Clathrin interactor 1

Overview
NameClathrin interactor 1
Smed IDSMED30022249
Length (bp)1515
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Clathrin interactor 1 (SMED30022249) t-SNE clustered cells

Violin plots show distribution of expression levels for Clathrin interactor 1 (SMED30022249) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Clathrin interactor 1 (SMED30022249) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Clathrin interactor 1 (SMED30022249) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022249

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30022249SMESG000032527.1 Contig439newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30022249SMESG000053020.1 SMESG000053011.1 Contig439newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30022249SMESG000032527.1 SMESG000022725.1 dd_Smed_v4_1563_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30022249SMESG000032527.1 SMESG000022725.1 dd_Smed_v4_1563_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30022249SMESG000032527.1 SMESG000022725.1 dd_Smed_v4_1563_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30022249SMESG000032527.1 SMESG000022725.1 dd_Smed_v4_1563_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30022249SMESG000032527.1 SMESG000022725.1 dd_Smed_v6_1563_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
glial cellSMED30022249SMESG000032527.1 SMESG000022725.1 dd_Smed_v6_1563_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
oocyteSMED30022249SMESG000032527.1 SMESG000023958.1 Contig19768newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30022249SMESG000032527.1 SMESG000023958.1 Contig19768newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30022249SMESG000032527.1 SMESG000023958.1 Contig19768uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30022249SMESG000032527.1 SMESG000023958.1 Contig19768uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
testisSMED30022249SMESG000032527.1 PL030006A20A10ncbi_smed_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
epidermisSMED30022249SMESG000032527.1 SMESG000022725.1 dd_Smed_v4_1563_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Clathrin interactor 1 vs. Ensembl Human
Match: CLINT1 (clathrin interactor 1 [Source:HGNC Symbol;Acc:HGNC:23186])

HSP 1 Score: 128.257 bits (321), Expect = 6.790e-31
Identity = 62/142 (43.66%), Postives = 87/142 (61.27%), Query Frame = 3
Query:  147 KDIANKLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQSY--IDGHGV-ADVAIRRKASDICDLLSDSQRLSDER 563
            +++ +K TN  +N SEIE K++ ATNDD WGP+G LM EIA  TF      E+M  LW R+  +   N RR YK L+LL YLI NGSE +  S R H+ D++ L++Y  +D HG    + IR+K  ++ +   D  RL +ER
Sbjct:    8 RELVDKATNVVMNYSEIESKVREATNDDPWGPSGQLMGEIAKATFMYEQFPELMNMLWSRMLKDNKKNWRRVYKSLLLLAYLIRNGSERVVTSAREHIYDLRSLENYHFVDEHGKDQGINIRQKVKELVEFAQDDDRLREER 149          
BLAST of Clathrin interactor 1 vs. Ensembl Human
Match: CLINT1 (clathrin interactor 1 [Source:HGNC Symbol;Acc:HGNC:23186])

HSP 1 Score: 127.872 bits (320), Expect = 6.981e-31
Identity = 62/142 (43.66%), Postives = 87/142 (61.27%), Query Frame = 3
Query:  147 KDIANKLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQSY--IDGHGV-ADVAIRRKASDICDLLSDSQRLSDER 563
            +++ +K TN  +N SEIE K++ ATNDD WGP+G LM EIA  TF      E+M  LW R+  +   N RR YK L+LL YLI NGSE +  S R H+ D++ L++Y  +D HG    + IR+K  ++ +   D  RL +ER
Sbjct:    8 RELVDKATNVVMNYSEIESKVREATNDDPWGPSGQLMGEIAKATFMYEQFPELMNMLWSRMLKDNKKNWRRVYKSLLLLAYLIRNGSERVVTSAREHIYDLRSLENYHFVDEHGKDQGINIRQKVKELVEFAQDDDRLREER 149          
BLAST of Clathrin interactor 1 vs. Ensembl Human
Match: CLINT1 (clathrin interactor 1 [Source:HGNC Symbol;Acc:HGNC:23186])

HSP 1 Score: 121.709 bits (304), Expect = 9.717e-29
Identity = 59/131 (45.04%), Postives = 80/131 (61.07%), Query Frame = 3
Query:  180 LNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQSY--IDGHGV-ADVAIRRKASDICDLLSDSQRLSDER 563
            +N SEIE K++ ATNDD WGP+G LM EIA  TF      E+M  LW R+  +   N RR YK L+LL YLI NGSE +  S R H+ D++ L++Y  +D HG    + IR+K  ++ +   D  RL +ER
Sbjct:    1 MNYSEIESKVREATNDDPWGPSGQLMGEIAKATFMYEQFPELMNMLWSRMLKDNKKNWRRVYKSLLLLAYLIRNGSERVVTSAREHIYDLRSLENYHFVDEHGKDQGINIRQKVKELVEFAQDDDRLREER 131          
BLAST of Clathrin interactor 1 vs. Ensembl Human
Match: CLINT1 (clathrin interactor 1 [Source:HGNC Symbol;Acc:HGNC:23186])

HSP 1 Score: 121.709 bits (304), Expect = 9.717e-29
Identity = 59/131 (45.04%), Postives = 80/131 (61.07%), Query Frame = 3
Query:  180 LNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQSY--IDGHGV-ADVAIRRKASDICDLLSDSQRLSDER 563
            +N SEIE K++ ATNDD WGP+G LM EIA  TF      E+M  LW R+  +   N RR YK L+LL YLI NGSE +  S R H+ D++ L++Y  +D HG    + IR+K  ++ +   D  RL +ER
Sbjct:    1 MNYSEIESKVREATNDDPWGPSGQLMGEIAKATFMYEQFPELMNMLWSRMLKDNKKNWRRVYKSLLLLAYLIRNGSERVVTSAREHIYDLRSLENYHFVDEHGKDQGINIRQKVKELVEFAQDDDRLREER 131          
BLAST of Clathrin interactor 1 vs. Ensembl Human
Match: EPN3 (epsin 3 [Source:HGNC Symbol;Acc:HGNC:18235])

HSP 1 Score: 104.375 bits (259), Expect = 1.214e-25
Identity = 61/143 (42.66%), Postives = 80/143 (55.94%), Query Frame = 3
Query:  153 IANKLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQ--SYIDGHGV-ADVAIRRKASDICDLLSDSQRLSDERKRA 572
            +  ++ N   N SE E+K++ AT++D WGP  SLM EIAD TF+T    EVM  LW R+  +   N R  YK L LL YL+  GSE +A  CR +L  I+ L+   YID  G    V +R K   +  LL D +RL  ER  A
Sbjct:    6 LRRQVKNIVHNYSEAEIKVREATSNDPWGPPSSLMSEIADLTFNTVAFTEVMGMLWRRL-NDSGKNWRHVYKALTLLDYLLKTGSERVAHQCRENLYTIQTLKDFQYIDRDGKDQGVNVREKVKQVMALLKDEERLRQERTHA 147          
BLAST of Clathrin interactor 1 vs. Ensembl Celegans
Match: epn-1 (EPsiN (Endocytic protein) homolog [Source:UniProtKB/TrEMBL;Acc:Q9BI72])

HSP 1 Score: 103.99 bits (258), Expect = 1.203e-23
Identity = 62/169 (36.69%), Postives = 94/169 (55.62%), Query Frame = 3
Query:  153 IANKLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQSY--IDGHGVADVAIRRKASDICDLLSDSQRLSDERKRAKSYHQTRNYRSATVTGADGSDSNRQTR 653
            I  ++ N   N S+ +VK++ AT++D WGP+ +LM EIAD T +     E+M+ +W R+  +   N R  YK LVLL +LI  G E +A  CR ++  I+ L+ +  ++ +    + IR KA  I  LLSD +RL +ER R   +  TRN       G  G++S R  R
Sbjct:    6 IRRQVKNVAYNFSDAQVKVREATSNDPWGPSTALMSEIADLTHNPMAFTEIMSIVWKRL-NDSGKNWRHVYKSLVLLDFLIKCGHEKVAQQCRENVFTIETLKDFQHVEDNRDQGLNIREKAKQITSLLSDDERLKNERTR---FILTRNKFKQNNPGPVGAESRRSNR 170          
BLAST of Clathrin interactor 1 vs. Ensembl Celegans
Match: epn-1 (EPsiN (Endocytic protein) homolog [Source:UniProtKB/TrEMBL;Acc:Q9BI72])

HSP 1 Score: 103.99 bits (258), Expect = 1.207e-23
Identity = 62/169 (36.69%), Postives = 94/169 (55.62%), Query Frame = 3
Query:  153 IANKLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQSY--IDGHGVADVAIRRKASDICDLLSDSQRLSDERKRAKSYHQTRNYRSATVTGADGSDSNRQTR 653
            I  ++ N   N S+ +VK++ AT++D WGP+ +LM EIAD T +     E+M+ +W R+  +   N R  YK LVLL +LI  G E +A  CR ++  I+ L+ +  ++ +    + IR KA  I  LLSD +RL +ER R   +  TRN       G  G++S R  R
Sbjct:    6 IRRQVKNVAYNFSDAQVKVREATSNDPWGPSTALMSEIADLTHNPMAFTEIMSIVWKRL-NDSGKNWRHVYKSLVLLDFLIKCGHEKVAQQCRENVFTIETLKDFQHVEDNRDQGLNIREKAKQITSLLSDDERLKNERTR---FILTRNKFKQNNPGPVGAESRRSNR 170          
BLAST of Clathrin interactor 1 vs. Ensembl Celegans
Match: rsd-3 (pep chromosome:WBcel235:X:11798505:11803656:1 gene:WBGene00004682.1 transcript:C34E11.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:rsd-3)

HSP 1 Score: 83.1889 bits (204), Expect = 9.441e-17
Identity = 48/157 (30.57%), Postives = 83/157 (52.87%), Query Frame = 3
Query:  147 KDIANKLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFS--TTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQS--YIDGHGV-ADVAIRRKASDICDLLSDSQRLSDERKRAKSYHQTRNYR 602
            + +   + +  +N  +  + ++ ATN+D WGP G  M++I + T S    +   V T L+ R+        RR YK L+LL YL+ NGSE      R    ++++L+S  YID  G    + IR +   I ++++D + L  ER++A S  +++ YR
Sbjct:   26 RKVTESMNDAIMNYPKAMMDVREATNEDPWGPTGPQMKKICEYTRSRYMEDFYNVYTPLFQRMLENNKDAWRRVYKSLILLDYLLKNGSERFVQEAREKAYELRRLESYKYIDEKGKDQGINIRHRVKQILEMMNDDELLQAERQKANSDDKSK-YR 181          
BLAST of Clathrin interactor 1 vs. Ensembl Fly
Match: lqfR (gene:FBgn0261279 transcript:FBtr0299515)

