Mitoguardin 2

Overview
NameMitoguardin 2
Smed IDSMED30022242
Length (bp)1560
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Mitoguardin 2 (SMED30022242) t-SNE clustered cells

Violin plots show distribution of expression levels for Mitoguardin 2 (SMED30022242) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Mitoguardin 2 (SMED30022242) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Mitoguardin 2 (SMED30022242) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022242

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30022242h1SMcG0012156 SmedASXL_006899SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Mitoguardin 2 vs. Ensembl Human
Match: MIGA2 (mitoguardin 2 [Source:HGNC Symbol;Acc:HGNC:23621])

HSP 1 Score: 156.377 bits (394), Expect = 1.017e-40
Identity = 94/266 (35.34%), Postives = 152/266 (57.14%), Query Frame = 3
Query:  654 DSFVSAKEYYQDDSVIDEYLEITTKENKHLFKEALLELESGSIYYRTKRTELVNCQNDTEYLAKLYCLRSGFEVISEIESMSKELEDIGLDIGCGILTALGYEIDSFQSAYLRMMQFLHSPNSFGIIKEELSDRGIEVVSLYXXXXXXXXXXALESLENPPSSLVSVINNRWLSEGFKKTTLNSSIWTILLAKRKFLKYKSGFKAHFYDIMDAIGAPLAWSFLGSEIKANQIANQFKDSLNVLIRYLYS-DSPRLTSRQDLAEDIM 1448
            DSF SA E ++     D    I        ++EAL  ++ G +  RT RTEL+ C +D ++LAKL+C+R  FE + E +S       +G  +  G++T        F  +Y  M+ +   P ++   + EL  RG+  +S +DI+ DFIL+DA E LENPP+S+++V+ NRWLS+ FK+T L ++ W++L AKR+ L    GF +HFY + + +   LA+ FLG + +  ++   FK  +   +R ++  D+ R TS   LA+DI+
Sbjct:  291 DSFFSATELFESLQTGD--YPIPLSRPAAAYEEALQLVKEGRVPCRTLRTELLGCYSDQDFLAKLHCVRQAFEGLLEDKSNQLFFGKVGRQMVTGLMTKAEKSPKGFLESYEEMLSYALRPETWATTRLELEGRGVVCMSFFDIVLDFILMDAFEDLENPPASVLAVLRNRWLSDSFKETALATACWSVLKAKRRLLMVPDGFISHFYSVSEHVSPVLAFGFLGPKPQLAEVCAFFKHQIVQYLRDMFDLDNVRYTSLPALADDIL 554          
BLAST of Mitoguardin 2 vs. Ensembl Human
Match: MIGA1 (mitoguardin 1 [Source:HGNC Symbol;Acc:HGNC:24741])

HSP 1 Score: 155.221 bits (391), Expect = 3.065e-40
Identity = 94/267 (35.21%), Postives = 153/267 (57.30%), Query Frame = 3
Query:  651 NDSFVSAKEYYQDDSVIDEYLEITTKENKHLFKEALLELESGSIYYRTKRTELVNCQNDTEYLAKLYCLRSGFEVISEIESMSKELEDIGLDIGCGILTALGYEIDSFQSAYLRMMQFLHSPNSFGIIKEELSDRGIEVVSLYXXXXXXXXXXALESLENPPSSLVSVINNRWLSEGFKKTTLNSSIWTILLAKRKFLKYKSGFKAHFYDIMDAIGAPLAWSFLGSEIKANQIANQFKDSLNVLIRYLYS-DSPRLTSRQDLAEDIM 1448
             DSF SA E  +   V   Y  + +  +   ++EA+  +E G IY R  RTE++ C  D+++LAKL+C+R  F+VI    +    L + G  I   ++         F+  +  M+ FL   + +G  + EL+ RG++ ++ YD++ DFIL+D+ E LENPP+S+ +V+NNRWL+  FK+T + SS W++L  KR+ +K   GF AHFY I + I   LAW FLG       +   FK+ + + ++ ++  +  R +S + LAED+M
Sbjct:  292 TDSFASAAELAEHREVRHTY-SLESLCHCPFYEEAMHLVEEGKIYSRVLRTEMLECLGDSDFLAKLHCIRQAFQVILSESANRIFLAESGRKILSALIVKARKNPKKFEDVFDEMIYFLEQTDHWGSTEMELAARGVKNLNFYDVVLDFILMDSFEDLENPPTSIQNVVNNRWLNSSFKETAVASSCWSVLKQKRQQMKIPDGFFAHFYAICEHISPVLAWGFLGPRNSLYDLCCFFKNQVLLFLKDIFDFEKVRYSSTETLAEDLM 557          
BLAST of Mitoguardin 2 vs. Ensembl Human
Match: MIGA1 (mitoguardin 1 [Source:HGNC Symbol;Acc:HGNC:24741])

HSP 1 Score: 154.451 bits (389), Expect = 5.850e-40
Identity = 94/267 (35.21%), Postives = 153/267 (57.30%), Query Frame = 3
Query:  651 NDSFVSAKEYYQDDSVIDEYLEITTKENKHLFKEALLELESGSIYYRTKRTELVNCQNDTEYLAKLYCLRSGFEVISEIESMSKELEDIGLDIGCGILTALGYEIDSFQSAYLRMMQFLHSPNSFGIIKEELSDRGIEVVSLYXXXXXXXXXXALESLENPPSSLVSVINNRWLSEGFKKTTLNSSIWTILLAKRKFLKYKSGFKAHFYDIMDAIGAPLAWSFLGSEIKANQIANQFKDSLNVLIRYLYS-DSPRLTSRQDLAEDIM 1448
             DSF SA E  +   V   Y  + +  +   ++EA+  +E G IY R  RTE++ C  D+++LAKL+C+R  F+VI    +    L + G  I   ++         F+  +  M+ FL   + +G  + EL+ RG++ ++ YD++ DFIL+D+ E LENPP+S+ +V+NNRWL+  FK+T + SS W++L  KR+ +K   GF AHFY I + I   LAW FLG       +   FK+ + + ++ ++  +  R +S + LAED+M
Sbjct:  296 TDSFASAAELAEHREVRHTY-SLESLCHCPFYEEAMHLVEEGKIYSRVLRTEMLECLGDSDFLAKLHCIRQAFQVILSESANRIFLAESGRKILSALIVKARKNPKKFEDVFDEMIYFLEQTDHWGSTEMELAARGVKNLNFYDVVLDFILMDSFEDLENPPTSIQNVVNNRWLNSSFKETAVASSCWSVLKQKRQQMKIPDGFFAHFYAICEHISPVLAWGFLGPRNSLYDLCCFFKNQVLLFLKDIFDFEKVRYSSTETLAEDLM 561          
BLAST of Mitoguardin 2 vs. Ensembl Human
Match: MIGA1 (mitoguardin 1 [Source:HGNC Symbol;Acc:HGNC:24741])

HSP 1 Score: 154.451 bits (389), Expect = 7.968e-40
Identity = 94/267 (35.21%), Postives = 153/267 (57.30%), Query Frame = 3
Query:  651 NDSFVSAKEYYQDDSVIDEYLEITTKENKHLFKEALLELESGSIYYRTKRTELVNCQNDTEYLAKLYCLRSGFEVISEIESMSKELEDIGLDIGCGILTALGYEIDSFQSAYLRMMQFLHSPNSFGIIKEELSDRGIEVVSLYXXXXXXXXXXALESLENPPSSLVSVINNRWLSEGFKKTTLNSSIWTILLAKRKFLKYKSGFKAHFYDIMDAIGAPLAWSFLGSEIKANQIANQFKDSLNVLIRYLYS-DSPRLTSRQDLAEDIM 1448
             DSF SA E  +   V   Y  + +  +   ++EA+  +E G IY R  RTE++ C  D+++LAKL+C+R  F+VI    +    L + G  I   ++         F+  +  M+ FL   + +G  + EL+ RG++ ++ YD++ DFIL+D+ E LENPP+S+ +V+NNRWL+  FK+T + SS W++L  KR+ +K   GF AHFY I + I   LAW FLG       +   FK+ + + ++ ++  +  R +S + LAED+M
Sbjct:  324 TDSFASAAELAEHREVRHTY-SLESLCHCPFYEEAMHLVEEGKIYSRVLRTEMLECLGDSDFLAKLHCIRQAFQVILSESANRIFLAESGRKILSALIVKARKNPKKFEDVFDEMIYFLEQTDHWGSTEMELAARGVKNLNFYDVVLDFILMDSFEDLENPPTSIQNVVNNRWLNSSFKETAVASSCWSVLKQKRQQMKIPDGFFAHFYAICEHISPVLAWGFLGPRNSLYDLCCFFKNQVLLFLKDIFDFEKVRYSSTETLAEDLM 589          
BLAST of Mitoguardin 2 vs. Ensembl Human
Match: MIGA1 (mitoguardin 1 [Source:HGNC Symbol;Acc:HGNC:24741])

HSP 1 Score: 154.451 bits (389), Expect = 7.968e-40
Identity = 94/267 (35.21%), Postives = 153/267 (57.30%), Query Frame = 3
Query:  651 NDSFVSAKEYYQDDSVIDEYLEITTKENKHLFKEALLELESGSIYYRTKRTELVNCQNDTEYLAKLYCLRSGFEVISEIESMSKELEDIGLDIGCGILTALGYEIDSFQSAYLRMMQFLHSPNSFGIIKEELSDRGIEVVSLYXXXXXXXXXXALESLENPPSSLVSVINNRWLSEGFKKTTLNSSIWTILLAKRKFLKYKSGFKAHFYDIMDAIGAPLAWSFLGSEIKANQIANQFKDSLNVLIRYLYS-DSPRLTSRQDLAEDIM 1448
             DSF SA E  +   V   Y  + +  +   ++EA+  +E G IY R  RTE++ C  D+++LAKL+C+R  F+VI    +    L + G  I   ++         F+  +  M+ FL   + +G  + EL+ RG++ ++ YD++ DFIL+D+ E LENPP+S+ +V+NNRWL+  FK+T + SS W++L  KR+ +K   GF AHFY I + I   LAW FLG       +   FK+ + + ++ ++  +  R +S + LAED+M
Sbjct:  324 TDSFASAAELAEHREVRHTY-SLESLCHCPFYEEAMHLVEEGKIYSRVLRTEMLECLGDSDFLAKLHCIRQAFQVILSESANRIFLAESGRKILSALIVKARKNPKKFEDVFDEMIYFLEQTDHWGSTEMELAARGVKNLNFYDVVLDFILMDSFEDLENPPTSIQNVVNNRWLNSSFKETAVASSCWSVLKQKRQQMKIPDGFFAHFYAICEHISPVLAWGFLGPRNSLYDLCCFFKNQVLLFLKDIFDFEKVRYSSTETLAEDLM 589          
BLAST of Mitoguardin 2 vs. Ensembl Celegans
Match: K01D12.6 (pep chromosome:WBcel235:V:12398759:12400859:-1 gene:WBGene00010465.1 transcript:K01D12.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K01D12.6)

