Nucleotide-binding oligomerization domain-containing protein 2

Overview
NameNucleotide-binding oligomerization domain-containing protein 2
Smed IDSMED30022267
Length (bp)1484
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Nucleotide-binding oligomerization domain-containing protein 2 (SMED30022267) t-SNE clustered cells

Violin plots show distribution of expression levels for Nucleotide-binding oligomerization domain-containing protein 2 (SMED30022267) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Nucleotide-binding oligomerization domain-containing protein 2 (SMED30022267) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Nucleotide-binding oligomerization domain-containing protein 2 (SMED30022267) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022267

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30022267 dd_Smed_v4_18516_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30022267 dd_Smed_v4_17222_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. TrEMBL
Match: A0A2B4RBR1 (Uncharacterized protein OS=Stylophora pistillata OX=50429 GN=AWC38_SpisGene22068 PE=4 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 9.877e-22
Identity = 59/174 (33.91%), Postives = 103/174 (59.20%), Query Frame = 3
Query:   57 RKPTKEATLMVVRNEQVNIRERSYLSLRTI*IFLQNGNRKIKVNPLLDDAXXXXXXXXXXXXXLN*EGKAEIITVSVIDGKLQRMTTKRVKMTLVNYDQRMKKEFIALAVKNVCGDMRVVSWAKERE*WKHLNGIHFPMMDERQVVEVLIGVDYLGFQKCLREVEGKVGEPIAR 578
            R+   E +L    + + N++E  Y+ LRT+ + L++G RK+ VN LLDDASS + V+  V  +L  +G++  +TV+ ++G+     T  V+  + + D R+     A     V G+M+ V+WA+  + W HL  I+FP +  R +V++LIG+DY      +++V G+ G+P+AR
Sbjct:  328 RQQRSERSLTTTVHAKENVKE-EYIVLRTVPVILKSGGRKLVVNALLDDASSKTYVNSDVPAELGLQGESRKVTVNFLNGQEDTFETMPVECEIESLDGRISMRITAFTANRVTGNMKAVNWARYAKNWNHLKDINFPYLRPRPIVDILIGIDYADLHYSIKDVRGRPGKPVAR 500          
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. TrEMBL
Match: A0A2B4RVM7 (Uncharacterized protein OS=Stylophora pistillata OX=50429 GN=AWC38_SpisGene13841 PE=4 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 1.224e-20
Identity = 60/172 (34.88%), Postives = 99/172 (57.56%), Query Frame = 3
Query:   63 PTKEATLMVVRNEQVNIRERSYLSLRTI*IFLQNGNRKIKVNPLLDDAXXXXXXXXXXXXXLN*EGKAEIITVSVIDGKLQRMTTKRVKMTLVNYDQRMKKEFIALAVKNVCGDMRVVSWAKERE*WKHLNGIHFPMMDERQVVEVLIGVDYLGFQKCLREVEGKVGEPIAR 578
            P ++AT          I +  +L+LRT+ +FL+NG R+IKVN +LDDAS+ + ++  V  +L  +G  + +T++V++G+++   T  V++ L + D  +K    A   + V G+M+V+ W K      HL GI FP    R +V +LIG DY       ++V G+ GEP+AR
Sbjct:  220 PVEQATERSHTTLTSQIVQPRFLALRTVPVFLKNGYRRIKVNAMLDDASTKTYLNADVAAELGLQGHPQSVTLNVLNGQVETFETMPVEVELESLDGNLKVTISAFTAERVTGNMKVIDWGKYAVNCTHLKGIQFPNPGIRPIVGLLIGGDYAELHYSFKDVRGQPGEPVAR 391          
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. TrEMBL