HSP 1 Score: 129.028 bits (323), Expect = 1.963e-31
Identity = 60/142 (42.25%), Postives = 89/142 (62.68%), Query Frame = 3
Query:  147 KDIANKLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQSYI---DGHGVADVAIRRKASDICDLLSDSQRLSDER 563
            +++A+K+TN  +N +E E K++ ATNDD WGP G LM+E+A  TFS     EVM+ LW R+  +   N RRTYK L+LL YL+ NGSE +  S R H+ D++ L++Y    +G     + +R K  ++ D + D  RL +ER
Sbjct:   12 RELADKVTNVVMNYTETEGKVREATNDDPWGPTGPLMQELAYSTFSYETFPEVMSMLWKRMLQDNKTNWRRTYKSLLLLNYLVRNGSERVVTSSREHIYDLRSLENYTFTDEGGKDQGINVRHKVRELIDFIQDDDRLREER 153          
BLAST of Clathrin interactor 1 vs. Ensembl Fly
Match: lqfR (gene:FBgn0261279 transcript:FBtr0299516)

HSP 1 Score: 126.716 bits (317), Expect = 1.859e-30
Identity = 60/142 (42.25%), Postives = 89/142 (62.68%), Query Frame = 3
Query:  147 KDIANKLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQSYI---DGHGVADVAIRRKASDICDLLSDSQRLSDER 563
            +++A+K+TN  +N +E E K++ ATNDD WGP G LM+E+A  TFS     EVM+ LW R+  +   N RRTYK L+LL YL+ NGSE +  S R H+ D++ L++Y    +G     + +R K  ++ D + D  RL +ER
Sbjct:   12 RELADKVTNVVMNYTETEGKVREATNDDPWGPTGPLMQELAYSTFSYETFPEVMSMLWKRMLQDNKTNWRRTYKSLLLLNYLVRNGSERVVTSSREHIYDLRSLENYTFTDEGGKDQGINVRHKVRELIDFIQDDDRLREER 153          
BLAST of Clathrin interactor 1 vs. Ensembl Fly
Match: lqf (gene:FBgn0028582 transcript:FBtr0076796)

HSP 1 Score: 100.523 bits (249), Expect = 5.091e-22
Identity = 53/157 (33.76%), Postives = 90/157 (57.32%), Query Frame = 3
Query:  165 LTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQSYIDGHGVADVA--IRRKASDICDLLSDSQRLSDERKRAKSYHQTRNYRSATVTGADG 629
            + N   N S+ +VK++ AT++D WGP+ ++M EIA+ T++     E+M  +W R+  +   N R  YK L+LL YLI  GSE +A  C+ ++  I+ L+ ++      D    +R KA  +  LL D +RL +ER +A+   + R  ++ +  G+DG
Sbjct:   12 IKNLAHNYSDAQVKVREATSNDPWGPSAAIMSEIAELTYNVVAFSEIMQMIWKRL-NDHGKNWRHVYKALILLEYLIKTGSEKVAQQCKENIFAIQTLREFVYFEEGKDQGTHVREKAKQLVTLLKDDERLKNERVKAQKAKE-RFAQNPSGFGSDG 166          
BLAST of Clathrin interactor 1 vs. Ensembl Fly
Match: lqf (gene:FBgn0028582 transcript:FBtr0076794)

HSP 1 Score: 100.523 bits (249), Expect = 5.091e-22
Identity = 53/157 (33.76%), Postives = 90/157 (57.32%), Query Frame = 3
Query:  165 LTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQSYIDGHGVADVA--IRRKASDICDLLSDSQRLSDERKRAKSYHQTRNYRSATVTGADG 629
            + N   N S+ +VK++ AT++D WGP+ ++M EIA+ T++     E+M  +W R+  +   N R  YK L+LL YLI  GSE +A  C+ ++  I+ L+ ++      D    +R KA  +  LL D +RL +ER +A+   + R  ++ +  G+DG
Sbjct:   12 IKNLAHNYSDAQVKVREATSNDPWGPSAAIMSEIAELTYNVVAFSEIMQMIWKRL-NDHGKNWRHVYKALILLEYLIKTGSEKVAQQCKENIFAIQTLREFVYFEEGKDQGTHVREKAKQLVTLLKDDERLKNERVKAQKAKE-RFAQNPSGFGSDG 166          
BLAST of Clathrin interactor 1 vs. Ensembl Fly
Match: lqf (gene:FBgn0028582 transcript:FBtr0076798)

HSP 1 Score: 100.523 bits (249), Expect = 5.215e-22
Identity = 53/157 (33.76%), Postives = 90/157 (57.32%), Query Frame = 3
Query:  165 LTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQSYIDGHGVADVA--IRRKASDICDLLSDSQRLSDERKRAKSYHQTRNYRSATVTGADG 629
            + N   N S+ +VK++ AT++D WGP+ ++M EIA+ T++     E+M  +W R+  +   N R  YK L+LL YLI  GSE +A  C+ ++  I+ L+ ++      D    +R KA  +  LL D +RL +ER +A+   + R  ++ +  G+DG
Sbjct:   19 IKNLAHNYSDAQVKVREATSNDPWGPSAAIMSEIAELTYNVVAFSEIMQMIWKRL-NDHGKNWRHVYKALILLEYLIKTGSEKVAQQCKENIFAIQTLREFVYFEEGKDQGTHVREKAKQLVTLLKDDERLKNERVKAQKAKE-RFAQNPSGFGSDG 173          
BLAST of Clathrin interactor 1 vs. Ensembl Zebrafish
Match: clint1a (clathrin interactor 1a [Source:ZFIN;Acc:ZDB-GENE-030131-2590])

HSP 1 Score: 133.65 bits (335), Expect = 5.693e-33
Identity = 79/215 (36.74%), Postives = 118/215 (54.88%), Query Frame = 3
Query:  147 KDIANKLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQSY--IDGHGV-ADVAIRRKASDICDLLSDSQRLSDERKRAKSYHQTR-NYRSATVTGADGSDSNRQTRNAQPLGDIDDWD-----IPGSKSLPHV---IGESFMNFVNTF 755
            +++ +K TN  +N +E E K++ ATNDD WGP+G LM EIA  TF      EVM  LW R+  +   N RR YK L+LL YLI NGSE +  S R HL D++ ++SY  +D +G    V +R+K  ++ + + D  RL +ERK+AK          S +++G   S+    +R  +   D DDW+      P S+ L  +   IG +  + +N F
Sbjct:    8 RELVDKATNVVMNYTETESKVREATNDDPWGPSGQLMGEIARCTFMYEQFPEVMNMLWTRMLKDNKKNWRRVYKSLLLLAYLIRNGSERVVTSAREHLYDLRSIESYHCVDENGKDQGVNVRQKVKELIEFVQDDDRLREERKKAKKNRDKYIGVSSDSMSGFRYSEDRFDSREPRSKWD-DDWEKNKGAFPFSEKLGEISDKIGSTIDDTINMF 221          
BLAST of Clathrin interactor 1 vs. Ensembl Zebrafish
Match: clint1a (clathrin interactor 1a [Source:ZFIN;Acc:ZDB-GENE-030131-2590])

HSP 1 Score: 129.413 bits (324), Expect = 1.600e-31
Identity = 78/208 (37.50%), Postives = 113/208 (54.33%), Query Frame = 3
Query:  168 TNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQSY--IDGHGV-ADVAIRRKASDICDLLSDSQRLSDERKRAKSYHQTR-NYRSATVTGADGSDSNRQTRNAQPLGDIDDWD-----IPGSKSLPHV---IGESFMNFVNTF 755
            TN  +N +E E K++ ATNDD WGP+G LM EIA  TF      EVM  LW R+  +   N RR YK L+LL YLI NGSE +  S R HL D++ ++SY  +D +G    V +R+K  ++ + + D  RL +ERK+AK          S +++G   S+    +R  +   D DDW+      P S+ L  +   IG +  + +N F
Sbjct:   26 TNVVMNYTETESKVREATNDDPWGPSGQLMGEIARCTFMYEQFPEVMNMLWTRMLKDNKKNWRRVYKSLLLLAYLIRNGSERVVTSAREHLYDLRSIESYHCVDENGKDQGVNVRQKVKELIEFVQDDDRLREERKKAKKNRDKYIGVSSDSMSGFRYSEDRFDSREPRSKWD-DDWEKNKGAFPFSEKLGEISDKIGSTIDDTINMF 232          
BLAST of Clathrin interactor 1 vs. Ensembl Zebrafish
Match: epn3b (epsin 3b [Source:ZFIN;Acc:ZDB-GENE-121214-173])

HSP 1 Score: 100.523 bits (249), Expect = 2.211e-23
Identity = 57/143 (39.86%), Postives = 79/143 (55.24%), Query Frame = 3
Query:  153 IANKLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQ--SYIDGHGV-ADVAIRRKASDICDLLSDSQRLSDERKRA 572
            +  ++ N   N S+ E+K++ AT++D WGP+ SLM EIA+ TFS     EVM  +W R+  +   N R  YK L LL YL   GSE +A  CR +   I+ L+   Y+D  G    V +R KA  +  LL D  RL  ER +A
Sbjct:   12 LRRQVKNIVHNYSDAEIKVREATSNDPWGPSSSLMSEIAELTFSVVAFSEVMAMVWKRL-NDHGKNWRHVYKALTLLDYLAKTGSERVAQQCRENAFTIQTLRDFQYVDRDGRDQGVNVREKAKQLVALLRDEDRLRAERAQA 153          
BLAST of Clathrin interactor 1 vs. Ensembl Zebrafish
Match: epn1 (epsin 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2680])

HSP 1 Score: 104.76 bits (260), Expect = 2.575e-23
Identity = 55/140 (39.29%), Postives = 82/140 (58.57%), Query Frame = 3
Query:  162 KLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQ--SYIDGHGV-ADVAIRRKASDICDLLSDSQRLSDERKRA 572
            ++ N   N SE E+K++ AT++D WGP+ SLM EIAD T++     E+M+ +W R+  +   N R  YK + L+ YLI  GSE +A  CR ++  ++ L+   YID  G    V +R KA  +  LL D +RL +ER  A
Sbjct:    9 QVKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMVWKRL-NDHGKNWRHVYKAMTLMEYLIKTGSERVAQQCRENIYAVQTLKDFQYIDRDGKDQGVNVREKAKQLVTLLKDEERLREERIHA 147          
BLAST of Clathrin interactor 1 vs. Ensembl Zebrafish
Match: epn1 (epsin 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2680])

HSP 1 Score: 104.375 bits (259), Expect = 2.779e-23
Identity = 55/140 (39.29%), Postives = 82/140 (58.57%), Query Frame = 3
Query:  162 KLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQ--SYIDGHGV-ADVAIRRKASDICDLLSDSQRLSDERKRA 572
            ++ N   N SE E+K++ AT++D WGP+ SLM EIAD T++     E+M+ +W R+  +   N R  YK + L+ YLI  GSE +A  CR ++  ++ L+   YID  G    V +R KA  +  LL D +RL +ER  A
Sbjct:    9 QVKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMVWKRL-NDHGKNWRHVYKAMTLMEYLIKTGSERVAQQCRENIYAVQTLKDFQYIDRDGKDQGVNVREKAKQLVTLLKDEERLREERIHA 147          
BLAST of Clathrin interactor 1 vs. Ensembl Xenopus
Match: cyct (cytochrome c, testis [Source:Xenbase;Acc:XB-GENE-5931974])