HSP 1 Score: 105.916 bits (263), Expect = 3.334e-24
Identity = 78/291 (26.80%), Postives = 153/291 (52.58%), Query Frame = 3
Query:  651 NDSFVSAKEYYQDDSVIDEYLEITTKENK-----HLFKEALLELESGSIYYRTKRTELVNCQNDTEYLAKLYCLRSGFEVISEIESMSKELEDIGLDIGCGILTALGYEIDSFQSAYLRMMQFLHSPNSFGIIKEELSDRGIEVVSLYXXXXXXXXXXALESLENPPSSLVSVINNRWLSEGFKKTTLNSSIWTILLAKRKFLKYKSGFKAHFYDIMDAIGAPLAWSFLGSEIKANQIANQFKDSLNVLIRYLYSDSPRLTSR--QDLAEDIML----KIHSLKNSLNNEL 1490
            +DSF SA E +  D  ID+   ++   N          E +    +G + YR  R E   C ++T++ AKLYC+R       + E     L   G  +    +     +   F +AY  M++++ +  +   +++++  RG+     YD+  DFI+LDA E L++PPS++ SV  N ++S   K +TLN+ IW+I+ +KR+ LK   GF A FY+I + +   +   FLG++ +  ++   FK+ +   +  ++ ++ ++  R  ++++ED+ +    ++ +++  ++NEL
Sbjct:  209 DDSFRSAVEEFACD--IDDIDFVSDAANLDKNELRFLDEGMQAALNGEVKYRKSRMEFCKCDSETDFAAKLYCVRQALTNALKDEHKRVWLAKCGRTLLADFIRHTKQDPVKFFNAYDEMLEYVSNDRNEEQLRQDVEGRGVCETGFYDVAIDFIILDAFEDLKSPPSAVYSVTKNYFMSMSMKYSTLNTIIWSIIKSKRQRLKNPDGFIAKFYNISETVMPAITLGFLGTDERLGELCQYFKEQVVQFVLDVF-NTQKVCYRSLEEMSEDVWIVMRNRLEAVQTRMSNEL 496          
BLAST of Mitoguardin 2 vs. Ensembl Fly
Match: Miga (gene:FBgn0030037 transcript:FBtr0071246)

HSP 1 Score: 161.384 bits (407), Expect = 3.429e-43
Identity = 92/277 (33.21%), Postives = 161/277 (58.12%), Query Frame = 3
Query:  654 DSFVSAKEYYQDDSVIDEYLEITTKENKHLFKEALLELESGSIYYRTKRTELVNCQNDTEYLAKLYCLRSGFEVISEIESMSKELEDIGLDIGCGILTALGYEIDSFQSAYLRMMQFLHSPNSFGIIKEELSDRGIEVVSLYXXXXXXXXXXALESLENPPSSLVSVINNRWLSEGFKKTTLNSSIWTILLAKRKFLKYKSGFKAHFYDIMDAIGAPLAWSFLGSEIKANQIANQFKDSLNVLIRYLYS-DSPRLTSRQDLAEDIMLKIHSLKNSLN 1481
            +SF SA +   D    D ++E T+ E   LF+ AL   +  ++  RT R EL++C  DTEYLAKL+C+R  F+ + +  ++ + + D G  I   +L     +   F   Y  M+ +LH  N++  I+ EL  R ++ ++ YDI  DFI+LD+ + L+ PP+S+ +V+ NRWLS GFK+T L +++W++L AK++ LK+ +GF +HFY I + I   +AW F G       I + F++ L   +  ++S    R T+ ++ ++D++  + +  N++ 
Sbjct:  245 ESFASALDQVADLREFDGFIE-TSYEEYPLFQSALKHHDEYTVPCRTIRAELMHCSTDTEYLAKLHCVRLAFQFLFKDPAVGQWICDAGRQILTDLLCLGDKDTKEFLVGYEDMVNYLHDSNNWPCIQMELEQRNVKAMTFYDICLDFIILDSFKDLDAPPASVTAVVQNRWLSNGFKETALTTAVWSVLKAKKRMLKFPNGFMSHFYVISEQISPLMAWGFFGPNENLRDICHYFREELLAFLGDIFSFQKSRFTTIEEFSQDVLQHMQTRVNNIG 520          
BLAST of Mitoguardin 2 vs. Ensembl Fly
Match: Miga (gene:FBgn0030037 transcript:FBtr0300383)

HSP 1 Score: 161.384 bits (407), Expect = 3.429e-43
Identity = 92/277 (33.21%), Postives = 161/277 (58.12%), Query Frame = 3
Query:  654 DSFVSAKEYYQDDSVIDEYLEITTKENKHLFKEALLELESGSIYYRTKRTELVNCQNDTEYLAKLYCLRSGFEVISEIESMSKELEDIGLDIGCGILTALGYEIDSFQSAYLRMMQFLHSPNSFGIIKEELSDRGIEVVSLYXXXXXXXXXXALESLENPPSSLVSVINNRWLSEGFKKTTLNSSIWTILLAKRKFLKYKSGFKAHFYDIMDAIGAPLAWSFLGSEIKANQIANQFKDSLNVLIRYLYS-DSPRLTSRQDLAEDIMLKIHSLKNSLN 1481
            +SF SA +   D    D ++E T+ E   LF+ AL   +  ++  RT R EL++C  DTEYLAKL+C+R  F+ + +  ++ + + D G  I   +L     +   F   Y  M+ +LH  N++  I+ EL  R ++ ++ YDI  DFI+LD+ + L+ PP+S+ +V+ NRWLS GFK+T L +++W++L AK++ LK+ +GF +HFY I + I   +AW F G       I + F++ L   +  ++S    R T+ ++ ++D++  + +  N++ 
Sbjct:  245 ESFASALDQVADLREFDGFIE-TSYEEYPLFQSALKHHDEYTVPCRTIRAELMHCSTDTEYLAKLHCVRLAFQFLFKDPAVGQWICDAGRQILTDLLCLGDKDTKEFLVGYEDMVNYLHDSNNWPCIQMELEQRNVKAMTFYDICLDFIILDSFKDLDAPPASVTAVVQNRWLSNGFKETALTTAVWSVLKAKKRMLKFPNGFMSHFYVISEQISPLMAWGFFGPNENLRDICHYFREELLAFLGDIFSFQKSRFTTIEEFSQDVLQHMQTRVNNIG 520          
BLAST of Mitoguardin 2 vs. Ensembl Fly
Match: Miga (gene:FBgn0030037 transcript:FBtr0345986)

HSP 1 Score: 161.384 bits (407), Expect = 3.429e-43
Identity = 92/277 (33.21%), Postives = 161/277 (58.12%), Query Frame = 3
Query:  654 DSFVSAKEYYQDDSVIDEYLEITTKENKHLFKEALLELESGSIYYRTKRTELVNCQNDTEYLAKLYCLRSGFEVISEIESMSKELEDIGLDIGCGILTALGYEIDSFQSAYLRMMQFLHSPNSFGIIKEELSDRGIEVVSLYXXXXXXXXXXALESLENPPSSLVSVINNRWLSEGFKKTTLNSSIWTILLAKRKFLKYKSGFKAHFYDIMDAIGAPLAWSFLGSEIKANQIANQFKDSLNVLIRYLYS-DSPRLTSRQDLAEDIMLKIHSLKNSLN 1481
            +SF SA +   D    D ++E T+ E   LF+ AL   +  ++  RT R EL++C  DTEYLAKL+C+R  F+ + +  ++ + + D G  I   +L     +   F   Y  M+ +LH  N++  I+ EL  R ++ ++ YDI  DFI+LD+ + L+ PP+S+ +V+ NRWLS GFK+T L +++W++L AK++ LK+ +GF +HFY I + I   +AW F G       I + F++ L   +  ++S    R T+ ++ ++D++  + +  N++ 
Sbjct:  245 ESFASALDQVADLREFDGFIE-TSYEEYPLFQSALKHHDEYTVPCRTIRAELMHCSTDTEYLAKLHCVRLAFQFLFKDPAVGQWICDAGRQILTDLLCLGDKDTKEFLVGYEDMVNYLHDSNNWPCIQMELEQRNVKAMTFYDICLDFIILDSFKDLDAPPASVTAVVQNRWLSNGFKETALTTAVWSVLKAKKRMLKFPNGFMSHFYVISEQISPLMAWGFFGPNENLRDICHYFREELLAFLGDIFSFQKSRFTTIEEFSQDVLQHMQTRVNNIG 520          
BLAST of Mitoguardin 2 vs. Ensembl Zebrafish
Match: miga2 (mitoguardin 2 [Source:NCBI gene;Acc:541431])

HSP 1 Score: 159.844 bits (403), Expect = 4.374e-42
Identity = 99/283 (34.98%), Postives = 162/283 (57.24%), Query Frame = 3
Query:  651 NDSFVSAKEYYQDDSVIDEYLEITTKENKHLFKEALLELESGSIYYRTKRTELVNCQNDTEYLAKLYCLRSGFEVISEIESMSKELEDIGLDIGCGILTALGYEIDSFQSAYLRMMQFLHSPNSFGIIKEELSDRGIEVVSLYXXXXXXXXXXALESLENPPSSLVSVINNRWLSEGFKKTTLNSSIWTILLAKRKFLKYKSGFKAHFYDIMDAIGAPLAWSFLGSEIKANQIANQFKDSLNVLIRYLYS-DSPRLTSRQDLAEDIMLKIHSLKNSLNNELAV 1496
            +DSF SA E ++  S+ D +  +   +   L++EAL  ++ G +  R+ RTEL+ C +D ++LAKL+C+R  F+V+   E+      + G  +  G+L        +F  +Y  M+Q+     ++ + K EL  RG+  ++ +DI+ DFIL+DA E LE+PPSS+V+V+ NRWLS+ FK+T L ++ W++L AKR+ L    GF AHFY I + +   LA+ FLG     +++   FK  +   ++ ++  D  R TS   LAEDI+   H   + L   L +
Sbjct:  288 DDSFFSAAELFETFSLEDSFHLL---KPAALYEEALSLVKDGDVACRSLRTELLECYSDQDFLAKLHCVRQAFQVLLLDETHRMFFMETGKQMISGLLVKANKSPKAFLESYEDMLQYTQREETWPVSKMELEGRGVVCMNFFDIVLDFILMDAFEDLESPPSSVVAVLRNRWLSDSFKETALATACWSVLKAKRRLLMVPDGFIAHFYVISEHVSPVLAFGFLGPHQHLSEVCTIFKQQIVQYLKDMFDHDKVRFTSVPSLAEDILRLSHRRADILMGYLGI 567          
BLAST of Mitoguardin 2 vs. Ensembl Zebrafish
Match: miga1 (mitoguardin 1 [Source:NCBI gene;Acc:450070])