Match: A0A2B4T023 (Uncharacterized protein OS=Stylophora pistillata OX=50429 GN=AWC38_SpisGene666 PE=4 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 4.276e-20
Identity = 54/150 (36.00%), Postives = 90/150 (60.00%), Query Frame = 3
Query:  129 LSLRTI*IFLQNGNRKIKVNPLLDDAXXXXXXXXXXXXXLN*EGKAEIITVSVIDGKLQRMTTKRVKMTLVNYDQRMKKEFIALAVKNVCGDMRVVSWAKERE*WKHLNGIHFPMMDERQVVEVLIGVDYLGFQKCLREVEGKVGEPIAR 578
            ++LRT+ +FL+N  R+IKVN LLDDAS+ + ++  V  +L  +G  + +TV+V++G+++   T  V++ L + D  +K        + V G++RV+ W K    + HL GI FP    R + ++LIG DY       ++V G+ GEP+AR
Sbjct:  291 VALRTVPVFLKNSYRRIKVNALLDDASTKTYLNADVAAELGLQGHPQSVTVNVLNGQVETFDTMPVEVELESLDGNVKVTISTFTAERVTGNLRVIDWGKYAVNYTHLKGIQFPNPGIRPIADLLIGGDYAELHYSFKDVRGQPGEPVAR 440          
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. TrEMBL
Match: A0A2B4S024 (DUF1758 domain-containing protein OS=Stylophora pistillata OX=50429 GN=AWC38_SpisGene13097 PE=4 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 1.216e-18
Identity = 52/151 (34.44%), Postives = 92/151 (60.93%), Query Frame = 3
Query:  126 YLSLRTI*IFLQNGNRKIKVNPLLDDAXXXXXXXXXXXXXLN*EGKAEIITVSVIDGKLQRMTTKRVKMTLVNYDQRMKKEFIALAVKNVCGDMRVVSWAKERE*WKHLNGIHFPMMDERQVVEVLIGVDYLGFQKCLREVEGKVGEPIAR 578
            +++L+T+ ++L NG ++++VN LLD+ SS + ++  V  +L  EG+   +TV V++   +++ +  V+ T+ + D ++ K   A   + V G+++VV+W   +  WKHL  I FP +  R + ++LIGVD       L +V GK GEPIAR
Sbjct:   54 FVALQTVPVYLTNGRKRVQVNALLDEGSSKAYLNSDVAAELGLEGRPHQLTVKVLNDNQEKLNSSIVEFTIHSLDGKVHKSTSAYTAERVTGNIQVVNWNLYKYKWKHLKSIKFPRVGPRPIDDLLIGVDQAELLCSLEDVTGKPGEPIAR 204          
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. TrEMBL
Match: A0A2B4SGX8 (Uncharacterized protein OS=Stylophora pistillata OX=50429 GN=AWC38_SpisGene6919 PE=4 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 1.867e-18
Identity = 73/289 (25.26%), Postives = 134/289 (46.37%), Query Frame = 3
Query:  126 YLSLRTI*IFLQNGNRKIKVNPLLDDAXXXXXXXXXXXXXLN*EGKAEIITVSVIDGKLQRMTTKRVKMTLVNYDQRMKKEFIALAVKNVCGDMRVVSWAKERE*WKHLNGIHFPMMDERQVVEVLIGVDYLGFQKCLREVEGKVGEPIAR*HYSDGHVSGKLS*KRH*LITLTSFKRIFQ*MKS**TK*KGLRRSKNIKNNTIHLTGNDQEVIRVMDEQLVKKDIYYQVNLTLKHGKCDLTNNRLIAMKRVQIQMRKVDKEKELRTEYQKILNEYEMKNYTQTLSRQK 992
            +++LRT+ ++L +G RKIKVN LLDD SS + ++     +L  EG A  +T++V++   +   +  V+ T+ + D ++ K+  A   + V G+M VV W + +  WKHL  I FP +  R  ++VLI  D       L++++G+ G+PIAR                     LT                 G+  ++ +  +T+                L   D +Y V +  K GK  L +   + + R++   +++ K  EL   Y+++L  Y+   Y   + +++
Sbjct:   17 FIALRTVPVYLASGQRKIKVNALLDDCSSRTYLNSDTVAELVLEGSAHELTLNVLNDNQETFESTVVEFTISSLDGKVSKQASAYTTERVTGNMEVVDWRRCQSKWKHLQSIEFPQVGPRTTLDVLIRADQADLLCSLKDLKGRSGKPIAR---------------------LTPL---------------GVNPNEKLARDTVA-------------NSLTFVDGHYTVVMPWKSGKRLLPDIYSMPLYRLRNTEKRLQKSPELSQAYERVLQTYQEAGYIHKVPQEE 256          
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000000863.1 (SMESG000000863.1)