HSP 1 Score: 125.561 bits (314), Expect = 4.360e-30
Identity = 59/142 (41.55%), Postives = 88/142 (61.97%), Query Frame = 3
Query:  147 KDIANKLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQSY--IDGHGV-ADVAIRRKASDICDLLSDSQRLSDER 563
            +++ +K TN  +N SEIE K++ ATNDD WGP+G LM EIA  TF      ++M  LW R+  +   N RR YK ++LL YLI NGSE +  S R H+ D++ L++Y  +D +G    + IR+K  ++ + + D  RL +ER
Sbjct:    8 RELVDKATNVVMNYSEIESKVREATNDDPWGPSGQLMGEIAKATFMYEQFPDLMNMLWTRMLKDNKKNWRRVYKSMLLLAYLIRNGSERVVTSAREHIYDLRSLENYHFVDENGKDQGINIRQKVKEMVEFIQDDDRLREER 149          
BLAST of Clathrin interactor 1 vs. Ensembl Xenopus
Match: cyct (cytochrome c, testis [Source:Xenbase;Acc:XB-GENE-5931974])

HSP 1 Score: 120.553 bits (301), Expect = 1.721e-28
Identity = 58/135 (42.96%), Postives = 83/135 (61.48%), Query Frame = 3
Query:  168 TNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQSY--IDGHGV-ADVAIRRKASDICDLLSDSQRLSDER 563
            TN  +N SEIE K++ ATNDD WGP+G LM EIA  TF      ++M  LW R+  +   N RR YK ++LL YLI NGSE +  S R H+ D++ L++Y  +D +G    + IR+K  ++ + + D  RL +ER
Sbjct:   20 TNVVMNYSEIESKVREATNDDPWGPSGQLMGEIAKATFMYEQFPDLMNMLWTRMLKDNKKNWRRVYKSMLLLAYLIRNGSERVVTSAREHIYDLRSLENYHFVDENGKDQGINIRQKVKEMVEFIQDDDRLREER 154          
BLAST of Clathrin interactor 1 vs. Ensembl Xenopus
Match: cyct (cytochrome c, testis [Source:Xenbase;Acc:XB-GENE-5931974])

HSP 1 Score: 120.553 bits (301), Expect = 2.033e-28
Identity = 58/135 (42.96%), Postives = 83/135 (61.48%), Query Frame = 3
Query:  168 TNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQSY--IDGHGV-ADVAIRRKASDICDLLSDSQRLSDER 563
            TN  +N SEIE K++ ATNDD WGP+G LM EIA  TF      ++M  LW R+  +   N RR YK ++LL YLI NGSE +  S R H+ D++ L++Y  +D +G    + IR+K  ++ + + D  RL +ER
Sbjct:   20 TNVVMNYSEIESKVREATNDDPWGPSGQLMGEIAKATFMYEQFPDLMNMLWTRMLKDNKKNWRRVYKSMLLLAYLIRNGSERVVTSAREHIYDLRSLENYHFVDENGKDQGINIRQKVKEMVEFIQDDDRLREER 154          
BLAST of Clathrin interactor 1 vs. Ensembl Xenopus
Match: uvssa (UV stimulated scaffold protein A [Source:Xenbase;Acc:XB-GENE-5833232])

HSP 1 Score: 105.916 bits (263), Expect = 1.501e-23
Identity = 54/140 (38.57%), Postives = 82/140 (58.57%), Query Frame = 3
Query:  162 KLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQ--SYIDGHGV-ADVAIRRKASDICDLLSDSQRLSDERKRA 572
            ++ N   N SE E+K++ AT++D WGP+ SLM EIAD T++     E+M+ +W R+  +   N R  YK + L+ YLI  GSE +A  C+ ++  I+ L+   Y+D  G    V +R KA  +  LL D +RL +ER  A
Sbjct:    9 QMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRL-NDHGKNWRHVYKAMTLMEYLIKTGSERVAQQCKENIYAIQTLKDFQYVDRDGKDQGVNVREKAKQLVSLLKDDERLKEERAHA 147          
BLAST of Clathrin interactor 1 vs. Ensembl Xenopus
Match: uvssa (UV stimulated scaffold protein A [Source:Xenbase;Acc:XB-GENE-5833232])

HSP 1 Score: 105.916 bits (263), Expect = 1.527e-23
Identity = 54/140 (38.57%), Postives = 82/140 (58.57%), Query Frame = 3
Query:  162 KLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQ--SYIDGHGV-ADVAIRRKASDICDLLSDSQRLSDERKRA 572
            ++ N   N SE E+K++ AT++D WGP+ SLM EIAD T++     E+M+ +W R+  +   N R  YK + L+ YLI  GSE +A  C+ ++  I+ L+   Y+D  G    V +R KA  +  LL D +RL +ER  A
Sbjct:    9 QMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRL-NDHGKNWRHVYKAMTLMEYLIKTGSERVAQQCKENIYAIQTLKDFQYVDRDGKDQGVNVREKAKQLVSLLKDDERLKEERAHA 147          
BLAST of Clathrin interactor 1 vs. Ensembl Mouse
Match: Clint1 (clathrin interactor 1 [Source:MGI Symbol;Acc:MGI:2144243])

HSP 1 Score: 128.257 bits (321), Expect = 4.086e-31
Identity = 62/142 (43.66%), Postives = 87/142 (61.27%), Query Frame = 3
Query:  147 KDIANKLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQSY--IDGHGV-ADVAIRRKASDICDLLSDSQRLSDER 563
            +++ +K TN  +N SEIE K++ ATNDD WGP+G LM EIA  TF      E+M  LW R+  +   N RR YK L+LL YLI NGSE +  S R H+ D++ L++Y  +D HG    + IR+K  ++ +   D  RL +ER
Sbjct:    8 RELVDKATNVVMNYSEIESKVREATNDDPWGPSGQLMGEIAKATFMYEQFPELMNMLWSRMLKDNKKNWRRVYKSLLLLAYLIRNGSERVVTSAREHIYDLRSLENYHFVDEHGKDQGINIRQKVKELVEFAQDDDRLREER 149          
BLAST of Clathrin interactor 1 vs. Ensembl Mouse
Match: Clint1 (clathrin interactor 1 [Source:MGI Symbol;Acc:MGI:2144243])

HSP 1 Score: 128.257 bits (321), Expect = 4.578e-31
Identity = 62/142 (43.66%), Postives = 87/142 (61.27%), Query Frame = 3
Query:  147 KDIANKLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQSY--IDGHGV-ADVAIRRKASDICDLLSDSQRLSDER 563
            +++ +K TN  +N SEIE K++ ATNDD WGP+G LM EIA  TF      E+M  LW R+  +   N RR YK L+LL YLI NGSE +  S R H+ D++ L++Y  +D HG    + IR+K  ++ +   D  RL +ER
Sbjct:    8 RELVDKATNVVMNYSEIESKVREATNDDPWGPSGQLMGEIAKATFMYEQFPELMNMLWSRMLKDNKKNWRRVYKSLLLLAYLIRNGSERVVTSAREHIYDLRSLENYHFVDEHGKDQGINIRQKVKELVEFAQDDDRLREER 149          
BLAST of Clathrin interactor 1 vs. Ensembl Mouse
Match: Epn3 (epsin 3 [Source:MGI Symbol;Acc:MGI:1919139])

HSP 1 Score: 106.686 bits (265), Expect = 5.619e-24
Identity = 60/143 (41.96%), Postives = 80/143 (55.94%), Query Frame = 3
Query:  153 IANKLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQ--SYIDGHGV-ADVAIRRKASDICDLLSDSQRLSDERKRA 572
            +  ++ N   N SE E+K++ AT++D WGP  SLM EIAD TF+T    EVM  +W R+  +   N R  YK L LL YL+  GSE +A  CR +L  I+ L+   YID  G    V +R K   +  LL D +RL  ER  A
Sbjct:    6 LRRQVKNIVHNYSEAEIKVREATSNDPWGPPSSLMSEIADLTFNTVAFAEVMGMVWRRL-NDSGKNWRHVYKALTLLDYLLKTGSERVAHQCRENLYTIQTLKDFQYIDRDGKDQGVNVREKVKQVMALLKDEERLRQERTHA 147          
BLAST of Clathrin interactor 1 vs. Ensembl Mouse
Match: Epn2 (epsin 2 [Source:MGI Symbol;Acc:MGI:1333766])

HSP 1 Score: 105.145 bits (261), Expect = 1.776e-23
Identity = 57/143 (39.86%), Postives = 83/143 (58.04%), Query Frame = 3
Query:  153 IANKLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQ--SYIDGHGV-ADVAIRRKASDICDLLSDSQRLSDERKRA 572
            I  ++ N   N SE E+K++ AT++D WGP+ SLM EIAD T++     E+M+ +W R+  +   N R  YK L LL YLI  GSE +A  CR ++  I+ L+   YID  G    + +R K+  +  LL D +RL  ER +A
Sbjct:    6 IRRQMKNIVNNYSEAEIKVREATSNDPWGPSSSLMTEIADLTYNVVAFSEIMSMVWKRL-NDHGKNWRHVYKALTLLDYLIKTGSERVAQQCRENIFAIQTLKDFQYIDRDGKDQGINVREKSKQLVALLKDEERLKVERVQA 147          
BLAST of Clathrin interactor 1 vs. Ensembl Mouse
Match: Epn2 (epsin 2 [Source:MGI Symbol;Acc:MGI:1333766])