HSP 1 Score: 150.984 bits (380), Expect = 6.111e-39
Identity = 111/347 (31.99%), Postives = 175/347 (50.43%), Query Frame = 3
Query:  546 MKHLLEEAFRIREKFKQKLIIXXXXXXXX------------------------XXXXXXNDSFVSAKEYYQDDSVIDEYLEITTKEN-----KHLFKEALLEL-ESGSIYYRTKRTELVNCQNDTEYLAKLYCLRSGFEVISEIESMSKELEDIGLDIGCGILTALGYEIDSFQSAYLRMMQFLHSPNSFGIIKEELSDRGIEVVSLYXXXXXXXXXXALESLENPPSSLVSVINNRWLSEGFKKTTLNSSIWTILLAKRKFLKYKSGFKAHFYDIMDAIGAPLAWSFLGSEIKANQIANQFKDSLNVLIRYLYS-DSPRLTSRQDLAEDIMLKIHSLKNSLNNELA 1493
            ++ LL+ A+R++E+F+  L +T  +   +                            +S DSFVSA E       + E+ E+ +         H F E  L++ E G I  R  RTE++ C  D ++LAKL+C+R   +VI    +    L D G  I   I+         F+  +  M+ FL   + +   + ELS RG++ ++ YD++ DFIL+D+ E LENPP S+ +V+NNRWLS  FK+T + SS W++L  KR+ +K + GF AHFY + + I   LAW FLG +         FK+ +   ++ ++  D  R  S + LAEDI+  +H   + L   LA
Sbjct:  228 LESLLQRAYRLQEEFEGSLGVTDPTTHPTNVLLADKHMDLSVREELEDTCLRDSISIASTDSFVSAAE-------LSEHREMRSGHALGSLCPHPFYEDALQMAEEGKISCRVLRTEMLECLGDADFLAKLHCVRQACQVILCERATRAFLADTGKRILSAIIARARKSPKRFEEVFEEMISFLEHTDHWENTENELSSRGVKHMNFYDVVLDFILMDSFEDLENPPLSIQTVVNNRWLSNSFKETAVASSCWSVLKQKRQHIKVQDGFIAHFYAVCEHISPVLAWGFLGPKCTLQDFCCFFKEQVLFFLKDIFDLDKVRYFSLETLAEDILHLLHRRSDLLMAYLA 567          
BLAST of Mitoguardin 2 vs. Ensembl Xenopus
Match: slc25a30 (solute carrier family 25 member 30 [Source:Xenbase;Acc:XB-GENE-995074])

HSP 1 Score: 151.369 bits (381), Expect = 4.775e-39
Identity = 93/269 (34.57%), Postives = 154/269 (57.25%), Query Frame = 3
Query:  654 DSFVSAKEYYQDDSVIDEYLEITTKENKHLFKEALLELESGSIYYRTKRTELVNCQNDTEYLAKLYCLRSGFEVISEIESMSKELEDIGLDIGCGILTALGYEIDSFQSAYLRMMQFLHSPNSFGIIKEELSDRGIEVVSLYXXXXXXXXXXALESLENPPSSLVSVINNRWLSEGFKKTTLNSSIWTILLAKRKFLKYKSGFKAHFYDIMDAIGAPLAWSFLGSEIKANQIANQFKDSLNVLIRYLYS----DSPRLTSRQDLAEDIM 1448
            DSF SA E +  D++    +     +    ++EAL+ + +G +  RT RTEL+ C ND ++LAKL+C+R  FEV+   E       ++G  +  G++         F   Y  M+++    +++   ++EL  RG+  ++ +DI  DFIL+DA E LE+PPSS+++V+ NRWLS+ FK+T L ++ W++L AKR+ L    GF +HFY + + +   LA+ FLG +    +I N FK   + +++YL      D    T+ Q LA+DI+
Sbjct:  289 DSFFSAAELF--DTLQLNEVPFRPPKPAAAYEEALMLVHTGEVACRTLRTELLGCYNDQDFLAKLHCVRQAFEVLLLDERNRLFFGEVGKQMVSGLMQKAEKNPKGFLENYEEMLRYALKEDTWTTTQKELKGRGVVCMNFFDIALDFILMDAFEDLESPPSSVIAVLRNRWLSDSFKETALATACWSVLKAKRRLLMVPDGFISHFYSVSEHVSPVLAFGFLGPKEHLAEICNFFK---HQIVQYLTDMFDLDKVSYTTIQSLADDIL 552          
BLAST of Mitoguardin 2 vs. Ensembl Xenopus
Match: slc25a30 (solute carrier family 25 member 30 [Source:Xenbase;Acc:XB-GENE-995074])

HSP 1 Score: 150.984 bits (380), Expect = 7.360e-39
Identity = 93/269 (34.57%), Postives = 154/269 (57.25%), Query Frame = 3
Query:  654 DSFVSAKEYYQDDSVIDEYLEITTKENKHLFKEALLELESGSIYYRTKRTELVNCQNDTEYLAKLYCLRSGFEVISEIESMSKELEDIGLDIGCGILTALGYEIDSFQSAYLRMMQFLHSPNSFGIIKEELSDRGIEVVSLYXXXXXXXXXXALESLENPPSSLVSVINNRWLSEGFKKTTLNSSIWTILLAKRKFLKYKSGFKAHFYDIMDAIGAPLAWSFLGSEIKANQIANQFKDSLNVLIRYLYS----DSPRLTSRQDLAEDIM 1448
            DSF SA E +  D++    +     +    ++EAL+ + +G +  RT RTEL+ C ND ++LAKL+C+R  FEV+   E       ++G  +  G++         F   Y  M+++    +++   ++EL  RG+  ++ +DI  DFIL+DA E LE+PPSS+++V+ NRWLS+ FK+T L ++ W++L AKR+ L    GF +HFY + + +   LA+ FLG +    +I N FK   + +++YL      D    T+ Q LA+DI+
Sbjct:  289 DSFFSAAELF--DTLQLNEVPFRPPKPAAAYEEALMLVHTGEVACRTLRTELLGCYNDQDFLAKLHCVRQAFEVLLLDERNRLFFGEVGKQMVSGLMQKAEKNPKGFLENYEEMLRYALKEDTWTTTQKELKGRGVVCMNFFDIALDFILMDAFEDLESPPSSVIAVLRNRWLSDSFKETALATACWSVLKAKRRLLMVPDGFISHFYSVSEHVSPVLAFGFLGPKEHLAEICNFFK---HQIVQYLTDMFDLDKVSYTTIQSLADDIL 552          
BLAST of Mitoguardin 2 vs. Ensembl Xenopus
Match: miga1 (mitoguardin 1 [Source:NCBI gene;Acc:100145180])

HSP 1 Score: 146.747 bits (369), Expect = 2.123e-37
Identity = 91/271 (33.58%), Postives = 156/271 (57.56%), Query Frame = 3
Query:  651 NDSFVSAKEYYQDDSVIDEYLEITTKENKHLFKEALLELESGSIYYRTKRTELVNCQNDTEYLAKLYCLRSGFEVISEIESMSKELEDIGLDIGCGILTALGYEI----DSFQSAYLRMMQFLHSPNSFGIIKEELSDRGIEVVSLYXXXXXXXXXXALESLENPPSSLVSVINNRWLSEGFKKTTLNSSIWTILLAKRKFLKYKSGFKAHFYDIMDAIGAPLAWSFLGSEIKANQIANQFKDSLNVLIRYLYS-DSPRLTSRQDLAEDIM 1448
             DSF+SA E   D+  +     + +  +  L++EA+  +E G ++ R  RTE++ C  D+++LAKL+C+R  F+ I     + +E     +  G  +L+ L  +       F+ AY  MM FL    S+   + EL  RG++ ++ YDI+ DFI++D+LE LENPP S+ +V+ NRWL+  FK+T + SS W++L  K++ +K  +GF A+FY + + +   LAW FLG     + +   +KD +   ++ ++  +  R ++ + LAEDIM
Sbjct:  283 TDSFLSAAEL-SDNQELRPTRGLGSLYHNALYEEAMQLVEEGKVHCRVLRTEMLECLGDSDFLAKLHCIRQAFQEIF----LQRENRIFLMGTGRKLLSTLIVKARKNPKKFEDAYFEMMCFLEQSESWDTAEIELFSRGVKCINFYDIVLDFIVMDSLEDLENPPLSIQNVVRNRWLNSSFKETAVTSSCWSVLKQKKQQIKVANGFFANFYTVCEQLCPVLAWGFLGPRSSLHDLCCFYKDQVMFFLKDIFDFEKVRYSNVEHLAEDIM 548          
BLAST of Mitoguardin 2 vs. Ensembl Xenopus
Match: slc25a30 (solute carrier family 25 member 30 [Source:Xenbase;Acc:XB-GENE-995074])

HSP 1 Score: 142.51 bits (358), Expect = 4.820e-36
Identity = 94/274 (34.31%), Postives = 152/274 (55.47%), Query Frame = 3
Query:  654 DSFVSAKEYYQDDSVIDEYLEITTKENKHLFKEALLELESGSIYYRTKRTELVNCQNDTEYLAKLYCLRSGFEV-----ISEIESMSKELEDIGLDIGCGILTALGYEIDSFQSAYLRMMQFLHSPNSFGIIKEELSDRGIEVVSLYXXXXXXXXXXALESLENPPSSLVSVINNRWLSEGFKKTTLNSSIWTILLAKRKFLKYKSGFKAHFYDIMDAIGAPLAWSFLGSEIKANQIANQFKDSLNVLIRYLYS----DSPRLTSRQDLAEDIM 1448
            DSF SA E +  D++    +     +    ++EAL+ + +G +  RT RTEL+ C ND ++LAKL+C+R  FEV     ++  +    EL    L         L +    F   Y  M+++    +++   ++EL  RG+  ++ +DI  DFIL+DA E LE+PPSS+++V+ NRWLS+ FK+T L ++ W++L AKR+ L    GF +HFY + + +   LA+ FLG +    +I N FK     +++YL      D    T+ Q LA+DI+
Sbjct:  252 DSFFSAAELF--DTLQLNEVPFRPPKPAAAYEEALMLVHTGEVACRTLRTELLGCYNDQDFLAKLHCVRQAFEVNLLLYLTVFKICFGELPKTIL------FNYLSFSHICFLENYEEMLRYALKEDTWTTTQKELKGRGVVCMNFFDIALDFILMDAFEDLESPPSSVIAVLRNRWLSDSFKETALATACWSVLKAKRRLLMVPDGFISHFYSVSEHVSPVLAFGFLGPKEHLAEICNFFKHQ---IVQYLTDMFDLDKVSYTTIQSLADDIL 514          
BLAST of Mitoguardin 2 vs. Ensembl Xenopus
Match: slc25a30 (solute carrier family 25 member 30 [Source:Xenbase;Acc:XB-GENE-995074])