HSP 1 Score: 227.639 bits (579), Expect = 1.071e-66
Identity = 144/322 (44.72%), Postives = 188/322 (58.39%), Query Frame = 3
Query:    3 CRETDCQRNHSCFLHECQRKPTKEATLMVVRNEQVNIRERSYLSLRTI*IFLQNGNRKIKVNPLLDDAXXXXXXXXXXXXXLN*EGKAEIITVSVIDGKLQRMTTKRVKMTLVNYDQRMKKEFIALAVKNVCGDMRVVSWAKERE*WKHLNGIHFPMMDERQVVEVLIGVDYLGFQKCLREVEGKVGEPIAR*HYSDGHVSGKLS*KRH*LITLTSFKRIFQ*MKS**TK*KGLRRSKNIKNNTIHLTGNDQEVIRVMDEQLVKKDIYYQVNLTLKHGKCDLTNNRLIAMKRVQIQMRKVDKEKELRTEYQKILNEYEMKNY 968
            C ETDC+R HS FLHE Q+K                           I  FL+N N++IKVN LLDDASSVS VSQ+V ++LN +GK E+ TVSVI GK+QRMTTKRV MTL++ DQRM KEF ALAVKNVCGDMRVVSWA+ERE WKHL  I+FPM+ ERQ V +LI  DYLG Q+ LREV+GK+G+PIAR                     LT+ + + +       + K +     I    +  +  D+ V     E L K D  Y+V +  K     L +++++A KR++  ++K+DKE  +R EY  I+  Y  K Y
Sbjct:  281 CGETDCRRKHSSFLHEVQKK---------------------------IPFFLRNSNKRIKVNALLDDASSVSYVSQRVLEELNLKGKDEVTTVSVIGGKVQRMTTKRVNMTLISSDQRMTKEFTALAVKNVCGDMRVVSWAEERENWKHLGNIYFPMIGERQTVNILIEADYLGLQRSLREVDGKMGDPIAR---------------------LTTLENVLE------DQMKRMWEIDEISLKEVEFSKLDKNVYEKTMESLQKVDRRYEVKIPWKRSPTLLPDSKVLAEKRLKSLLQKLDKEG-IREEYYGIIEGYRKKGY 547          
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000014680.1 (SMESG000014680.1)

HSP 1 Score: 212.616 bits (540), Expect = 1.888e-65
Identity = 104/107 (97.20%), Postives = 105/107 (98.13%), Query Frame = 1
Query: 1105 MKSRKKNFYDAIKDGKVSGCKDRTSNKYDNDCKLEIQNRSLMDRIDELLNREKRVPRELQCANSRLKQMDNDCITTIADTLNRETKAHQEYIKTLDGDRSYWKKESE 1425
            MKSRKKN YDAIKDGKVSGCKDRTSNKYDNDCKLEIQNRSLMDRIDELLNREKRV RELQCANSRLKQMDN+CITTIADTLNRETKAHQEYIKTLDGDRSYWKKESE
Sbjct:    1 MKSRKKNLYDAIKDGKVSGCKDRTSNKYDNDCKLEIQNRSLMDRIDELLNREKRVLRELQCANSRLKQMDNECITTIADTLNRETKAHQEYIKTLDGDRSYWKKESE 107          
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000034883.1 (SMESG000034883.1)

HSP 1 Score: 207.994 bits (528), Expect = 2.639e-61
Identity = 120/191 (62.83%), Postives = 142/191 (74.35%), Query Frame = 3
Query:    6 RETDCQRNHSCFLHECQRKPTKEATLMVVRNEQVNIRERSYLSLRTI*IFLQNGNRKIKVNPLLDDAXXXXXXXXXXXXXLN*EGKAEIITVSVIDGKLQRMTTKRVKMTLVNYDQRMKKEFIALAVKNVCGDMRVVSWAKERE*WKHLNGIHFPMMDERQVVEVLIGVDYLGFQKCLREVEGKVGEPIAR 578
            +ETDC R +S FLHE QRK T+EATLMVV+NE  N+RERSYLSLRT+ IFL+NGN+ IKVN LL DASSVS VSQ+V ++L+ +GK E+ T SV     QRM+TKRV MTL++ DQR  KEF ALAVKNVCGDMRVVSWAKERE                   +VLIG DYLG Q+ LREV+GK+G+PIAR
Sbjct:  287 KETDCLRKYSSFLHEVQRKTTEEATLMVVKNENANMRERSYLSLRTVPIFLRNGNKTIKVNVLLGDASSVSYVSQRVLEELDFKGKDEVKTASV-----QRMSTKRVNMTLISSDQRRTKEFTALAVKNVCGDMRVVSWAKERE-----------------NRDVLIGADYLGSQRSLREVDGKMGKPIAR 455          