HSP 1 Score: 105.145 bits (261), Expect = 1.867e-23
Identity = 57/143 (39.86%), Postives = 83/143 (58.04%), Query Frame = 3
Query:  153 IANKLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQ--SYIDGHGV-ADVAIRRKASDICDLLSDSQRLSDERKRA 572
            I  ++ N   N SE E+K++ AT++D WGP+ SLM EIAD T++     E+M+ +W R+  +   N R  YK L LL YLI  GSE +A  CR ++  I+ L+   YID  G    + +R K+  +  LL D +RL  ER +A
Sbjct:    6 IRRQMKNIVNNYSEAEIKVREATSNDPWGPSSSLMTEIADLTYNVVAFSEIMSMVWKRL-NDHGKNWRHVYKALTLLDYLIKTGSERVAQQCRENIFAIQTLKDFQYIDRDGKDQGINVREKSKQLVALLKDEERLKVERVQA 147          
BLAST of Clathrin interactor 1 vs. UniProt/SwissProt
Match: sp|A7Z035|EPN4_BOVIN (Clathrin interactor 1 OS=Bos taurus OX=9913 GN=CLINT1 PE=2 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 3.230e-30
Identity = 62/142 (43.66%), Postives = 87/142 (61.27%), Query Frame = 3
Query:  147 KDIANKLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQSY--IDGHGV-ADVAIRRKASDICDLLSDSQRLSDER 563
            +++ +K TN  +N SEIE K++ ATNDD WGP+G LM EIA  TF      E+M  LW R+  +   N RR YK L+LL YLI NGSE +  S R H+ D++ L++Y  +D HG    + IR+K  ++ +   D  RL +ER
Sbjct:    8 RELVDKATNVVMNYSEIESKVREATNDDPWGPSGQLMGEIAKATFMYEQFPELMNMLWSRMLKDNKKNWRRVYKSLLLLAYLIRNGSERVVTSAREHIYDLRSLENYHFVDEHGKDQGINIRQKVKELVEFAQDDDRLREER 149          
BLAST of Clathrin interactor 1 vs. UniProt/SwissProt
Match: sp|Q14677|EPN4_HUMAN (Clathrin interactor 1 OS=Homo sapiens OX=9606 GN=CLINT1 PE=1 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 3.352e-30
Identity = 62/142 (43.66%), Postives = 87/142 (61.27%), Query Frame = 3
Query:  147 KDIANKLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQSY--IDGHGV-ADVAIRRKASDICDLLSDSQRLSDER 563
            +++ +K TN  +N SEIE K++ ATNDD WGP+G LM EIA  TF      E+M  LW R+  +   N RR YK L+LL YLI NGSE +  S R H+ D++ L++Y  +D HG    + IR+K  ++ +   D  RL +ER
Sbjct:    8 RELVDKATNVVMNYSEIESKVREATNDDPWGPSGQLMGEIAKATFMYEQFPELMNMLWSRMLKDNKKNWRRVYKSLLLLAYLIRNGSERVVTSAREHIYDLRSLENYHFVDEHGKDQGINIRQKVKELVEFAQDDDRLREER 149          
BLAST of Clathrin interactor 1 vs. UniProt/SwissProt
Match: sp|Q99KN9|EPN4_MOUSE (Clathrin interactor 1 OS=Mus musculus OX=10090 GN=Clint1 PE=1 SV=2)

HSP 1 Score: 123.635 bits (309), Expect = 1.108e-28
Identity = 61/135 (45.19%), Postives = 82/135 (60.74%), Query Frame = 3
Query:  168 TNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQSY--IDGHGV-ADVAIRRKASDICDLLSDSQRLSDER 563
            TN  +N SEIE K++ ATNDD WGP+G LM EIA  TF      E+M  LW R+  +   N RR YK L+LL YLI NGSE +  S R H+ D++ L++Y  +D HG    + IR+K  ++ +   D  RL +ER
Sbjct:   23 TNVVMNYSEIESKVREATNDDPWGPSGQLMGEIAKATFMYEQFPELMNMLWSRMLKDNKKNWRRVYKSLLLLAYLIRNGSERVVTSAREHIYDLRSLENYHFVDEHGKDQGINIRQKVKELVEFAQDDDRLREER 157          
BLAST of Clathrin interactor 1 vs. UniProt/SwissProt
Match: sp|Q9H201|EPN3_HUMAN (Epsin-3 OS=Homo sapiens OX=9606 GN=EPN3 PE=2 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 1.618e-23
Identity = 61/143 (42.66%), Postives = 80/143 (55.94%), Query Frame = 3
Query:  153 IANKLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQ--SYIDGHGV-ADVAIRRKASDICDLLSDSQRLSDERKRA 572
            +  ++ N   N SE E+K++ AT++D WGP  SLM EIAD TF+T    EVM  LW R+  +   N R  YK L LL YL+  GSE +A  CR +L  I+ L+   YID  G    V +R K   +  LL D +RL  ER  A
Sbjct:    6 LRRQVKNIVHNYSEAEIKVREATSNDPWGPPSSLMSEIADLTFNTVAFTEVMGMLWRRL-NDSGKNWRHVYKALTLLDYLLKTGSERVAHQCRENLYTIQTLKDFQYIDRDGKDQGVNVREKVKQVMALLKDEERLRQERTHA 147          
BLAST of Clathrin interactor 1 vs. UniProt/SwissProt
Match: sp|Q91W69|EPN3_MOUSE (Epsin-3 OS=Mus musculus OX=10090 GN=Epn3 PE=1 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 3.931e-23
Identity = 60/143 (41.96%), Postives = 80/143 (55.94%), Query Frame = 3
Query:  153 IANKLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQ--SYIDGHGV-ADVAIRRKASDICDLLSDSQRLSDERKRA 572
            +  ++ N   N SE E+K++ AT++D WGP  SLM EIAD TF+T    EVM  +W R+  +   N R  YK L LL YL+  GSE +A  CR +L  I+ L+   YID  G    V +R K   +  LL D +RL  ER  A
Sbjct:    6 LRRQVKNIVHNYSEAEIKVREATSNDPWGPPSSLMSEIADLTFNTVAFAEVMGMVWRRL-NDSGKNWRHVYKALTLLDYLLKTGSERVAHQCRENLYTIQTLKDFQYIDRDGKDQGVNVREKVKQVMALLKDEERLRQERTHA 147          
BLAST of Clathrin interactor 1 vs. TrEMBL
Match: A0A170WWJ9 (Clathrin interactor 1 isoform x2 (Fragment) OS=Triatoma infestans OX=30076 PE=4 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 1.181e-34
Identity = 65/147 (44.22%), Postives = 97/147 (65.99%), Query Frame = 3
Query:  147 KDIANKLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQSY--IDGHGV-ADVAIRRKASDICDLLSDSQRLSDERKRAKS 578
            +++A+K+TN  +N +EIE K++ ATNDD WGP G+LM EIA  TF+  +  EVMT LW R+  +   N RRTYK L+LL YL+ NGSE +  S R H+ D++ L++Y  +D +G    + IR K  ++ D + D  +L DERK+++ 
Sbjct:    7 RELADKVTNVVMNYTEIEAKVREATNDDAWGPTGALMLEIAQATFTFEHFPEVMTMLWKRMLQDNKKNWRRTYKSLLLLNYLVRNGSERVVTSSREHIYDLRGLENYVFVDEYGKDQGINIRHKVKELIDFIQDDDKLRDERKKSQE 153          
BLAST of Clathrin interactor 1 vs. TrEMBL
Match: F6ZH66 (ENTH domain-containing protein OS=Ciona intestinalis OX=7719 PE=4 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 2.019e-34
Identity = 81/201 (40.30%), Postives = 119/201 (59.20%), Query Frame = 3
Query:  147 KDIANKLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQSYI--DGHGV-ADVAIRRKASDICDLLSDSQRLSDERKRAKSYHQTRNYRSA--------TVTGADGSDSNRQTRNAQPLGDIDDWDIPGSKSLPH 716
            +++A+K+TN  +N SE+E +++ ATND+ WGP+G++M+E+A +TF      EVM  +W R+  E   + RR YK L+LL YLI NGSE +  S R HL D+K LQ Y   D HG    + +R K  DI  L+ D++RL +ERKRAK   +TR+  +         +  G+ G D  R T+++    D  + D PG KS  H
Sbjct:   10 REVADKVTNVVMNYSEVEARVREATNDEAWGPSGTVMQELARDTFMYECFPEVMGMMWKRMLHEGRKSWRRIYKSLLLLMYLIRNGSERVVTSAREHLYDLKSLQDYTCHDEHGKDQGINVRNKVKDIIALIQDNERLREERKRAK---KTRDKYTGFSSDEARFSSRGSSGYDKRRDTQDSWRDADSYE-DNPG-KSRRH 205          
BLAST of Clathrin interactor 1 vs. TrEMBL
Match: A0A1I8GVF1 (ENTH domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 1.529e-33
Identity = 79/212 (37.26%), Postives = 117/212 (55.19%), Query Frame = 3
Query:  120 MLSNVINAGKDIANKLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQS--YIDGHGVAD-VAIRRKASDICDLLSDSQRLSDERKRA-KSYHQTR-------------------NYRSATVTGADGSDSNRQTRNAQPLGDIDDW 686
            ML +V+  GKD+A K+TN  +N +E+E K++ ATNDD WGP+G LM+E+A  TFS     EVM+ +W R+ T    N RR YK L+LL YLI +GSE +  + R H  D++ L+S  +ID  G  + + +R++A ++ +L+ D  RL +ER+ A KS  Q                     ++R  +       D+         LGDIDDW
Sbjct:    1 MLRDVLYKGKDLAEKMTNVVMNYTEVEAKVREATNDDAWGPHGELMQELAQCTFSHEQFPEVMSMMWKRMLTSTGKNWRRAYKSLLLLNYLIRHGSERVVTNAREHGYDLRSLESFQFIDERGKDEGINVRQRARELLELIQDDGRLREERQLARKSRVQCGGLSGAGGFRDPDKLSEDDFHWRGESAPAGQRGDAGANPSAPNTLGDIDDW 212          
BLAST of Clathrin interactor 1 vs. TrEMBL
Match: A0A1S8WLS0 (ENTH domain protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_08938 PE=4 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 1.598e-33
Identity = 69/155 (44.52%), Postives = 105/155 (67.74%), Query Frame = 3
Query:  120 MLSNVINAGKDIANKLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQS--YIDGHGV-ADVAIRRKASDICDLLSDSQRLSDERKRAK 575
            M+ +++N G++IA+K+TN  +N SE+E+K++ AT+D+ WGP+G LM +IAD TF+     EVM  LW R++ E   N RR YK LVLL +L+ NGSE +AA  R H+ DI+ L+S  +ID +G    + +R K  ++ +L+ DS +L  ER +AK
Sbjct:    1 MIRDLLNKGREIADKVTNMVMNFSEVEMKVREATSDEPWGPHGQLMMQIADYTFTHNTYLEVMCTLWRRLYPENSRNWRRVYKSLVLLDFLLKNGSENVAAGAREHIYDIRTLESFQFIDDNGKDQGINVRIKVQEVINLIQDSDKLKVERAKAK 155          
BLAST of Clathrin interactor 1 vs. TrEMBL
Match: A0A3Q0JT77 (clathrin interactor 1-like isoform X4 OS=Ciona intestinalis OX=7719 GN=LOC100183269 PE=4 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 1.672e-33
Identity = 79/201 (39.30%), Postives = 118/201 (58.71%), Query Frame = 3
Query:  147 KDIANKLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQSYI--DGHGV-ADVAIRRKASDICDLLSDSQRLSDERKRAKSYHQTRNYRSA--------TVTGADGSDSNRQTRNAQPLGDIDDWDIPGSKSLPH 716
            +++A+K+TN  +N SE+E +++ ATND+ WGP+G++M+E+A +TF      EVM  +W R+  E   + RR YK L+LL YLI NGSE +  S R HL D+K LQ Y   D HG    + +R K  DI  L+ D++RL +ERKRAK   +TR+  +         +  G+ G D  R T+++    D D ++    KS  H
Sbjct:   10 REVADKVTNVVMNYSEVEARVREATNDEAWGPSGTVMQELARDTFMYECFPEVMGMMWKRMLHEGRKSWRRIYKSLLLLMYLIRNGSERVVTSAREHLYDLKSLQDYTCHDEHGKDQGINVRNKVKDIIALIQDNERLREERKRAK---KTRDKYTGFSSDEARFSSRGSSGYDKRRDTQDS--WRDADSYEDNPGKSRRH 205          
BLAST of Clathrin interactor 1 vs. Ensembl Cavefish
Match: clint1a (clathrin interactor 1a [Source:ZFIN;Acc:ZDB-GENE-030131-2590])