HSP 1 Score: 142.51 bits (358), Expect = 7.404e-36
Identity = 94/274 (34.31%), Postives = 153/274 (55.84%), Query Frame = 3
Query:  654 DSFVSAKEYYQDDSVIDEYLEITTKENKHLFKEALLELESGSIYYRTKRTELVNCQNDTEYLAKLYCLRSGFEV-----ISEIESMSKELEDIGLDIGCGILTALGYEIDSFQSAYLRMMQFLHSPNSFGIIKEELSDRGIEVVSLYXXXXXXXXXXALESLENPPSSLVSVINNRWLSEGFKKTTLNSSIWTILLAKRKFLKYKSGFKAHFYDIMDAIGAPLAWSFLGSEIKANQIANQFKDSLNVLIRYLYS----DSPRLTSRQDLAEDIM 1448
            DSF SA E +  D++    +     +    ++EAL+ + +G +  RT RTEL+ C ND ++LAKL+C+R  FEV     ++  +    EL    L         L +    F   Y  M+++    +++   ++EL  RG+  ++ +DI  DFIL+DA E LE+PPSS+++V+ NRWLS+ FK+T L ++ W++L AKR+ L    GF +HFY + + +   LA+ FLG +    +I N FK   + +++YL      D    T+ Q LA+DI+
Sbjct:  289 DSFFSAAELF--DTLQLNEVPFRPPKPAAAYEEALMLVHTGEVACRTLRTELLGCYNDQDFLAKLHCVRQAFEVNLLLYLTVFKICFGELPKTIL------FNYLSFSHICFLENYEEMLRYALKEDTWTTTQKELKGRGVVCMNFFDIALDFILMDAFEDLESPPSSVIAVLRNRWLSDSFKETALATACWSVLKAKRRLLMVPDGFISHFYSVSEHVSPVLAFGFLGPKEHLAEICNFFK---HQIVQYLTDMFDLDKVSYTTIQSLADDIL 551          
BLAST of Mitoguardin 2 vs. Ensembl Mouse
Match: Miga2 (mitoguardin 2 [Source:MGI Symbol;Acc:MGI:1922035])

HSP 1 Score: 160.614 bits (405), Expect = 2.014e-42
Identity = 97/266 (36.47%), Postives = 155/266 (58.27%), Query Frame = 3
Query:  654 DSFVSAKEYYQDDSVIDEYLEITTKENKHLFKEALLELESGSIYYRTKRTELVNCQNDTEYLAKLYCLRSGFEVISEIESMSKELEDIGLDIGCGILTALGYEIDSFQSAYLRMMQFLHSPNSFGIIKEELSDRGIEVVSLYXXXXXXXXXXALESLENPPSSLVSVINNRWLSEGFKKTTLNSSIWTILLAKRKFLKYKSGFKAHFYDIMDAIGAPLAWSFLGSEIKANQIANQFKDSLNVLIRYLYS-DSPRLTSRQDLAEDIM 1448
            DSF SA E ++    I EY  +        ++EAL  ++ G +  RT RTEL+ C +D ++LAKL+C+R  FE + E  S      ++G  +  G++T        F  +Y  M+ +   P ++   + EL  RG+  +S +DI+ DFIL+DA E LENPPSS+++V+ NRWLS+ FK+T L ++ W++L AKR+ L    GF +HFY + + +   LA+ FLG + + +++   FK  +   +R ++  D+ R TS   LAEDI+
Sbjct:  291 DSFFSATEIFESLQ-IGEY-PLPLSRPAAAYEEALQLVKEGRVPCRTLRTELLGCYSDQDFLAKLHCVRQAFEGLLEERSNQIFFGEVGRQMVTGLMTKAEKSPKGFLESYEEMLSYALRPETWATTRLELEGRGVACMSFFDIVLDFILMDAFEDLENPPSSVLAVLRNRWLSDSFKETALATACWSVLKAKRRLLMVPDGFISHFYSVSEHVSPVLAFGFLGPKPQLSEVCAFFKHQIVQYLRDMFDLDNVRYTSVPALAEDIL 554          
BLAST of Mitoguardin 2 vs. Ensembl Mouse
Match: Miga2 (mitoguardin 2 [Source:MGI Symbol;Acc:MGI:1922035])

HSP 1 Score: 160.614 bits (405), Expect = 2.014e-42
Identity = 97/266 (36.47%), Postives = 155/266 (58.27%), Query Frame = 3
Query:  654 DSFVSAKEYYQDDSVIDEYLEITTKENKHLFKEALLELESGSIYYRTKRTELVNCQNDTEYLAKLYCLRSGFEVISEIESMSKELEDIGLDIGCGILTALGYEIDSFQSAYLRMMQFLHSPNSFGIIKEELSDRGIEVVSLYXXXXXXXXXXALESLENPPSSLVSVINNRWLSEGFKKTTLNSSIWTILLAKRKFLKYKSGFKAHFYDIMDAIGAPLAWSFLGSEIKANQIANQFKDSLNVLIRYLYS-DSPRLTSRQDLAEDIM 1448
            DSF SA E ++    I EY  +        ++EAL  ++ G +  RT RTEL+ C +D ++LAKL+C+R  FE + E  S      ++G  +  G++T        F  +Y  M+ +   P ++   + EL  RG+  +S +DI+ DFIL+DA E LENPPSS+++V+ NRWLS+ FK+T L ++ W++L AKR+ L    GF +HFY + + +   LA+ FLG + + +++   FK  +   +R ++  D+ R TS   LAEDI+
Sbjct:  291 DSFFSATEIFESLQ-IGEY-PLPLSRPAAAYEEALQLVKEGRVPCRTLRTELLGCYSDQDFLAKLHCVRQAFEGLLEERSNQIFFGEVGRQMVTGLMTKAEKSPKGFLESYEEMLSYALRPETWATTRLELEGRGVACMSFFDIVLDFILMDAFEDLENPPSSVLAVLRNRWLSDSFKETALATACWSVLKAKRRLLMVPDGFISHFYSVSEHVSPVLAFGFLGPKPQLSEVCAFFKHQIVQYLRDMFDLDNVRYTSVPALAEDIL 554          
BLAST of Mitoguardin 2 vs. Ensembl Mouse
Match: Miga1 (mitoguardin 1 [Source:MGI Symbol;Acc:MGI:1924567])

HSP 1 Score: 142.51 bits (358), Expect = 5.387e-36
Identity = 83/236 (35.17%), Postives = 136/236 (57.63%), Query Frame = 3
Query:  741 LFKEALLELESGSIYYRTKRTELVNCQNDTEYLAKLYCLRSGFEVISEIESMSKELEDIGLDIGCGILTALGYEIDSFQSAYLRMMQFLHSPNSFGIIKEELSDRGIEVVSLYXXXXXXXXXXALESLENPPSSLVSVINNRWLSEGFKKTTLNSSIWTILLAKRKFLKYKSGFKAHFYDIMDAIGAPLAWSFLGSEIKANQIANQFKDSLNVLIRYLYS-DSPRLTSRQDLAEDI 1445
             ++EA+  +E G IY R  RTE++ C  D+++LAKL+C+R  F++I         L + G  I   ++         FQ  +  M+ FL   + +   + EL+ RG++ ++ YD++ DFIL+D+ E LENPP+S+ SV+NNRWL+  FK++ + SS W++L  KR+ +K   GF AHFY I + +   LAW FLG       +   FK+ +   ++ ++  +  R +S   LAED+
Sbjct:  321 FYEEAMHLVEEGKIYSRVLRTEMLECLGDSDFLAKLHCIRQAFQLILAEADNRSFLAESGRKILSALIVKARKNPKKFQDVFDEMINFLEQTDHWDSTELELAARGVKNLNFYDVVLDFILMDSFEDLENPPTSIQSVVNNRWLNSSFKESAVASSCWSVLKQKRQQMKISDGFFAHFYAICEHVSPVLAWGFLGPRNSLYDLCCFFKNQVLFFLKDIFDFEKVRYSSIDTLAEDL 556          
BLAST of Mitoguardin 2 vs. Ensembl Mouse
Match: Miga1 (mitoguardin 1 [Source:MGI Symbol;Acc:MGI:1924567])

HSP 1 Score: 111.694 bits (278), Expect = 9.077e-26
Identity = 63/171 (36.84%), Postives = 104/171 (60.82%), Query Frame = 3
Query:  741 LFKEALLELESGSIYYRTKRTELVNCQNDTEYLAKLYCLRSGFEVISEIESMSKELEDIGLDIGCGILTALGYEIDSFQSAYLRMMQFLHSPNSFGIIKEELSDRGIEVVSLYXXXXXXXXXXALESLENPPSSLVSVINNRWLSEGFKKTTLNSSIWTILLAKRKFLKYK 1253
             ++EA+  +E G IY R  RTE++ C  D+++LAKL+C+R  F++I         L + G  I   ++         FQ  +  M+ FL   + +   + EL+ RG++ ++ YD++ DFIL+D+ E LENPP+S+ SV+NNRWL+  FK++ + SS W++L  KR+ +K K
Sbjct:  321 FYEEAMHLVEEGKIYSRVLRTEMLECLGDSDFLAKLHCIRQAFQLILAEADNRSFLAESGRKILSALIVKARKNPKKFQDVFDEMINFLEQTDHWDSTELELAARGVKNLNFYDVVLDFILMDSFEDLENPPTSIQSVVNNRWLNSSFKESAVASSCWSVLKQKRQQMKVK 491          
BLAST of Mitoguardin 2 vs. Ensembl Mouse
Match: Miga1 (mitoguardin 1 [Source:MGI Symbol;Acc:MGI:1924567])

HSP 1 Score: 102.834 bits (255), Expect = 7.999e-23
Identity = 60/159 (37.74%), Postives = 97/159 (61.01%), Query Frame = 3
Query:  972 FQSAYLRMMQFLHSPNSFGIIKEELSDRGIEVVSLYXXXXXXXXXXALESLENPPSSLVSVINNRWLSEGFKKTTLNSSIWTILLAKRKFLKYKSGFKAHFYDIMDAIGAPLAWSFLGSEIKANQIANQFKDSLNVLIRYLYS-DSPRLTSRQDLAEDI 1445
            FQ  +  M+ FL   + +   + EL+ RG++ ++ YD++ DFIL+D+ E LENPP+S+ SV+NNRWL+  FK++ + SS W++L  KR+ +K   GF AHFY I + +   LAW FLG       +   FK+ +   ++ ++  +  R +S   LAED+
Sbjct:  334 FQDVFDEMINFLEQTDHWDSTELELAARGVKNLNFYDVVLDFILMDSFEDLENPPTSIQSVVNNRWLNSSFKESAVASSCWSVLKQKRQQMKISDGFFAHFYAICEHVSPVLAWGFLGPRNSLYDLCCFFKNQVLFFLKDIFDFEKVRYSSIDTLAEDL 492          
BLAST of Mitoguardin 2 vs. UniProt/SwissProt
Match: sp|Q9W3F7|MIGA_DROME (Mitoguardin OS=Drosophila melanogaster OX=7227 GN=Miga PE=1 SV=2)