HSP 2 Score: 47.7506 bits (112), Expect = 2.639e-61
Identity = 22/55 (40.00%), Postives = 33/55 (60.00%), Query Frame = 2
Query:  554 KSGRANRQITLLRWTCVGKIKLKAPLTHHTNFVQTYFSMNEELVDQVKRVKEIEK 718
            K G+   ++T L WTCVG   +     H  NF++T+FS    L +Q+KR+ EI+K
Sbjct:  448 KMGKPIARLTPLGWTCVGSTSVGTLWNHQNNFIRTFFSQENVLEEQMKRMWEIDK 502          
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000070566.1 (SMESG000070566.1)

HSP 1 Score: 176.792 bits (447), Expect = 2.245e-60
Identity = 88/115 (76.52%), Postives = 98/115 (85.22%), Query Frame = 1
Query: 1138 IKDGKVSGCKDRTSNKYDNDCKLEIQNRSLMDRIDELLNREKRVPRELQCANSRLKQMDNDCITTIADTLNRETKAHQEYIKTLDGDRSYWKKESECNA*DINAVYRRSIESDQD 1482
            IKDGKVSG KDR+S KYDNDC LEIQNR L+DRIDEL+NREK + REL C NSRL Q DNDCI TIAD+L RE +A QE+IKTL+GDRSYWKKE+ECNA D N VYR+SIESDQD
Sbjct:  323 IKDGKVSGYKDRSSIKYDNDCMLEIQNRKLLDRIDELVNREKCLLRELHCVNSRLTQRDNDCIPTIADSLEREIQALQEHIKTLEGDRSYWKKEAECNAQDKNDVYRKSIESDQD 437          

HSP 2 Score: 75.485 bits (184), Expect = 2.245e-60
Identity = 40/74 (54.05%), Postives = 53/74 (71.62%), Query Frame = 3
Query:  942 LNEYEMKNYTQTL--------SRQKELSGSRTIEHVTLENQT*SRDRIYEQFCMQIYLLEQRNEKSEKEFLRCN 1139
            LN+ +++NY++ +           KELSG RTIE ++LENQ  SRDRI+EQ CMQI LL+QRNE+ EKE +RCN
Sbjct:  246 LNDRKLENYSEQVVLYEEEIQRLTKELSGGRTIESLSLENQNRSRDRIHEQLCMQIDLLQQRNEELEKEVIRCN 319          
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000070566.1 (SMESG000070566.1)

HSP 1 Score: 176.792 bits (447), Expect = 2.736e-60
Identity = 88/115 (76.52%), Postives = 98/115 (85.22%), Query Frame = 1
Query: 1138 IKDGKVSGCKDRTSNKYDNDCKLEIQNRSLMDRIDELLNREKRVPRELQCANSRLKQMDNDCITTIADTLNRETKAHQEYIKTLDGDRSYWKKESECNA*DINAVYRRSIESDQD 1482
            IKDGKVSG KDR+S KYDNDC LEIQNR L+DRIDEL+NREK + REL C NSRL Q DNDCI TIAD+L RE +A QE+IKTL+GDRSYWKKE+ECNA D N VYR+SIESDQD
Sbjct:  323 IKDGKVSGYKDRSSIKYDNDCMLEIQNRKLLDRIDELVNREKCLLRELHCVNSRLTQRDNDCIPTIADSLEREIQALQEHIKTLEGDRSYWKKEAECNAQDKNDVYRKSIESDQD 437          