HSP 1 Score: 132.494 bits (332), Expect = 1.008e-32
Identity = 65/139 (46.76%), Postives = 88/139 (63.31%), Query Frame = 3
Query:  168 TNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQSY--IDGHGV-ADVAIRRKASDICDLLSDSQRLSDERKRAK 575
            TN  +N +E+E K++ ATNDD WGP+G LM EIA  TF      EVM  LWYR+  +   N RR YK L+LL YLI NGSE +  S R HL D++ ++SY  ID +G    V +R+K  ++ + + D  RL +ERK+AK
Sbjct:   21 TNVVMNYTEMESKVREATNDDPWGPSGQLMGEIAKATFMYEQFPEVMNMLWYRMLKDNKKNWRRVYKSLLLLAYLIRNGSERVVTSAREHLYDLRSIESYHCIDENGKDQGVNVRQKVKEMVEFVQDDDRLREERKKAK 159          
BLAST of Clathrin interactor 1 vs. Ensembl Cavefish
Match: epn3b (epsin-3-like [Source:NCBI gene;Acc:103023012])

HSP 1 Score: 106.686 bits (265), Expect = 3.752e-24
Identity = 59/143 (41.26%), Postives = 80/143 (55.94%), Query Frame = 3
Query:  153 IANKLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQ--SYIDGHGV-ADVAIRRKASDICDLLSDSQRLSDERKRA 572
            +  ++ N   N SE E+K++ AT++D WGP+ SLM EIAD TFS     EVM  +W R+  +   N R  YK L LL YL   GSE +A  CR +   I+ L+   Y+D  G    V +R KA  +  LL D +RL  ER +A
Sbjct:    6 LRRQVKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTFSVVAFSEVMAMVWKRL-NDHGKNWRHVYKALTLLDYLAKTGSERVAQQCRENAFTIQTLRDFQYVDRDGRDQGVNVREKAKQLVALLRDEERLRQERAQA 147          
BLAST of Clathrin interactor 1 vs. Ensembl Cavefish
Match: epn3a (epsin 3 [Source:NCBI gene;Acc:103029089])

HSP 1 Score: 107.071 bits (266), Expect = 3.846e-24
Identity = 64/153 (41.83%), Postives = 85/153 (55.56%), Query Frame = 3
Query:  183 NLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQ--SYIDGHGV-ADVAIRRKASDICDLLSDSQRLSDERKRAKSYHQTRNYRSATVTGADGS 632
            N +E E+K++ AT++D WGP  SLM EIAD TF+     EVM  +W R+  +   N R  YK L LL YL+  GSE +A  CR ++  I+ L+   YID  G    V +R KA  +  LL D  RL  ER +A   H+TR      + GA GS
Sbjct:   16 NYTEAEIKVREATSNDPWGPPSSLMMEIADLTFNVVAFTEVMGMVWKRL-NDHGKNWRHVYKALTLLEYLLKAGSERVAQQCRENIYAIQTLRDFQYIDRDGQDQGVNVREKAKQLVSLLRDEDRLKQERSQA---HKTRER----MAGAYGS 160          
BLAST of Clathrin interactor 1 vs. Ensembl Cavefish
Match: epn3a (epsin 3 [Source:NCBI gene;Acc:103029089])

HSP 1 Score: 107.071 bits (266), Expect = 3.846e-24
Identity = 64/153 (41.83%), Postives = 85/153 (55.56%), Query Frame = 3
Query:  183 NLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQ--SYIDGHGV-ADVAIRRKASDICDLLSDSQRLSDERKRAKSYHQTRNYRSATVTGADGS 632
            N +E E+K++ AT++D WGP  SLM EIAD TF+     EVM  +W R+  +   N R  YK L LL YL+  GSE +A  CR ++  I+ L+   YID  G    V +R KA  +  LL D  RL  ER +A   H+TR      + GA GS
Sbjct:   16 NYTEAEIKVREATSNDPWGPPSSLMMEIADLTFNVVAFTEVMGMVWKRL-NDHGKNWRHVYKALTLLEYLLKAGSERVAQQCRENIYAIQTLRDFQYIDRDGQDQGVNVREKAKQLVSLLRDEDRLKQERSQA---HKTRER----MAGAYGS 160          
BLAST of Clathrin interactor 1 vs. Ensembl Cavefish
Match: epn3a (epsin 3 [Source:NCBI gene;Acc:103029089])

HSP 1 Score: 106.686 bits (265), Expect = 4.906e-24
Identity = 64/153 (41.83%), Postives = 85/153 (55.56%), Query Frame = 3
Query:  183 NLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQ--SYIDGHGV-ADVAIRRKASDICDLLSDSQRLSDERKRAKSYHQTRNYRSATVTGADGS 632
            N +E E+K++ AT++D WGP  SLM EIAD TF+     EVM  +W R+  +   N R  YK L LL YL+  GSE +A  CR ++  I+ L+   YID  G    V +R KA  +  LL D  RL  ER +A   H+TR      + GA GS
Sbjct:   16 NYTEAEIKVREATSNDPWGPPSSLMMEIADLTFNVVAFTEVMGMVWKRL-NDHGKNWRHVYKALTLLEYLLKAGSERVAQQCRENIYAIQTLRDFQYIDRDGQDQGVNVREKAKQLVSLLRDEDRLKQERSQA---HKTRER----MAGAYGS 160          
BLAST of Clathrin interactor 1 vs. Ensembl Sea Lamprey
Match: clint1a (clathrin interactor 1a [Source:ZFIN;Acc:ZDB-GENE-030131-2590])

HSP 1 Score: 115.546 bits (288), Expect = 1.087e-27
Identity = 65/148 (43.92%), Postives = 93/148 (62.84%), Query Frame = 3
Query:  147 KDIANKLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQSY--IDGHGV-ADVAIRRKASDICDLLSDSQRLSDERKRAKSY 581
            K + +  TN  +N +E+E K++ ATND+ WGP+G LM EIA  TF      EVM  LW R+  E   N RR YKGL+LLTYL+ NGSE +  S R HL D++ L+ Y  +D +G    V +R+K  ++ D + D +R+ +ERK+AK +
Sbjct:    7 KALVDLKTNIVMNYTEMEAKVREATNDEPWGPSGKLMGEIAKATFMYELFPEVMNMLWARMLRENKNNWRRAYKGLLLLTYLLRNGSERVVTSAREHLYDLRSLEDYHFVDENGKDQGVNVRQKVKEMIDFVQDDERVREERKKAKKH 154          
BLAST of Clathrin interactor 1 vs. Ensembl Sea Lamprey
Match: epn2 (epsin 2 [Source:ZFIN;Acc:ZDB-GENE-071212-1])

HSP 1 Score: 104.375 bits (259), Expect = 4.983e-24
Identity = 61/165 (36.97%), Postives = 91/165 (55.15%), Query Frame = 3
Query:  141 AGKDIANKLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQ--SYIDGHGV-ADVAIRRKASDICDLLSDSQRLSDERKRAKSYHQTRNYRSATVTGAD 626
            A   +  ++ N   N SE EVK++ AT++D WGP+ SLM EIAD T++     E+M+ +W R+  +   N R  YK L LL YLI  GSE +A  C+ ++  I+ L+   Y+D  G    V +R K+  +  LL D  RL  ER+ A    + R  + AT  G++
Sbjct:    2 ATSSLRRQMKNIVNNFSEAEVKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRL-NDHGKNWRHVYKALTLLDYLIKTGSERVAQQCKENIFAIQTLKDFQYVDRDGKDQGVNVREKSKQLVALLRDEDRLRGEREHALKTKE-RLAQGATGMGSN 164          
BLAST of Clathrin interactor 1 vs. Ensembl Yeast
Match: ENT3 (Protein containing an N-terminal epsin-like domain; involved in clathrin recruitment and traffic between the Golgi and endosomes; associates with the clathrin adaptor Gga2p [Source:SGD;Acc:S000003886])

HSP 1 Score: 87.0409 bits (214), Expect = 6.223e-19
Identity = 54/167 (32.34%), Postives = 90/167 (53.89%), Query Frame = 3
Query:  144 GKDIANKLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNN-RRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQS--YIDGHGV-ADVAIRRKASDICDLLSDSQRLSDERKRAKSYHQTRNYRSATVTGADGS 632
             K    K  N   N +E+E K++ ATN++ WG + +LM +I+  T++    +E+++ + +R FTEK  +  R+ YK L LL YLI +GSE      R  +  I+ L++  YID  G    + +R +   + +LLSD  ++  ERK+A+   +     +     ADGS
Sbjct:   15 AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMI-FRRFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYIDSQGRDQGINVRTRVKALIELLSDDNKIRAERKKARETAKKYKGVAGGSASADGS 180          
BLAST of Clathrin interactor 1 vs. Ensembl Yeast
Match: ENT1 (Epsin-like protein involved in endocytosis and actin patch assembly; functionally redundant with Ent2p; binds clathrin via a clathrin-binding domain motif at C-terminus; relocalizes from bud neck to cytoplasm upon DNA replication stress; ENT1 has a paralog, ENT2, that arose from the whole genome duplication [Source:SGD;Acc:S000002320])

HSP 1 Score: 59.6918 bits (143), Expect = 5.011e-10
Identity = 44/142 (30.99%), Postives = 72/142 (50.70%), Query Frame = 3
Query:  147 KDIANKLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQSYI--DGHGVADVAI-RRKASDICDLLSDSQRLSDER 563
            K       N     S  +V ++ AT++DN   +   + E+A++++ + +  E+M  L  R+  +K    R   K L ++ YLI  GSE     CR +L  IK L+ +   D  G+    I R KA ++  LLSD +RL++ER
Sbjct:    3 KQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDKRL-NDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQIVRVKAKELTALLSDDERLNEER 143          
BLAST of Clathrin interactor 1 vs. Ensembl Yeast
Match: ENT2 (Epsin-like protein required for endocytosis and actin patch assembly; functionally redundant with Ent1p; contains clathrin-binding motif at C-terminus; ENT2 has a paralog, ENT1, that arose from the whole genome duplication [Source:SGD;Acc:S000004196])