HSP 1 Score: 161.384 bits (407), Expect = 3.437e-42
Identity = 92/277 (33.21%), Postives = 161/277 (58.12%), Query Frame = 3
Query:  654 DSFVSAKEYYQDDSVIDEYLEITTKENKHLFKEALLELESGSIYYRTKRTELVNCQNDTEYLAKLYCLRSGFEVISEIESMSKELEDIGLDIGCGILTALGYEIDSFQSAYLRMMQFLHSPNSFGIIKEELSDRGIEVVSLYXXXXXXXXXXALESLENPPSSLVSVINNRWLSEGFKKTTLNSSIWTILLAKRKFLKYKSGFKAHFYDIMDAIGAPLAWSFLGSEIKANQIANQFKDSLNVLIRYLYS-DSPRLTSRQDLAEDIMLKIHSLKNSLN 1481
            +SF SA +   D    D ++E T+ E   LF+ AL   +  ++  RT R EL++C  DTEYLAKL+C+R  F+ + +  ++ + + D G  I   +L     +   F   Y  M+ +LH  N++  I+ EL  R ++ ++ YDI  DFI+LD+ + L+ PP+S+ +V+ NRWLS GFK+T L +++W++L AK++ LK+ +GF +HFY I + I   +AW F G       I + F++ L   +  ++S    R T+ ++ ++D++  + +  N++ 
Sbjct:  245 ESFASALDQVADLREFDGFIE-TSYEEYPLFQSALKHHDEYTVPCRTIRAELMHCSTDTEYLAKLHCVRLAFQFLFKDPAVGQWICDAGRQILTDLLCLGDKDTKEFLVGYEDMVNYLHDSNNWPCIQMELEQRNVKAMTFYDICLDFIILDSFKDLDAPPASVTAVVQNRWLSNGFKETALTTAVWSVLKAKKRMLKFPNGFMSHFYVISEQISPLMAWGFFGPNENLRDICHYFREELLAFLGDIFSFQKSRFTTIEEFSQDVLQHMQTRVNNIG 520          
BLAST of Mitoguardin 2 vs. UniProt/SwissProt
Match: sp|Q8BK03|MIGA2_MOUSE (Mitoguardin 2 OS=Mus musculus OX=10090 GN=Miga2 PE=1 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 1.409e-41
Identity = 97/266 (36.47%), Postives = 155/266 (58.27%), Query Frame = 3
Query:  654 DSFVSAKEYYQDDSVIDEYLEITTKENKHLFKEALLELESGSIYYRTKRTELVNCQNDTEYLAKLYCLRSGFEVISEIESMSKELEDIGLDIGCGILTALGYEIDSFQSAYLRMMQFLHSPNSFGIIKEELSDRGIEVVSLYXXXXXXXXXXALESLENPPSSLVSVINNRWLSEGFKKTTLNSSIWTILLAKRKFLKYKSGFKAHFYDIMDAIGAPLAWSFLGSEIKANQIANQFKDSLNVLIRYLYS-DSPRLTSRQDLAEDIM 1448
            DSF SA E ++    I EY  +        ++EAL  ++ G +  RT RTEL+ C +D ++LAKL+C+R  FE + E  S      ++G  +  G++T        F  +Y  M+ +   P ++   + EL  RG+  +S +DI+ DFIL+DA E LENPPSS+++V+ NRWLS+ FK+T L ++ W++L AKR+ L    GF +HFY + + +   LA+ FLG + + +++   FK  +   +R ++  D+ R TS   LAEDI+
Sbjct:  291 DSFFSATEIFESLQ-IGEY-PLPLSRPAAAYEEALQLVKEGRVPCRTLRTELLGCYSDQDFLAKLHCVRQAFEGLLEERSNQIFFGEVGRQMVTGLMTKAEKSPKGFLESYEEMLSYALRPETWATTRLELEGRGVACMSFFDIVLDFILMDAFEDLENPPSSVLAVLRNRWLSDSFKETALATACWSVLKAKRRLLMVPDGFISHFYSVSEHVSPVLAFGFLGPKPQLSEVCAFFKHQIVQYLRDMFDLDNVRYTSVPALAEDIL 554          
BLAST of Mitoguardin 2 vs. UniProt/SwissProt
Match: sp|Q1JPG0|MIGA2_BOVIN (Mitoguardin 2 OS=Bos taurus OX=9913 GN=MIGA2 PE=2 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 2.008e-41
Identity = 98/269 (36.43%), Postives = 156/269 (57.99%), Query Frame = 3
Query:  654 DSFVSAKEYYQDDSVIDEYLEITTKENKHLFKEALLELESGSIYYRTKRTELVNCQNDTEYLAKLYCLRSGFEVISEIESMSKELEDIGLDIGCGILTALGYEIDSFQSAYLRMMQFLHSPNSFGIIKEELSDRGIEVVSLYXXXXXXXXXXALESLENPPSSLVSVINNRWLSEGFKKTTLNSSIWTILLAKRKFLKYKSGFKAHFYDIMDAIGAPLAWSFLGSEIKANQIANQFKDSLNVLIRYLYS----DSPRLTSRQDLAEDIM 1448
            DSF SA E ++   V D    I        ++EAL  ++ G +  RT RTEL+ C +D ++LAKL+C+R  FE + E +S      ++G  +  G++T        F  +Y  M+ +   P ++   + EL  RG+  +S +DI+ DFIL+DA E LENPPSS+++V+ NRWLS+ FK+T L ++ W++L AKR+ L    GF +HFY + + +   LA+ FLG + + +++   FK   + +++YL      D+ R TS   LAEDI+
Sbjct:  291 DSFFSATELFESLQVGD--YPIPLSRPAAAYEEALQLVKEGKVPCRTLRTELLGCYSDQDFLAKLHCVRQAFEGLLEDKSHQLFFGEVGRQMVTGLMTKAEKSPKGFLESYEEMLSYALRPETWATTRLELEGRGVVCMSFFDIVLDFILMDAFEDLENPPSSVLAVLRNRWLSDSFKETALATACWSVLKAKRRLLMVPDGFISHFYSVSEHVSPVLAFGFLGPKPQLSEVCAFFK---HQIVQYLTDMFDLDNVRYTSVPALAEDIL 554          
BLAST of Mitoguardin 2 vs. UniProt/SwissProt
Match: sp|Q5BLE2|MIGA2_DANRE (Mitoguardin 2 OS=Danio rerio OX=7955 GN=miga2 PE=2 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 3.270e-41
Identity = 99/283 (34.98%), Postives = 162/283 (57.24%), Query Frame = 3
Query:  651 NDSFVSAKEYYQDDSVIDEYLEITTKENKHLFKEALLELESGSIYYRTKRTELVNCQNDTEYLAKLYCLRSGFEVISEIESMSKELEDIGLDIGCGILTALGYEIDSFQSAYLRMMQFLHSPNSFGIIKEELSDRGIEVVSLYXXXXXXXXXXALESLENPPSSLVSVINNRWLSEGFKKTTLNSSIWTILLAKRKFLKYKSGFKAHFYDIMDAIGAPLAWSFLGSEIKANQIANQFKDSLNVLIRYLYS-DSPRLTSRQDLAEDIMLKIHSLKNSLNNELAV 1496
            +DSF SA E ++  S+ D +  +   +   L++EAL  ++ G +  R+ RTEL+ C +D ++LAKL+C+R  F+V+   E+      + G  +  G+L        +F  +Y  M+Q+     ++ + K EL  RG+  ++ +DI+ DFIL+DA E LE+PPSS+V+V+ NRWLS+ FK+T L ++ W++L AKR+ L    GF AHFY I + +   LA+ FLG     +++   FK  +   ++ ++  D  R TS   LAEDI+   H   + L   L +
Sbjct:  288 DDSFFSAAELFETFSLEDSFHLL---KPAALYEEALSLVKDGDVACRSLRTELLECYSDQDFLAKLHCVRQAFQVLLLDETHRMFFMETGKQMISGLLVKANKSPKAFLESYEDMLQYTQREETWPVSKMELEGRGVVCMNFFDIVLDFILMDAFEDLESPPSSVVAVLRNRWLSDSFKETALATACWSVLKAKRRLLMVPDGFIAHFYVISEHVSPVLAFGFLGPHQHLSEVCTIFKQQIVQYLKDMFDHDKVRFTSVPSLAEDILRLSHRRADILMGYLGI 567          
BLAST of Mitoguardin 2 vs. UniProt/SwissProt
Match: sp|Q7L4E1|MIGA2_HUMAN (Mitoguardin 2 OS=Homo sapiens OX=9606 GN=MIGA2 PE=1 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 4.885e-40
Identity = 94/266 (35.34%), Postives = 152/266 (57.14%), Query Frame = 3
Query:  654 DSFVSAKEYYQDDSVIDEYLEITTKENKHLFKEALLELESGSIYYRTKRTELVNCQNDTEYLAKLYCLRSGFEVISEIESMSKELEDIGLDIGCGILTALGYEIDSFQSAYLRMMQFLHSPNSFGIIKEELSDRGIEVVSLYXXXXXXXXXXALESLENPPSSLVSVINNRWLSEGFKKTTLNSSIWTILLAKRKFLKYKSGFKAHFYDIMDAIGAPLAWSFLGSEIKANQIANQFKDSLNVLIRYLYS-DSPRLTSRQDLAEDIM 1448
            DSF SA E ++     D    I        ++EAL  ++ G +  RT RTEL+ C +D ++LAKL+C+R  FE + E +S       +G  +  G++T        F  +Y  M+ +   P ++   + EL  RG+  +S +DI+ DFIL+DA E LENPP+S+++V+ NRWLS+ FK+T L ++ W++L AKR+ L    GF +HFY + + +   LA+ FLG + +  ++   FK  +   +R ++  D+ R TS   LA+DI+
Sbjct:  291 DSFFSATELFESLQTGD--YPIPLSRPAAAYEEALQLVKEGRVPCRTLRTELLGCYSDQDFLAKLHCVRQAFEGLLEDKSNQLFFGKVGRQMVTGLMTKAEKSPKGFLESYEEMLSYALRPETWATTRLELEGRGVVCMSFFDIVLDFILMDAFEDLENPPASVLAVLRNRWLSDSFKETALATACWSVLKAKRRLLMVPDGFISHFYSVSEHVSPVLAFGFLGPKPQLAEVCAFFKHQIVQYLRDMFDLDNVRYTSLPALADDIL 554          
BLAST of Mitoguardin 2 vs. TrEMBL
Match: A0A504YS68 (Protein FAM73A OS=Fasciola gigantica OX=46835 GN=FGIG_06130 PE=4 SV=1)

HSP 1 Score: 233.802 bits (595), Expect = 9.252e-66
Identity = 139/340 (40.88%), Postives = 215/340 (63.24%), Query Frame = 3
Query:  405 LNYGRLCLKSLDDVIGNLQSSIFKLNKYEAEHVLNETQSDSHLLFNDMKHLLEEAFRIREKFKQKLIIX-----XXXXXXXXXXXXXNDSFVSAKEYYQDDSVID-EYLEITTKEN--KHLFKEALLELESGSIYYRTKRTELVNCQNDTEYLAKLYCLRSGFEVISEIESMSKELEDIGLDIGCGILTALGYEIDSFQSAYLRMMQFLHS----PNSFGIIKEELSDRGIEVVSLYXXXXXXXXXXALESLENPPSSLVSVINNRWLSEGFKKTTLNSSIWTILLAKRKFLKYKSGFKAHFYDIMDAIGAPLAWSFLGSEIKANQIANQFKDSLNVLIR 1388
            +++GRL L++L  V+ +L++ + K+ +Y+ + V  +T SDS  L N+++ LLE+A+++RE++K+KL++        S            S+ SA E+      ID   LE+   EN  + ++ EAL  L++G I YR+ RT+LV CQ D EYLAKL+CLR   + I E    ++ LE +G   GC +L  LGY    F  AY R+M F+H     PN+  +I EELS +GI+V++ YD++ D++LLD+LE L +PPSS+++V  +RWLS+ FK+  L+S+IWTILLAKRK LKY  GF AH+Y ++      LAW FLG +  A +  N+F++++N  +R
Sbjct:  112 IDWGRLGLRTLAGVVDHLEALMAKIRRYD-DRVQVDTSSDSGQLINELRLLLEQAYQLREQYKRKLVLLDHDYLPESIETEVVSDEETCSYFSALEH------IDLTELELLMAENYNRPIYLEALKLLDTGEIPYRSLRTQLVGCQRDIEYLAKLHCLRQALDFIFEQPEPTEWLEAVGRLSGCRLLHCLGYSTTEFDEAYGRLMSFVHMQRKLPNN--LITEELSAKGIKVINFYDVVVDYMLLDSLELLSDPPSSVLAVTRHRWLSDNFKRVALDSTIWTILLAKRKLLKYADGFCAHYYTLVGTFSPALAWGFLGPDENAQRACNRFRETINAFLR 442          
BLAST of Mitoguardin 2 vs. TrEMBL
Match: A0A267FWQ7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026380g5 PE=4 SV=1)