HSP 2 Score: 75.485 bits (184), Expect = 2.736e-60
Identity = 40/74 (54.05%), Postives = 53/74 (71.62%), Query Frame = 3
Query:  942 LNEYEMKNYTQTL--------SRQKELSGSRTIEHVTLENQT*SRDRIYEQFCMQIYLLEQRNEKSEKEFLRCN 1139
            LN+ +++NY++ +           KELSG RTIE ++LENQ  SRDRI+EQ CMQI LL+QRNE+ EKE +RCN
Sbjct:  246 LNDRKLENYSEQVVLYEEEIQRLTKELSGGRTIESLSLENQNRSRDRIHEQLCMQIDLLQQRNEELEKEVIRCN 319          
The following BLAST results are available for this feature:
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2B4RBR19.877e-2233.91Uncharacterized protein OS=Stylophora pistillata O... [more]
A0A2B4RVM71.224e-2034.88Uncharacterized protein OS=Stylophora pistillata O... [more]
A0A2B4T0234.276e-2036.00Uncharacterized protein OS=Stylophora pistillata O... [more]
A0A2B4S0241.216e-1834.44DUF1758 domain-containing protein OS=Stylophora pi... [more]
A0A2B4SGX81.867e-1825.26Uncharacterized protein OS=Stylophora pistillata O... [more]
back to top
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nucleotide-binding oligomerization domain-containing protein 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000000863.11.071e-6644.72SMESG000000863.1[more]
SMESG000014680.11.888e-6597.20SMESG000014680.1[more]
SMESG000034883.12.639e-6162.83SMESG000034883.1[more]
SMESG000070566.12.245e-6076.52SMESG000070566.1[more]
SMESG000070566.12.736e-6076.52SMESG000070566.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022267 ID=SMED30022267|Name=Nucleotide-binding oligomerization domain-containing protein 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1484bp
TTTGTAGAGAAACAGATTGCCAAAGAAACCACAGTTGTTTTCTACATGAA
TGTCAGAGAAAGCCTACCAAAGAAGCAACTTTAATGGTAGTGAGAAATGA
GCAAGTGAATATCAGGGAACGGAGTTACCTTAGTCTAAGGACAATTTAAA
TTTTTCTGCAGAACGGTAATAGGAAGATCAAAGTCAATCCTTTACTCGAT
GATGCCAGTTCCGTCAGTTAAGTAAGTCAAAAGGTTTAACAACAATTGAA
TTAAGAAGGAAAGGCAGAAATAATAACAGTGAGTGTCATAGATGGCAAAC
TTCAAAGAATGACCACAAAAAGAGTAAAAATGACTCTGGTAAATTATGAC
CAAAGGATGAAAAAAGAATTCATTGCTTTGGCTGTAAAAAATGTGTGTGG
AGACATGCGAGTGGTGAGTTGGGCTAAAGAAAGAGAATAATGGAAGCATT
TAAATGGCATTCACTTTCCTATGATGGATGAGCGACAGGTGGTGGAAGTA
CTGATTGGAGTGGACTACCTCGGTTTTCAGAAATGTTTGAGAGAAGTCGA
AGGAAAAGTGGGCGAGCCAATCGCCAGATAACACTACTCAGATGGACATG
TGTCGGGAAAATTAAGTTAAAAGCGCCATTGACTCATCACACTAACTTCG
TTCAAACGTATTTTTCAATGAATGAAGAGTTAGTAGACCAAGTGAAAAGG
GTTAAGGAGATCGAAAAATATCAAAAATAACACTATTCACTTGACGGGAA
ACGATCAAGAAGTAATTCGAGTTATGGATGAACAACTGGTCAAAAAAGAT
ATTTACTACCAGGTAAATTTAACGTTGAAGCATGGAAAGTGTGATTTGAC
AAACAACAGGTTGATAGCGATGAAACGTGTACAAATTCAAATGCGGAAAG
TAGACAAAGAGAAAGAGCTGAGAACGGAATATCAAAAGATATTAAATGAG
TATGAGATGAAAAATTATACTCAAACGTTGAGTAGACAAAAGGAATTGAG
TGGTAGCAGGACAATTGAACATGTAACTCTTGAAAATCAAACCTAATCAC
GGGATAGAATCTATGAGCAATTTTGCATGCAAATTTATCTGTTAGAACAA
CGAAATGAAAAGTCGGAAAAAGAATTTTTACGATGCAATTAAAGATGGAA
AGGTCTCGGGATGTAAAGATAGGACTTCTAATAAATATGACAACGATTGT
AAGCTGGAAATACAAAATAGGAGCTTAATGGACAGAATTGATGAATTATT
AAATAGAGAGAAACGTGTTCCCAGAGAATTGCAATGTGCTAACAGTAGAC
TCAAGCAAATGGACAACGACTGCATTACTACAATTGCAGATACCTTAAAT
AGGGAAACCAAAGCTCATCAAGAGTACATCAAAACATTGGATGGAGATCG
TAGTTATTGGAAAAAAGAGTCCGAATGTAATGCTTAGGATATAAATGCTG
TTTATAGAAGATCTATTGAAAGCGATCAAGATTA
back to top

protein sequence of SMED30022267-orf-1

>SMED30022267-orf-1 ID=SMED30022267-orf-1|Name=SMED30022267-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=111bp
MKSRKKNFYDAIKDGKVSGCKDRTSNKYDNDCKLEIQNRSLMDRIDELLN
REKRVPRELQCANSRLKQMDNDCITTIADTLNRETKAHQEYIKTLDGDRS
YWKKESECNA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0015074DNA integration
GO:0006508proteolysis
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: molecular function
TermDefinition
GO:0004190aspartic-type endopeptidase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 38..72