HSP 1 Score: 54.6842 bits (130), Expect = 2.174e-8
Identity = 40/143 (27.97%), Postives = 67/143 (46.85%), Query Frame = 3
Query:  147 KDIANKLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQSYI----DGHGVADVAIRRKASDICDLLSDSQRLSDER 563
            K       N     S  +V ++ AT +D+  P+   + ++A  ++ + +  E+M  L  R+  +K    R   K L +L YL+  GSE     CR +   IK L+ +      G     + IR KA ++  LL+D +RL +ER
Sbjct:    3 KQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLDKRL-NDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQI-IRVKAKELVSLLNDEERLREER 143          
BLAST of Clathrin interactor 1 vs. Ensembl Nematostella
Match: EDO48788 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIC8])

HSP 1 Score: 115.546 bits (288), Expect = 3.736e-30
Identity = 62/147 (42.18%), Postives = 97/147 (65.99%), Query Frame = 3
Query:  147 KDIANKLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQSY--IDGHGV-ADVAIRRKASDICDLLSDSQRLSDERKRAKS 578
            ++I++K+TN  +N SE+E K++ ATNDD WGP+GSLM+EIA  TF+  +  EVM+ LW R+  E     RR YK L+LL YL+ NGS+ +  + R H+ D+++L+++   D +G    + +R K  ++ +L+ D  R+  ERKRAK 
Sbjct:    8 REISDKVTNVVMNYSEVEAKVREATNDDTWGPHGSLMQEIAKYTFTYEHFPEVMSMLWKRMLQEPKKYWRRIYKSLLLLGYLLKNGSDRVVTNARDHIYDMRQLENFHHTDENGKDQGINVRHKVKELIELVQDDDRIRSERKRAKK 154          
BLAST of Clathrin interactor 1 vs. Ensembl Nematostella
Match: EDO36992 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SH59])

HSP 1 Score: 105.916 bits (263), Expect = 6.508e-27
Identity = 59/143 (41.26%), Postives = 83/143 (58.04%), Query Frame = 3
Query:  153 IANKLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQ--SYIDGHGV-ADVAIRRKASDICDLLSDSQRLSDERKRA 572
            I  +L N   N S  EVK++ AT++D WGP+ SLM EIAD T++     E+M  +W R+  +   N R  YK LVLL Y+I  GSE +A  CR ++  I+ L+   +ID  G    + +R KA  +  LL D +RL  ER+RA
Sbjct:    3 IRRQLKNVVNNYSNSEVKVREATSNDPWGPSSSLMSEIADATYNVVAFSEIMAMIWRRL-NDHGKNWRHVYKSLVLLDYIIKTGSERVAQQCRENIFVIQTLKDFQFIDKDGKDQGMNVREKAKQLVALLKDEERLKSERQRA 144          
BLAST of Clathrin interactor 1 vs. Ensembl Medaka
Match: clint1a (clathrin interactor 1 [Source:NCBI gene;Acc:101169791])

HSP 1 Score: 130.954 bits (328), Expect = 3.448e-32
Identity = 81/228 (35.53%), Postives = 120/228 (52.63%), Query Frame = 3
Query:  147 KDIANKLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQSY--IDGHGV-ADVAIRRKASDICDLLSDSQRLSDERKRAKSYHQTRNYRSATVTGADGSDSNRQTRNAQPLGDIDDWD----IPGSKSLPHV---IGESFMNFVNTFTQNISGPPPTETHDN 800
            +++ +K TN  +N SE+E K++ ATNDD WGP+G +M EI+  TF      EVM  LW R+  +   N RR YK L+LL +LI NGSE +  S R HL D++ L+SY  +D +G    + +R+K  ++ D + D  RL +ERK+AK         S+   G  G   +R   +       DDW+     P S+ L  +   IG +  + +NTF +      P    DN
Sbjct:    8 RELVDKATNVVMNYSEVESKVREATNDDPWGPSGQMMTEISRATFMYEQFPEVMNMLWARMLRDNKKNWRRVYKSLLLLAHLIRNGSERVVTSAREHLYDLRSLESYHFVDENGKDQGINVRQKVKEMVDFIQDDDRLREERKKAKKNKDKYIGVSSDSMGYRGYSGDRYDSSDNRGRWDDDWEKKGPFPFSEKLGEISDKIGSTINDTINTFRKKDRDDSPDRFSDN 235          
BLAST of Clathrin interactor 1 vs. Ensembl Medaka
Match: CLINT1 (clathrin interactor 1 [Source:NCBI gene;Acc:101160502])

HSP 1 Score: 108.612 bits (270), Expect = 1.102e-24
Identity = 62/142 (43.66%), Postives = 88/142 (61.97%), Query Frame = 3
Query:  147 KDIANKLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQSY--IDGHGV-ADVAIRRKASDICDLLSDSQRLSDER 563
            +++ +K TN  +N SEIE K++ ATNDD WGP+G LM EIA  TF      EVM  LW R+  +   N RR YK L+LL YLI NGSE +  S R H+ D++ L++Y  ID +G    + +R+K  ++ + + D  RL +ER
Sbjct:    8 RELVDKATNVVMNYSEIESKVREATNDDPWGPSGQLMGEIAKSTFMYEQFPEVMNMLWTRMLKDNKKNWRRVYKALLLLAYLIRNGSERVVTSSREHIYDLRSLENYNFIDENGKDQGINVRQKVKEMVEFIQDDDRLREER 149          
BLAST of Clathrin interactor 1 vs. Ensembl Medaka
Match: CLINT1 (clathrin interactor 1 [Source:NCBI gene;Acc:101160502])

HSP 1 Score: 108.227 bits (269), Expect = 1.438e-24
Identity = 62/142 (43.66%), Postives = 88/142 (61.97%), Query Frame = 3
Query:  147 KDIANKLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQSY--IDGHGV-ADVAIRRKASDICDLLSDSQRLSDER 563
            +++ +K TN  +N SEIE K++ ATNDD WGP+G LM EIA  TF      EVM  LW R+  +   N RR YK L+LL YLI NGSE +  S R H+ D++ L++Y  ID +G    + +R+K  ++ + + D  RL +ER
Sbjct:    8 RELVDKATNVVMNYSEIESKVREATNDDPWGPSGQLMGEIAKSTFMYEQFPEVMNMLWTRMLKDNKKNWRRVYKALLLLAYLIRNGSERVVTSSREHIYDLRSLENYNFIDENGKDQGINVRQKVKEMVEFIQDDDRLREER 149          
BLAST of Clathrin interactor 1 vs. Ensembl Medaka
Match: epn1 (epsin-1 [Source:NCBI gene;Acc:101167232])

HSP 1 Score: 102.449 bits (254), Expect = 1.047e-22
Identity = 53/140 (37.86%), Postives = 82/140 (58.57%), Query Frame = 3
Query:  162 KLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQ--SYIDGHGV-ADVAIRRKASDICDLLSDSQRLSDERKRA 572
            ++ N   N SE E+K++ AT++D WGP+ SLM EIAD T++     E+M+ +W R+  +   N R  YK + L+ YLI  GSE +A  CR ++  ++ L+   YID  G    + +R KA  +  LL D ++L +ER  A
Sbjct:    9 QVKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMVWKRL-NDHGKNWRHVYKAMTLMEYLIKTGSERVAQQCRENIYAVQTLKDFQYIDRDGKDQGLNVREKAKQLVTLLKDEEKLREERIHA 147          
BLAST of Clathrin interactor 1 vs. Ensembl Medaka
Match: epn1 (epsin-1 [Source:NCBI gene;Acc:101167232])

HSP 1 Score: 102.449 bits (254), Expect = 1.114e-22
Identity = 53/140 (37.86%), Postives = 82/140 (58.57%), Query Frame = 3
Query:  162 KLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQ--SYIDGHGV-ADVAIRRKASDICDLLSDSQRLSDERKRA 572
            ++ N   N SE E+K++ AT++D WGP+ SLM EIAD T++     E+M+ +W R+  +   N R  YK + L+ YLI  GSE +A  CR ++  ++ L+   YID  G    + +R KA  +  LL D ++L +ER  A
Sbjct:    9 QVKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMVWKRL-NDHGKNWRHVYKAMTLMEYLIKTGSERVAQQCRENIYAVQTLKDFQYIDRDGKDQGLNVREKAKQLVTLLKDEEKLREERIHA 147          
BLAST of Clathrin interactor 1 vs. Planmine SMEST
Match: SMESG000032527.1 (SMESG000032527.1)

HSP 1 Score: 853.588 bits (2204), Expect = 0.000e+0
Identity = 443/450 (98.44%), Postives = 443/450 (98.44%), Query Frame = 3
Query:  120 MLSNVINAGKDIANKLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQSYIDGHGVADVAIRRKASDICDLLSDSQRLSDERKRAKSYHQTRNYRSATVTGADGSDSNRQTRNAQPLGDIDDWDIPGSKSLPHVIGESFMNFVNTFTQNISGPPPTETHDNFDIPAMQYEISTPTPPPMATREDESVCNSAPQPRSSNQPVLRIDXXXXXXXXXXXXXXXXXLPIAVVPLDRPIIDFSEPDAINADVDFLLAVXXXXXXXXXXEEFGNLRAGDHSGDAIGRPSQLQLINNNYYHPDNSYTHADFCGFVSSDSKEMSNLKSNQSPPSVTTSSIQLSNPQAQSQLGNSSSTMPKSDKKIGSTWNEIDALNIDLNNLCGRKRMYSKS 1469
            MLSNVINAGKDIANKLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQSYIDGHGVADVAIRRKASDICDLLSDSQRLSDERKRAKSYHQTRNYRSATVT ADGSDSNRQTRNAQPLGDIDDWDIPGSKSLPHVIGESFMNFVNTFTQNISGPPPTETHDNFDIPAMQYEIS P PPPMATREDESVCNSAPQPRSSNQPVLRIDSSNRKESSNNKAAAK SLPIAVVPLDRPIIDFSEPDAINADVDFLLAVNNNTIDNDIDEEFGNLRAGDH GDAIGRPSQLQLINNNYYHPD SYTHADF GFVSSDSKEMSNLKSNQSPPSVTTSSIQLSNPQAQSQLGNSSSTMPKSDKKIGSTWNEIDALNIDLNNLCGRKRMYSKS
Sbjct:    1 MLSNVINAGKDIANKLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQSYIDGHGVADVAIRRKASDICDLLSDSQRLSDERKRAKSYHQTRNYRSATVTVADGSDSNRQTRNAQPLGDIDDWDIPGSKSLPHVIGESFMNFVNTFTQNISGPPPTETHDNFDIPAMQYEISAPPPPPMATREDESVCNSAPQPRSSNQPVLRIDSSNRKESSNNKAAAKCSLPIAVVPLDRPIIDFSEPDAINADVDFLLAVNNNTIDNDIDEEFGNLRAGDHRGDAIGRPSQLQLINNNYYHPDTSYTHADFGGFVSSDSKEMSNLKSNQSPPSVTTSSIQLSNPQAQSQLGNSSSTMPKSDKKIGSTWNEIDALNIDLNNLCGRKRMYSKS 450          
BLAST of Clathrin interactor 1 vs. Planmine SMEST
Match: SMESG000032527.1 (SMESG000032527.1)