HSP 1 Score: 218.779 bits (556), Expect = 3.684e-61
Identity = 133/365 (36.44%), Postives = 212/365 (58.08%), Query Frame = 3
Query:  426 LKSLDDVIGNLQSSIFKLNKYEAEHVLNETQSDSHLLFNDMKHLLEEAFRIREKFKQKLIIXXXXXXXXXXXXXXN-----DSFVSAKEYYQDDSVIDEYLEITTKENKHLFKEALLELESGSIYYRTKRTELVNCQNDTEYLAKLYCLRSGFEVISEIESMSKELEDIGLDIGCGILTALGYEIDSFQSAYLRMMQFLHSPNSFGIIKEELSDRGIEVVSLYXXXXXXXXXXALESLENPPSSLVSVINNRWLSEGFKKTTLNSSIWTILLAKRKFLKYKSGFKAHFYDIMDAIGAPLAWSFLGSEIKANQIANQFKDSLNVLIRYLYSDSP-RLTSRQDLAEDIMLKIHSLKNSLNNELAVID 1502
            +++L  VI +L++S+   +      V     S+S LL  +++ LLE A+ IRE+ KQ+ +    +Y+ S   +  +     DSFVSA E      + D+  + +  +N HL++ ALLELE GS+ +R  RT  + C  DTEYLA+L+C+R   + +    + +      G ++G  +L  LG ++  F++AY  ++QFL SP++   I+ +L  RG+ V  LYDI FD++LLDA E L +PP S+VSV+ NRWLS GFK+T L+S++WT++LAKRK L    GF  HFY ++ ++G  LAW FLG + +AN+I    + +       L+S    R T+ ++LA D++         + + LA  D
Sbjct:  139 IEALHRVITDLETSLESFDGLG--DVRGGAASESELL-TELRQLLETAYSIRERAKQRALDVDEAYLPSTDVSDEDGDSDADSFVSALEQLDISDLDDQKRQAS--DNAHLYRAALLELEHGSVPFRKLRTANLGCSTDTEYLARLHCIRLAMDQLMADRASANWFRVTGRELGALLLDRLGCDVQPFEAAYRDLLQFLDSPDAPDAIRRDLEPRGVRVFGLYDIAFDYMLLDAFEELASPPPSIVSVLQNRWLSAGFKRTALDSTVWTLVLAKRKMLGGARGFSYHFYGLVASLGPALAWGFLGPDQRANRICEALRSTATQFAEDLFSPKQVRFTTVEELAADVLTCAQRSVRLMRDRLAACD 498          
BLAST of Mitoguardin 2 vs. TrEMBL
Match: A0A267DZR1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026380g2 PE=4 SV=1)

HSP 1 Score: 218.394 bits (555), Expect = 4.494e-61
Identity = 133/365 (36.44%), Postives = 212/365 (58.08%), Query Frame = 3
Query:  426 LKSLDDVIGNLQSSIFKLNKYEAEHVLNETQSDSHLLFNDMKHLLEEAFRIREKFKQKLIIXXXXXXXXXXXXXXN-----DSFVSAKEYYQDDSVIDEYLEITTKENKHLFKEALLELESGSIYYRTKRTELVNCQNDTEYLAKLYCLRSGFEVISEIESMSKELEDIGLDIGCGILTALGYEIDSFQSAYLRMMQFLHSPNSFGIIKEELSDRGIEVVSLYXXXXXXXXXXALESLENPPSSLVSVINNRWLSEGFKKTTLNSSIWTILLAKRKFLKYKSGFKAHFYDIMDAIGAPLAWSFLGSEIKANQIANQFKDSLNVLIRYLYSDSP-RLTSRQDLAEDIMLKIHSLKNSLNNELAVID 1502
            +++L  VI +L++S+   +      V     S+S LL  +++ LLE A+ IRE+ KQ+ +    +Y+ S   +  +     DSFVSA E      + D+  + +  +N HL++ ALLELE GS+ +R  RT  + C  DTEYLA+L+C+R   + +    + +      G ++G  +L  LG ++  F++AY  ++QFL SP++   I+ +L  RG+ V  LYDI FD++LLDA E L +PP S+VSV+ NRWLS GFK+T L+S++WT++LAKRK L    GF  HFY ++ ++G  LAW FLG + +AN+I    + +       L+S    R T+ ++LA D++         + + LA  D
Sbjct:  139 IEALHRVITDLETSLESFDGLG--DVRGGAASESELL-TELRQLLETAYSIRERAKQRALDVDEAYLPSTDVSDEDGDSDADSFVSALEQLDISDLDDQKRQAS--DNAHLYRAALLELEHGSVPFRKLRTANLGCSTDTEYLARLHCIRLAMDQLMADRASANWFRVTGRELGALLLDRLGCDVQPFEAAYRDLLQFLDSPDAPDAIRRDLEPRGVRVFGLYDIAFDYMLLDAFEELASPPPSIVSVLQNRWLSAGFKRTALDSTVWTLVLAKRKMLGGARGFSYHFYGLVASLGPALAWGFLGPDQRANRICEALRSTATQFAEDLFSPKQVRFTTVEELAADVLTCAQRSVRLMRDRLAACD 498          
BLAST of Mitoguardin 2 vs. TrEMBL
Match: A0A267EQX3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029709g2 PE=4 SV=1)

HSP 1 Score: 213.001 bits (541), Expect = 5.538e-59
Identity = 133/365 (36.44%), Postives = 212/365 (58.08%), Query Frame = 3
Query:  426 LKSLDDVIGNLQSSIFKLNKYEAEHVLNETQSDSHLLFNDMKHLLEEAFRIREKFKQKLIIXXXXXXXXXXXXXXN-----DSFVSAKEYYQDDSVIDEYLEITTKENKHLFKEALLELESGSIYYRTKRTELVNCQNDTEYLAKLYCLRSGFEVISEIESMSKELEDIGLDIGCGILTALGYEIDSFQSAYLRMMQFLHSPNSFGIIKEELSDRGIEVVSLYXXXXXXXXXXALESLENPPSSLVSVINNRWLSEGFKKTTLNSSIWTILLAKRKFLKYKSGFKAHFYDIMDAIGAPLAWSFLGSEIKANQIANQFKDSLNVLIRYLYSDSP-RLTSRQDLAEDIMLKIHSLKNSLNNELAVID 1502
            +++L  VI +L++S+   +      V     S+S LL  +++ LLE A+ IRE+ KQ+ +    +Y+ S   +  +     DSFVSA E      + D+  + +  +N HL++ ALLELE GS+ +R  RT  + C  DTEYLA+L+C+R   + +    + +      G ++G  +L  LG ++  F++AY  ++QFL SP++   I+ +L  RG+ V  LYDI FD++LLDA E L +PP S+VSV+ NRWLS GFK+T L+S++WT++LAKRK L    GF  HFY ++ ++G  LAW FLG + +AN+I    + +       L+S    R T+ ++LA D++         + + LA  D
Sbjct:  139 IEALHRVITDLETSLESFDGLG--DVRGGAASESELL-TELRQLLETAYSIRERAKQRALDVDEAYLPSTDVSDEDGDSDADSFVSALEQLDISDLDDQKRQAS--DNAHLYRAALLELEHGSVPFRKLRTVNLGCSTDTEYLARLHCIRLAMDQLMADRASANWFRVTGRELGALLLDRLGCDVQPFEAAYRDLLQFLDSPDAPDAIRRDLEPRGVRVFGLYDIAFDYMLLDAFEELASPPPSIVSVLQNRWLSAGFKRTALDSTVWTLVLAKRKMLGGARGFY-HFYGLVASLGPALAWGFLGPDQRANRICEALRSTATQFAEDLFSPKQVRFTTVEELAADVLTCAQRSVRLMCDRLAACD 497          
BLAST of Mitoguardin 2 vs. TrEMBL
Match: A0A075AJS6 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_12516 PE=4 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 2.034e-54
Identity = 125/348 (35.92%), Postives = 206/348 (59.20%), Query Frame = 3
Query:  405 LNYGRLCLKSLDDVIGNLQSSIFKLNKYEAEHVLNETQSDSHLLFNDMKHLLEEAFRIREKFKQKLIIXXXXXXXXXXXXXXNDSFVSAKEYYQDDSVIDEY----------LEITTKEN--KHLFKEALLELESGSIYYRTKRTELVNCQNDTEYLAKLYCLRSGFEVISEIESMSKELEDIGLDIGCGILTALGYEIDSFQSAYLRMMQFLHSPNS--FGIIKEELSDRGIEVVSLYXXXXXXXXXXALESLENPPSSLVSVINNRWLSEGFKKTTLNSSIWTILLAKRKFLKYKSGFKAHFYDIMDAIGAPLAWSFLGSEIKANQIANQFKDSLNVLIRYLYSDS 1406
            L++GRL L++L  V+ +L++ + ++  YE E    +   +S  L ++++ LLE+A+++RE++++KLI+    Y              +  E+  DD     +          LEI    N  + ++++AL  L+   I YR+ RT+LV C+ D EYLAKL+CLR  F+ I +    +  L  +G   G  +L  LGY    F+ AY R++ F+++        + EEL  +G++VV+ YD++ D +LL+ALE L +PP+S++SV  +RWLS+ FKK  L+S+IWTILLAKRK LKY  GF AH+Y ++  I   LAW FLG +  A ++ N+F+D++N  ++  ++ S
Sbjct:  117 LDWGRLGLRALAAVVEHLETLMSRIRVYE-ERGQMQMSDNSGQLISELRLLLEQAYQLREQYRRKLILQDQDYTTE----------AADSEFSTDDDTCSYFSALEQIDLSELEIEISRNLLRPIYRDALELLDKSEIPYRSLRTQLVGCERDFEYLAKLHCLRQAFDYIFQQPEPTDWLCSVGKLTGLRLLHCLGYPTSDFEEAYERLVSFVNTQRRELKPTMSEELFAKGVKVVNFYDVVIDLMLLEALELLADPPASVLSVTRHRWLSDNFKKVALDSTIWTILLAKRKLLKYTDGFYAHYYTLVGTITPALAWGFLGPDEGALRLCNRFRDAINAFLQEAFTCS 453          
BLAST of Mitoguardin 2 vs. Ensembl Cavefish
Match: miga2 (mitoguardin 2 [Source:NCBI gene;Acc:103027239])

HSP 1 Score: 155.221 bits (391), Expect = 1.491e-40
Identity = 95/267 (35.58%), Postives = 155/267 (58.05%), Query Frame = 3
Query:  651 NDSFVSAKEYYQDDSVIDEYLEITTKENKHLFKEALLELESGSIYYRTKRTELVNCQNDTEYLAKLYCLRSGFEVISEIESMSKELEDIGLDIGCGILTALGYEIDSFQSAYLRMMQFLHSPNSFGIIKEELSDRGIEVVSLYXXXXXXXXXXALESLENPPSSLVSVINNRWLSEGFKKTTLNSSIWTILLAKRKFLKYKSGFKAHFYDIMDAIGAPLAWSFLGSEIKANQIANQFKDSLNVLIRYLYS-DSPRLTSRQDLAEDIM 1448
            +DSF SA E + D   +DE  +  T +   L++EAL  ++ G +  R+ RTEL+ C +D ++LAKL+C+R  F V+   ++      + G  +  G++        +F  +Y  M+ +     ++   K EL  RG+  ++ +DI+ DFIL+DA E LENPP+S+V+V+ NRWLS+ FK+T L ++ W++L AKR+ L    GF +HFY I + +   LA+ FLG     +++   FK  +   ++ ++  D  R TS Q LAEDI+
Sbjct:  287 DDSFFSAAELF-DALSLDEVYQ--TLKPAALYEEALNLVKEGKVNCRSFRTELLECYSDQDFLAKLHCVRQAFHVLLLDDTHRNFFMETGKQMITGLMIKANKSPKAFLESYQEMLLYSQREETWPTTKMELDGRGVVCMNFFDIVLDFILMDAFEDLENPPTSVVAVLRNRWLSDSFKETALATACWSVLKAKRRLLMVPDGFISHFYAISEHVSPVLAFGFLGPRQHLSEVCTIFKQQIVQYLKDMFDHDKVRFTSAQSLAEDIL 550          
BLAST of Mitoguardin 2 vs. Ensembl Cavefish
Match: miga1 (mitoguardin 1 [Source:NCBI gene;Acc:103029709])

HSP 1 Score: 153.68 bits (387), Expect = 5.564e-40
Identity = 101/287 (35.19%), Postives = 160/287 (55.75%), Query Frame = 3
Query:  651 NDSFVSAKEYYQDDSVIDEYLEITTKENKHLFKEALLELESGSIYYRTKRTELVNCQNDTEYLAKLYCLRSGFEVISEIESMSKELEDIGLDIGCGILTALGYEIDSFQSAYLRMMQFLHSPNSFGIIKEELSDRGIEVVSLYXXXXXXXXXXALESLENPPSSLVSVINNRWLSEGFKKTTLNSSIWTILLAKRKFLKYKSGFKAHFYDIMDAIGAPLAWSFLGSEIKANQIANQFKDSLNVLIRYLYS-DSPRLTSRQDLAEDIMLKIHSLKNSLNNELAVIDAD 1508
             DSFVSA E  +   + + +  + +  +   ++EAL   E G I  R  RTE++ C  DT++LAKL+C+R   +VI    +    L D G  I   I+         F+  +  M+ FL   + +   + EL+ RG++ ++ YDI+ DFIL+D+ E LENPP S+ +V+NNRWL+  FK+T + SS W++L  KR+ +K + GF AHFY + + I   LAW FLG +   +     FKD +   ++ ++  ++ R +S + LAEDI+  +H     L   LA + AD
Sbjct:  285 TDSFVSAAELSEHRDMRNAF-GLGSLCHYPFYEEALQMAEDGKISCRVLRTEMLECLGDTDFLAKLHCIRQACQVILCERATRMFLADTGKKILSSIIVKARKSPKRFEEVFEDMICFLEQTDHWENTEAELATRGVKHLNFYDIVLDFILMDSFEDLENPPISIQNVVNNRWLNASFKETAVASSCWSVLKQKRQHMKVQDGFIAHFYTVCEHISPVLAWGFLGPKSPLHDFCCFFKDQVLFFLKDIFDLENVRYSSVETLAEDILHLLHRRSELL---LAYLGAD 567          
BLAST of Mitoguardin 2 vs. Ensembl Nematostella
Match: EDO43395 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYW4])

HSP 1 Score: 86.6557 bits (213), Expect = 7.820e-20
Identity = 53/149 (35.57%), Postives = 86/149 (57.72%), Query Frame = 3
Query:  972 FQSAYLRMMQFLHSPNSFGIIKEELSDRG------IEVVSLYXXXXXXXXXXALESLENPPSSLVSVINNRWLSEGFKKTTLNSSIWTILLAKRKFLKYKSGFKAHFYDIMDAIGAPLAWSFLGSEIKANQIANQFKDSLNVLIRYLYS 1400
            F +A+  ++++  +P +   I+EEL  RG      + ++S YD++ D++LLDA + L  PP S+ + I NR LS   K+T L ++IW +L AK  +LK + G+ AHFY +   I   LAW FLG + +   +   FK  +   IR ++S
Sbjct:    6 FIAAFDELLEYCAAPENLSQIEEELQTRGSCACCRVPMLSFYDVILDYVLLDAFDDLATPPYSVATAIQNRRLSASIKETALTTAIWGVLKAKASYLKDQFGYMAHFYVVSQYILPVLAWGFLGPDNELRGLCEYFKGQMLGYIRDVFS 154          
BLAST of Mitoguardin 2 vs. Ensembl Medaka
Match: miga2 (mitoguardin 2 [Source:NCBI gene;Acc:101158215])

HSP 1 Score: 159.073 bits (401), Expect = 5.971e-42
Identity = 95/267 (35.58%), Postives = 154/267 (57.68%), Query Frame = 3
Query:  651 NDSFVSAKEYYQDDSVIDEYLEITTKENKHLFKEALLELESGSIYYRTKRTELVNCQNDTEYLAKLYCLRSGFEVISEIESMSKELEDIGLDIGCGILTALGYEIDSFQSAYLRMMQFLHSPNSFGIIKEELSDRGIEVVSLYXXXXXXXXXXALESLENPPSSLVSVINNRWLSEGFKKTTLNSSIWTILLAKRKFLKYKSGFKAHFYDIMDAIGAPLAWSFLGSEIKANQIANQFKDSLNVLIRYLYS-DSPRLTSRQDLAEDIM 1448
            +DSF SA E +   ++ + Y  I       L++EAL  +  G + +R+ RTEL+ C  D ++LAKL+C+R  F+V+   ES      ++G  +  G++        +F  +Y  M+ +     ++ + K EL  RG+  ++ +DI+ DFIL+DA E LE+PPSS+V+V+ NRWLS+ FK+T L ++ W++L AKR+ L    GF +HFY I + +   LA+ FLG     + +   FK  +   ++ ++  D  R TS Q LAEDI+
Sbjct:  291 DDSFFSAAEIFDKMTLEELYQPIRPAA---LYEEALTLVREGKVPFRSMRTELLECYGDQDFLAKLHCVRQAFQVLLLDESHRTFFMELGKQMIVGLMVKANKSPKAFLESYEDMLLYTQREETWPVTKMELDGRGVVCMNFFDIVLDFILMDAFEDLESPPSSVVAVLRNRWLSDSFKETALATACWSVLKAKRRLLMVPDGFISHFYAISEHVSPVLAFGFLGPRQHLSDVCMIFKQQIVQYLKDMFDHDKVRFTSVQCLAEDIL 554          
BLAST of Mitoguardin 2 vs. Ensembl Medaka
Match: miga2 (mitoguardin 2 [Source:NCBI gene;Acc:101158215])

HSP 1 Score: 154.066 bits (388), Expect = 2.751e-40
Identity = 95/268 (35.45%), Postives = 151/268 (56.34%), Query Frame = 3
Query:  651 NDSFVSA-KEYYQDDSVIDEYLEITTKENKHLFKEALLELESGSIYYRTKRTELVNCQNDTEYLAKLYCLRSGFEVISEIESMSKELEDIGLDIGCGILTALGYEIDSFQSAYLRMMQFLHSPNSFGIIKEELSDRGIEVVSLYXXXXXXXXXXALESLENPPSSLVSVINNRWLSEGFKKTTLNSSIWTILLAKRKFLKYKSGFKAHFYDIMDAIGAPLAWSFLGSEIKANQIANQFKDSLNVLIRYLYS-DSPRLTSRQDLAEDIM 1448
            +DSF SA +E YQ                  L++EAL  +  G + +R+ RTEL+ C  D ++LAKL+C+R  F+V+   ES      ++G  +  G++        +F  +Y  M+ +     ++ + K EL  RG+  ++ +DI+ DFIL+DA E LE+PPSS+V+V+ NRWLS+ FK+T L ++ W++L AKR+ L    GF +HFY I + +   LA+ FLG     + +   FK  +   ++ ++  D  R TS Q LAEDI+
Sbjct:  261 DDSFFSAAEELYQ------------PIRPAALYEEALTLVREGKVPFRSMRTELLECYGDQDFLAKLHCVRQAFQVLLLDESHRTFFMELGKQMIVGLMVKANKSPKAFLESYEDMLLYTQREETWPVTKMELDGRGVVCMNFFDIVLDFILMDAFEDLESPPSSVVAVLRNRWLSDSFKETALATACWSVLKAKRRLLMVPDGFISHFYAISEHVSPVLAFGFLGPRQHLSDVCMIFKQQIVQYLKDMFDHDKVRFTSVQCLAEDIL 516          
BLAST of Mitoguardin 2 vs. Ensembl Medaka
Match: miga2 (mitoguardin 2 [Source:NCBI gene;Acc:101158215])

HSP 1 Score: 147.902 bits (372), Expect = 3.049e-38
Identity = 86/240 (35.83%), Postives = 139/240 (57.92%), Query Frame = 3
Query:  651 NDSFVSAKEYYQDDSVIDEYLEITTKENKHLFKEALLELESGSIYYRTKRTELVNCQNDTEYLAKLYCLRSGFEVISEIESMSKELEDIGLDIGCGILTALGYEIDSFQSAYLRMMQFLHSPNSFGIIKEELSDRGIEVVSLYXXXXXXXXXXALESLENPPSSLVSVINNRWLSEGFKKTTLNSSIWTILLAKRKFLKYKSGFKAHFYDIMDAIGAPLAWSFLGSEIKANQIANQFKDS 1370
            +DSF SA E +   ++ + Y  I       L++EAL  +  G + +R+ RTEL+ C  D ++LAKL+C+R  F+V+   ES      ++G  +  G++        +F  +Y  M+ +     ++ + K EL  RG+  ++ +DI+ DFIL+DA E LE+PPSS+V+V+ NRWLS+ FK+T L ++ W++L AKR+ L    GF +HFY I + +   LA+ FLG     + +   FK S
Sbjct:  291 DDSFFSAAEIFDKMTLEELYQPI---RPAALYEEALTLVREGKVPFRSMRTELLECYGDQDFLAKLHCVRQAFQVLLLDESHRTFFMELGKQMIVGLMVKANKSPKAFLESYEDMLLYTQREETWPVTKMELDGRGVVCMNFFDIVLDFILMDAFEDLESPPSSVVAVLRNRWLSDSFKETALATACWSVLKAKRRLLMVPDGFISHFYAISEHVSPVLAFGFLGPRQHLSDVCMIFKVS 527          
BLAST of Mitoguardin 2 vs. Ensembl Medaka
Match: miga2 (mitoguardin 2 [Source:NCBI gene;Acc:101158215])