HSP 1 Score: 848.966 bits (2192), Expect = 0.000e+0
Identity = 440/451 (97.56%), Postives = 442/451 (98.00%), Query Frame = 3
Query:  120 MLSNVINAGKDIANKLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQSYIDGHGVADVAIRRKASDICDLLSDSQRLSDERKRAKSYHQTRNYRSATVTGADGSDSNRQTRNAQPLGDIDDWDIPGSKSLPHVIGESFMNFVNTFTQNISGPPPTETHDNFDIPAMQYEISTPTPPPMATREDESVCNSAPQPRSSNQPVLRIDXXXXXXXXXXXXXXXXXLPIAVVPLDRPIIDFSEPDAINADVDFLLAVXXXX-XXXXXXEEFGNLRAGDHSGDAIGRPSQLQLINNNYYHPDNSYTHADFCGFVSSDSKEMSNLKSNQSPPSVTTSSIQLSNPQAQSQLGNSSSTMPKSDKKIGSTWNEIDALNIDLNNLCGRKRMYSKS 1469
            MLSNVINAGKDIANKLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQSYIDGHGVADVAIRRKASDICDLLSDSQRLSDERKRAKSYHQTRNYRSATVT ADGSDSNRQTRNAQPLGDIDDWDIPGSKSLPHVIGESFMNFVNTFTQNISGPPPTETHDNFDIPAMQYEIS P PPPMATREDESVCNSAPQPRSSNQPVLRIDSSNRKESSNNKAAAK SLPIAVVPLDRPIIDFSEPDAINADVDFLLAVNNNT  ++DIDEEFGNLRAGDH GDAIGRPSQLQLINNNYYHPD SYTHADF GFVSSDSKEMSNLKSNQSPPSVTTSSIQLSNPQAQSQLGNSSSTMPKSDKKIGSTWNEIDALNIDLNNLCGRKRMYSKS
Sbjct:    1 MLSNVINAGKDIANKLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQSYIDGHGVADVAIRRKASDICDLLSDSQRLSDERKRAKSYHQTRNYRSATVTVADGSDSNRQTRNAQPLGDIDDWDIPGSKSLPHVIGESFMNFVNTFTQNISGPPPTETHDNFDIPAMQYEISAPPPPPMATREDESVCNSAPQPRSSNQPVLRIDSSNRKESSNNKAAAKCSLPIAVVPLDRPIIDFSEPDAINADVDFLLAVNNNTIDNSDIDEEFGNLRAGDHRGDAIGRPSQLQLINNNYYHPDTSYTHADFGGFVSSDSKEMSNLKSNQSPPSVTTSSIQLSNPQAQSQLGNSSSTMPKSDKKIGSTWNEIDALNIDLNNLCGRKRMYSKS 451          
BLAST of Clathrin interactor 1 vs. Planmine SMEST
Match: SMESG000032527.1 (SMESG000032527.1)

HSP 1 Score: 373.629 bits (958), Expect = 1.159e-128
Identity = 212/218 (97.25%), Postives = 212/218 (97.25%), Query Frame = 3
Query:  816 MQYEISTPTPPPMATREDESVCNSAPQPRSSNQPVLRIDXXXXXXXXXXXXXXXXXLPIAVVPLDRPIIDFSEPDAINADVDFLLAVXXXXXXXXXXEEFGNLRAGDHSGDAIGRPSQLQLINNNYYHPDNSYTHADFCGFVSSDSKEMSNLKSNQSPPSVTTSSIQLSNPQAQSQLGNSSSTMPKSDKKIGSTWNEIDALNIDLNNLCGRKRMYSKS 1469
            MQYEIS P PPPMATREDESVCNSAPQPRSSNQPVLRIDSSNRKESSNNKAAAK SLPIAVVPLDRPIIDFSEPDAINADVDFLLAVNNNTIDNDIDEEFGNLRAGDH GDAIGRPSQLQLINNNYYHPD SYTHADF GFVSSDSKEMSNLKSNQSPPSVTTSSIQLSNPQAQSQLGNSSSTMPKSDKKIGSTWNEIDALNIDLNNLCGRKRMYSKS
Sbjct:    1 MQYEISAPPPPPMATREDESVCNSAPQPRSSNQPVLRIDSSNRKESSNNKAAAKCSLPIAVVPLDRPIIDFSEPDAINADVDFLLAVNNNTIDNDIDEEFGNLRAGDHRGDAIGRPSQLQLINNNYYHPDTSYTHADFGGFVSSDSKEMSNLKSNQSPPSVTTSSIQLSNPQAQSQLGNSSSTMPKSDKKIGSTWNEIDALNIDLNNLCGRKRMYSKS 218          
BLAST of Clathrin interactor 1 vs. Planmine SMEST
Match: SMESG000032527.1 (SMESG000032527.1)

HSP 1 Score: 369.392 bits (947), Expect = 4.269e-127
Identity = 210/219 (95.89%), Postives = 210/219 (95.89%), Query Frame = 3
Query:  816 MQYEISTPTPPPMATREDESVCNSAPQPRSSNQPVLRIDXXXXXXXXXXXXXXXXXLPIAVVPLDRPIIDFSEPDAINADVDFLLAVXXXXXXXXX-XEEFGNLRAGDHSGDAIGRPSQLQLINNNYYHPDNSYTHADFCGFVSSDSKEMSNLKSNQSPPSVTTSSIQLSNPQAQSQLGNSSSTMPKSDKKIGSTWNEIDALNIDLNNLCGRKRMYSKS 1469
            MQYEIS P PPPMATREDESVCNSAPQPRSSNQPVLRIDSSNRKESSNNKAAAK SLPIAVVPLDRPIIDFSEPDAINADVDFLLAVNNNTIDN   DEEFGNLRAGDH GDAIGRPSQLQLINNNYYHPD SYTHADF GFVSSDSKEMSNLKSNQSPPSVTTSSIQLSNPQAQSQLGNSSSTMPKSDKKIGSTWNEIDALNIDLNNLCGRKRMYSKS
Sbjct:    1 MQYEISAPPPPPMATREDESVCNSAPQPRSSNQPVLRIDSSNRKESSNNKAAAKCSLPIAVVPLDRPIIDFSEPDAINADVDFLLAVNNNTIDNSDIDEEFGNLRAGDHRGDAIGRPSQLQLINNNYYHPDTSYTHADFGGFVSSDSKEMSNLKSNQSPPSVTTSSIQLSNPQAQSQLGNSSSTMPKSDKKIGSTWNEIDALNIDLNNLCGRKRMYSKS 219          
BLAST of Clathrin interactor 1 vs. Planmine SMEST
Match: SMESG000019746.1 (SMESG000019746.1)

HSP 1 Score: 132.109 bits (331), Expect = 3.417e-33
Identity = 76/171 (44.44%), Postives = 112/171 (65.50%), Query Frame = 3
Query:  120 MLSNVINAGKDIANKLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIADETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIAASCRAHLGDIKKLQS--YIDGHGV-ADVAIRRKASDICDLLSDSQRLSDERKRAKSYHQTRNYRSATVTGA 623
            ML  V   GK++A+K+TN  +N +E+E K++ ATNDD WGP+G  M+EIA+ T     L +VM  LW R+F E+  N RRTYK L+LL+YL+ NGSE I  SC+ H+ D++ L+S  YID +G    + IR K+ ++  LL +  +LS+ERK+A S    R+   A ++G+
Sbjct:    1 MLREVFEMGKELADKVTNAVMNYTEVEAKVRAATNDDPWGPHGQDMQEIAEFTKHYDTLTQVMGMLWRRMFQEQKSNWRRTYKSLLLLSYLLRNGSERIVISCKEHIYDLRLLESYQYIDENGKDQGINIRHKSKELIGLLENESQLSNERKKATS---NRSKYKAGISGS 168          
The following BLAST results are available for this feature:
BLAST of Clathrin interactor 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CLINT16.790e-3143.66clathrin interactor 1 [Source:HGNC Symbol;Acc:HGNC... [more]
CLINT16.981e-3143.66clathrin interactor 1 [Source:HGNC Symbol;Acc:HGNC... [more]
CLINT19.717e-2945.04clathrin interactor 1 [Source:HGNC Symbol;Acc:HGNC... [more]
CLINT19.717e-2945.04clathrin interactor 1 [Source:HGNC Symbol;Acc:HGNC... [more]
EPN31.214e-2542.66epsin 3 [Source:HGNC Symbol;Acc:HGNC:18235][more]
back to top
BLAST of Clathrin interactor 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
epn-11.203e-2336.69EPsiN (Endocytic protein) homolog [Source:UniProt... [more]
epn-11.207e-2336.69EPsiN (Endocytic protein) homolog [Source:UniProt... [more]
rsd-39.441e-1730.57pep chromosome:WBcel235:X:11798505:11803656:1 gene... [more]
back to top
BLAST of Clathrin interactor 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lqfR1.963e-3142.25gene:FBgn0261279 transcript:FBtr0299515[more]
lqfR1.859e-3042.25gene:FBgn0261279 transcript:FBtr0299516[more]
lqf5.091e-2233.76gene:FBgn0028582 transcript:FBtr0076796[more]
lqf5.091e-2233.76gene:FBgn0028582 transcript:FBtr0076794[more]
lqf5.215e-2233.76gene:FBgn0028582 transcript:FBtr0076798[more]
back to top
BLAST of Clathrin interactor 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clint1a5.693e-3336.74clathrin interactor 1a [Source:ZFIN;Acc:ZDB-GENE-0... [more]
clint1a1.600e-3137.50clathrin interactor 1a [Source:ZFIN;Acc:ZDB-GENE-0... [more]
epn3b2.211e-2339.86epsin 3b [Source:ZFIN;Acc:ZDB-GENE-121214-173][more]
epn12.575e-2339.29epsin 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2680][more]
epn12.779e-2339.29epsin 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2680][more]
back to top
BLAST of Clathrin interactor 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cyct4.360e-3041.55cytochrome c, testis [Source:Xenbase;Acc:XB-GENE-5... [more]
cyct1.721e-2842.96cytochrome c, testis [Source:Xenbase;Acc:XB-GENE-5... [more]
cyct2.033e-2842.96cytochrome c, testis [Source:Xenbase;Acc:XB-GENE-5... [more]
uvssa1.501e-2338.57UV stimulated scaffold protein A [Source:Xenbase;A... [more]
uvssa1.527e-2338.57UV stimulated scaffold protein A [Source:Xenbase;A... [more]
back to top
BLAST of Clathrin interactor 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Clint14.086e-3143.66clathrin interactor 1 [Source:MGI Symbol;Acc:MGI:2... [more]
Clint14.578e-3143.66clathrin interactor 1 [Source:MGI Symbol;Acc:MGI:2... [more]
Epn35.619e-2441.96epsin 3 [Source:MGI Symbol;Acc:MGI:1919139][more]
Epn21.776e-2339.86epsin 2 [Source:MGI Symbol;Acc:MGI:1333766][more]
Epn21.867e-2339.86epsin 2 [Source:MGI Symbol;Acc:MGI:1333766][more]
back to top
BLAST of Clathrin interactor 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A7Z035|EPN4_BOVIN3.230e-3043.66Clathrin interactor 1 OS=Bos taurus OX=9913 GN=CLI... [more]
sp|Q14677|EPN4_HUMAN3.352e-3043.66Clathrin interactor 1 OS=Homo sapiens OX=9606 GN=C... [more]
sp|Q99KN9|EPN4_MOUSE1.108e-2845.19Clathrin interactor 1 OS=Mus musculus OX=10090 GN=... [more]
sp|Q9H201|EPN3_HUMAN1.618e-2342.66Epsin-3 OS=Homo sapiens OX=9606 GN=EPN3 PE=2 SV=1[more]
sp|Q91W69|EPN3_MOUSE3.931e-2341.96Epsin-3 OS=Mus musculus OX=10090 GN=Epn3 PE=1 SV=1[more]
back to top
BLAST of Clathrin interactor 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A170WWJ91.181e-3444.22Clathrin interactor 1 isoform x2 (Fragment) OS=Tri... [more]
F6ZH662.019e-3440.30ENTH domain-containing protein OS=Ciona intestinal... [more]
A0A1I8GVF11.529e-3337.26ENTH domain-containing protein OS=Macrostomum lign... [more]
A0A1S8WLS01.598e-3344.52ENTH domain protein (Fragment) OS=Opisthorchis viv... [more]
A0A3Q0JT771.672e-3339.30clathrin interactor 1-like isoform X4 OS=Ciona int... [more]
back to top
BLAST of Clathrin interactor 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clint1a1.008e-3246.76clathrin interactor 1a [Source:ZFIN;Acc:ZDB-GENE-0... [more]
epn3b3.752e-2441.26epsin-3-like [Source:NCBI gene;Acc:103023012][more]
epn3a3.846e-2441.83epsin 3 [Source:NCBI gene;Acc:103029089][more]
epn3a3.846e-2441.83epsin 3 [Source:NCBI gene;Acc:103029089][more]
epn3a4.906e-2441.83epsin 3 [Source:NCBI gene;Acc:103029089][more]
back to top
BLAST of Clathrin interactor 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
clint1a1.087e-2743.92clathrin interactor 1a [Source:ZFIN;Acc:ZDB-GENE-0... [more]
epn24.983e-2436.97epsin 2 [Source:ZFIN;Acc:ZDB-GENE-071212-1][more]
back to top
BLAST of Clathrin interactor 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
ENT36.223e-1932.34Protein containing an N-terminal epsin-like domain... [more]
ENT15.011e-1030.99Epsin-like protein involved in endocytosis and act... [more]
ENT22.174e-827.97Epsin-like protein required for endocytosis and ac... [more]
back to top
BLAST of Clathrin interactor 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO487883.736e-3042.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO369926.508e-2741.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Clathrin interactor 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clint1a3.448e-3235.53clathrin interactor 1 [Source:NCBI gene;Acc:101169... [more]
CLINT11.102e-2443.66clathrin interactor 1 [Source:NCBI gene;Acc:101160... [more]
CLINT11.438e-2443.66clathrin interactor 1 [Source:NCBI gene;Acc:101160... [more]
epn11.047e-2237.86epsin-1 [Source:NCBI gene;Acc:101167232][more]
epn11.114e-2237.86epsin-1 [Source:NCBI gene;Acc:101167232][more]
back to top
BLAST of Clathrin interactor 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000032527.10.000e+098.44SMESG000032527.1[more]
SMESG000032527.10.000e+097.56SMESG000032527.1[more]
SMESG000032527.11.159e-12897.25SMESG000032527.1[more]
SMESG000032527.14.269e-12795.89SMESG000032527.1[more]
SMESG000019746.13.417e-3344.44SMESG000019746.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022249 ID=SMED30022249|Name=Clathrin interactor 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1515bp
TTTATTAAATTTGAACTGGCGAAATTTAAAATTTAGCAATTGTTCAGTAT
CTACTGATCAATTATCGTAAAAATATTAATTTAAAATTTTTTTAATTATT
TTTAATCAATTTAATTAAGATGTTATCAAATGTTATTAATGCTGGGAAAG
ATATTGCAAATAAATTAACAAACAAATTTCTCAATCTTTCCGAAATCGAG
GTGAAAATTAAAACTGCCACAAATGATGATAATTGGGGCCCAAATGGATC
GCTGATGAGAGAAATTGCAGATGAAACATTCTCGACGACAAATTTGCAAG
AAGTTATGACGTTTTTGTGGTACAGAATTTTTACTGAGAAACCGCCGAAT
AATCGGAGAACTTATAAAGGCCTCGTTTTGCTGACCTATCTCATTGTGAA
TGGCTCGGAATTGATTGCTGCCAGTTGCAGGGCTCATTTAGGCGACATAA
AGAAGCTGCAATCATATATTGATGGTCATGGAGTGGCAGATGTCGCTATC
CGGAGAAAGGCGAGCGACATCTGTGACTTACTCAGTGATTCCCAAAGGTT
GTCCGATGAAAGGAAACGTGCCAAAAGCTATCACCAGACAAGAAATTACC
GATCGGCAACCGTAACCGGTGCCGACGGTTCCGACAGCAACAGACAGACA
AGGAATGCTCAACCCCTAGGTGACATCGATGATTGGGACATCCCTGGGTC
GAAATCGCTCCCGCATGTGATTGGCGAATCATTTATGAACTTTGTCAACA
CATTCACTCAGAATATTTCTGGGCCGCCTCCGACAGAAACTCACGATAAT
TTTGACATTCCGGCGATGCAATACGAGATATCGACACCGACGCCGCCTCC
AATGGCAACGCGGGAGGATGAATCAGTCTGTAATTCAGCACCGCAACCGA
GGAGCTCCAATCAGCCGGTTCTCAGGATTGATTCTAGCAACAGAAAAGAA
AGCAGTAATAATAAAGCAGCGGCTAAATCCAGTCTGCCAATTGCCGTTGT
GCCACTGGATAGACCGATAATAGATTTCTCGGAGCCGGACGCGATCAATG
CCGATGTGGATTTCCTGCTGGCTGTCAATAACAACACAATTGACAATGAT
ATCGATGAGGAGTTTGGAAACCTGCGGGCTGGGGATCATTCGGGTGACGC
CATCGGGAGGCCGTCGCAGCTGCAGCTCATCAATAATAACTATTATCATC
CTGATAATAGTTATACTCATGCAGATTTTTGCGGTTTCGTTTCCTCTGAT
TCGAAAGAGATGTCGAATTTGAAAAGTAACCAATCACCACCATCCGTCAC
CACCAGCTCAATCCAGTTATCCAATCCTCAGGCCCAATCACAGCTTGGCA
ATTCCTCATCGACTATGCCTAAATCAGACAAAAAGATCGGATCGACCTGG
AATGAAATCGATGCATTAAATATCGATCTAAATAATTTGTGCGGCCGGAA
ACGTATGTATTCCAAATCGTAGTTCGAGTTGCTTTCAAATATCAATATAT
ATCAAGGACCATTAT
back to top

protein sequence of SMED30022249-orf-1

>SMED30022249-orf-1 ID=SMED30022249-orf-1|Name=SMED30022249-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=451bp
MLSNVINAGKDIANKLTNKFLNLSEIEVKIKTATNDDNWGPNGSLMREIA
DETFSTTNLQEVMTFLWYRIFTEKPPNNRRTYKGLVLLTYLIVNGSELIA
ASCRAHLGDIKKLQSYIDGHGVADVAIRRKASDICDLLSDSQRLSDERKR
AKSYHQTRNYRSATVTGADGSDSNRQTRNAQPLGDIDDWDIPGSKSLPHV
IGESFMNFVNTFTQNISGPPPTETHDNFDIPAMQYEISTPTPPPMATRED
ESVCNSAPQPRSSNQPVLRIDSSNRKESSNNKAAAKSSLPIAVVPLDRPI
IDFSEPDAINADVDFLLAVNNNTIDNDIDEEFGNLRAGDHSGDAIGRPSQ
LQLINNNYYHPDNSYTHADFCGFVSSDSKEMSNLKSNQSPPSVTTSSIQL
SNPQAQSQLGNSSSTMPKSDKKIGSTWNEIDALNIDLNNLCGRKRMYSKS
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000070intestinal phagocyte
PLANA:0000074oocyte
PLANA:0000208testis
PLANA:0000231vitelline gland
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
PLANA:0007528glial cell
Vocabulary: INTERPRO
TermDefinition
IPR030544CLINT1
IPR013809ENTH
IPR008942ENTH_VHS
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008289lipid binding
GO:0030276clathrin binding
GO:0045296cadherin binding
Vocabulary: cellular component
TermDefinition
GO:0005654nucleoplasm
GO:0005737cytoplasm
GO:0005794Golgi apparatus
GO:0005829cytosol
GO:0016020membrane
GO:0030136clathrin-coated vesicle
GO:0031410cytoplasmic vesicle
GO:0043231intracellular membrane-bounded organelle
GO:0048471perinuclear region of cytoplasm
Vocabulary: biological process
TermDefinition
GO:0006897endocytosis
GO:0016192vesicle-mediated transport
GO:0048268clathrin coat assembly
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013809ENTH domainSMARTSM00273enth_2coord: 24..148
e-value: 7.4E-19
score: 78.7
IPR013809ENTH domainPFAMPF01417ENTHcoord: 24..144
e-value: 3.2E-30
score: 104.7
IPR013809ENTH domainPROSITEPS50942ENTHcoord: 18..148
score: 25.285
IPR008942ENTH/VHSGENE3DG3DSA:1.25.40.90coord: 6..148
e-value: 2.2E-37
score: 130.2
IPR008942ENTH/VHSSUPERFAMILYSSF48464ENTH/VHS domaincoord: 10..148
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 164..189
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 379..422
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 242..282
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 164..181
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 252..282
NoneNo IPR availablePANTHERPTHR12276EPSIN/ENT-RELATEDcoord: 10..179
NoneNo IPR availableCDDcd16989ENTH_EpsinRcoord: 26..152
e-value: 2.50884E-47
score: 157.452
IPR030544Clathrin interactor 1PANTHERPTHR12276:SF83CLATHRIN INTERACTOR 1coord: 10..179