HSP 1 Score: 147.902 bits (372), Expect = 3.049e-38
Identity = 86/240 (35.83%), Postives = 139/240 (57.92%), Query Frame = 3
Query:  651 NDSFVSAKEYYQDDSVIDEYLEITTKENKHLFKEALLELESGSIYYRTKRTELVNCQNDTEYLAKLYCLRSGFEVISEIESMSKELEDIGLDIGCGILTALGYEIDSFQSAYLRMMQFLHSPNSFGIIKEELSDRGIEVVSLYXXXXXXXXXXALESLENPPSSLVSVINNRWLSEGFKKTTLNSSIWTILLAKRKFLKYKSGFKAHFYDIMDAIGAPLAWSFLGSEIKANQIANQFKDS 1370
            +DSF SA E +   ++ + Y  I       L++EAL  +  G + +R+ RTEL+ C  D ++LAKL+C+R  F+V+   ES      ++G  +  G++        +F  +Y  M+ +     ++ + K EL  RG+  ++ +DI+ DFIL+DA E LE+PPSS+V+V+ NRWLS+ FK+T L ++ W++L AKR+ L    GF +HFY I + +   LA+ FLG     + +   FK S
Sbjct:  291 DDSFFSAAEIFDKMTLEELYQPI---RPAALYEEALTLVREGKVPFRSMRTELLECYGDQDFLAKLHCVRQAFQVLLLDESHRTFFMELGKQMIVGLMVKANKSPKAFLESYEDMLLYTQREETWPVTKMELDGRGVVCMNFFDIVLDFILMDAFEDLESPPSSVVAVLRNRWLSDSFKETALATACWSVLKAKRRLLMVPDGFISHFYAISEHVSPVLAFGFLGPRQHLSDVCMIFKVS 527          
BLAST of Mitoguardin 2 vs. Ensembl Medaka
Match: miga1 (mitoguardin 1 [Source:NCBI gene;Acc:101172683])

HSP 1 Score: 145.206 bits (365), Expect = 3.158e-37
Identity = 93/271 (34.32%), Postives = 146/271 (53.87%), Query Frame = 3
Query:  651 NDSFVSAKEYYQDDSVIDEYLEITTKENKHLFKEALLELESGSIYYRTKRTELVNCQNDTEYLAKLYCLRSGFEVISEIESMSKELEDIGLDIGCGILTALGYEIDSFQSAYLRMMQFLHSPNSFGIIKEELSDRGIEVVSLYXXXXXXXXXXALESLENPPSSLVSVINNRWLSEGFKKTTLNSSIWTILLAKRKFLKYKSGFKAHFYDIMDAIGAPLAWSFLGSEIKANQIANQFKDSLNVLIRYLYS-DSPRLTSRQDLAEDIMLKIH 1460
             DSFVSA E  +   +   + +        L++EAL   E G I  R  RTE++ C  D ++LAKL+C+R   E+I    +    L + G  I   I+         F+  +  M+ FL     +   + EL+ RG++ ++ YD++ DFIL+D+ E LENPP S+ +VINNRWL+  FK+T + SS W++L  KRK +K   GF A FY + + I   LAW FLG E     +   FK+ +   ++ ++  D  R ++ + +AED +  +H
Sbjct:  261 TDSFVSAAEAGEQRDLRGVFAQ------HPLYEEALQMAEEGQISCRVLRTEVLGCHGDLDFLAKLHCVRQACELILCDRTTRMFLANTGKKILSSIIVQAQKSPKRFEDVFEEMISFLEEAKHWEDTEVELAARGVKHLNFYDVVLDFILMDSFEDLENPPFSIQNVINNRWLNSSFKETAVASSCWSVLKQKRKHMKVPDGFIARFYAVCEQISPVLAWGFLGPESSLQDLCRFFKEQVLHFLKDVFDLDKVRYSTVESMAEDTLHLLH 525          
BLAST of Mitoguardin 2 vs. Planmine SMEST
Match: SMESG000007053.1 (SMESG000007053.1)

HSP 1 Score: 858.596 bits (2217), Expect = 0.000e+0
Identity = 470/473 (99.37%), Postives = 472/473 (99.79%), Query Frame = 3
Query:  102 MPISNIQIKAVFVXXXXXXXXXXXXXXRRNRNKQLQISNQDEINKEYVPGLNSNFNHYTDSREKTFTSVAIGKSDKTASISSKNSTAKELEQHLYEDSTDELNYGRLCLKSLDDVIGNLQSSIFKLNKYEAEHVLNETQSDSHLLFNDMKHLLEEAFRIREKFKQKLIIXXXXXXXXXXXXXXNDSFVSAKEYYQDDSVIDEYLEITTKENKHLFKEALLELESGSIYYRTKRTELVNCQNDTEYLAKLYCLRSGFEVISEIESMSKELEDIGLDIGCGILTALGYEIDSFQSAYLRMMQFLHSPNSFGIIKEELSDRGIEVVSLYXXXXXXXXXXALESLENPPSSLVSVINNRWLSEGFKKTTLNSSIWTILLAKRKFLKYKSGFKAHFYDIMDAIGAPLAWSFLGSEIKANQIANQFKDSLNVLIRYLYSDSPRLTSRQDLAEDIMLKIHSLKNSLNNELAVIDADFSTM 1520
            MPISNIQIKAVFVGSIIGVSAIVIYIYRRNRNKQLQISNQDEINKEYVPGLNSNFNHYTDSREKTFTSVAIGKSDKTASISSKNSTAKELEQHLYEDSTDELNYGRLCLKSLDDVIGNLQSSIFKLNKYEAEHVLNETQSDSHLLFNDMKHLLEEAFRIREKFKQKLIITSSSYVGSDSDTSSNDSFVSAKEYYQDDSVIDEYLEITTKENKHLFKEALLELESGSIYYRTKRTELVNCQNDTEYLAKLYCLR+GFEVISEIESMSKELEDIGLDIGCGILTALGYEIDSFQSAYLRMMQFLHSPNSFGIIKEELSDRGIEVVSLYDILFDFILLDALESLENPPSSLVSVINNRWLSEGFKKTTLNSSIWTILLAKRKFLKYKSGFKAHFYDIMDAIGAPLAWSFLGSEIKANQIANQFKDSLNVLIRYLYSDSPRLTSRQDLAEDIMLKI SLK+SLNNELAVIDADFSTM
Sbjct:    1 MPISNIQIKAVFVGSIIGVSAIVIYIYRRNRNKQLQISNQDEINKEYVPGLNSNFNHYTDSREKTFTSVAIGKSDKTASISSKNSTAKELEQHLYEDSTDELNYGRLCLKSLDDVIGNLQSSIFKLNKYEAEHVLNETQSDSHLLFNDMKHLLEEAFRIREKFKQKLIITSSSYVGSDSDTSSNDSFVSAKEYYQDDSVIDEYLEITTKENKHLFKEALLELESGSIYYRTKRTELVNCQNDTEYLAKLYCLRTGFEVISEIESMSKELEDIGLDIGCGILTALGYEIDSFQSAYLRMMQFLHSPNSFGIIKEELSDRGIEVVSLYDILFDFILLDALESLENPPSSLVSVINNRWLSEGFKKTTLNSSIWTILLAKRKFLKYKSGFKAHFYDIMDAIGAPLAWSFLGSEIKANQIANQFKDSLNVLIRYLYSDSPRLTSRQDLAEDIMLKIRSLKDSLNNELAVIDADFSTM 473          
BLAST of Mitoguardin 2 vs. Planmine SMEST
Match: SMESG000007053.1 (SMESG000007053.1)

HSP 1 Score: 578.556 bits (1490), Expect = 0.000e+0
Identity = 320/323 (99.07%), Postives = 323/323 (100.00%), Query Frame = 3
Query:  102 MPISNIQIKAVFVXXXXXXXXXXXXXXRRNRNKQLQISNQDEINKEYVPGLNSNFNHYTDSREKTFTSVAIGKSDKTASISSKNSTAKELEQHLYEDSTDELNYGRLCLKSLDDVIGNLQSSIFKLNKYEAEHVLNETQSDSHLLFNDMKHLLEEAFRIREKFKQKLIIXXXXXXXXXXXXXXNDSFVSAKEYYQDDSVIDEYLEITTKENKHLFKEALLELESGSIYYRTKRTELVNCQNDTEYLAKLYCLRSGFEVISEIESMSKELEDIGLDIGCGILTALGYEIDSFQSAYLRMMQFLHSPNSFGIIKEELSDRGIEVV 1070
            MPISNIQIKAVFVGSIIGVSAIVIYIYRRNRNKQLQISNQDEINKEYVPGLNSNFNHYTDSREKTFTSVAIGKSDKTASISSKNSTAKELEQHLYEDSTDELNYGRLCLKSLDDVIGNLQSSIFKLNKYEAEHVLNETQSDSHLLFNDMKHLLEEAFRIREKFKQKLIITSSSYVGSDSDTSSNDSFVSAKEYYQDDSVIDEYLEITTKENKHLFKEALLELESGSIYYRTKRTELVNCQNDTEYLAKLYCLR+GFEVISEIESMSKELEDIGLDIGCGILTALGYEIDSFQSAYLRMMQFLHSPNSFGIIKEELSDRGIE++
Sbjct:    1 MPISNIQIKAVFVGSIIGVSAIVIYIYRRNRNKQLQISNQDEINKEYVPGLNSNFNHYTDSREKTFTSVAIGKSDKTASISSKNSTAKELEQHLYEDSTDELNYGRLCLKSLDDVIGNLQSSIFKLNKYEAEHVLNETQSDSHLLFNDMKHLLEEAFRIREKFKQKLIITSSSYVGSDSDTSSNDSFVSAKEYYQDDSVIDEYLEITTKENKHLFKEALLELESGSIYYRTKRTELVNCQNDTEYLAKLYCLRTGFEVISEIESMSKELEDIGLDIGCGILTALGYEIDSFQSAYLRMMQFLHSPNSFGIIKEELSDRGIEML 323          

HSP 2 Score: 62.7734 bits (151), Expect = 1.830e-10
Identity = 29/30 (96.67%), Postives = 29/30 (96.67%), Query Frame = 1
Query: 1108 MLWNHWRILRLLWFPLSIIAGSLKVLKKRL 1197
            MLWNHWRILRLLWFPLSIIAGSLKV KKRL
Sbjct:  322 MLWNHWRILRLLWFPLSIIAGSLKVSKKRL 351          
The following BLAST results are available for this feature:
BLAST of Mitoguardin 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MIGA21.017e-4035.34mitoguardin 2 [Source:HGNC Symbol;Acc:HGNC:23621][more]
MIGA13.065e-4035.21mitoguardin 1 [Source:HGNC Symbol;Acc:HGNC:24741][more]
MIGA15.850e-4035.21mitoguardin 1 [Source:HGNC Symbol;Acc:HGNC:24741][more]
MIGA17.968e-4035.21mitoguardin 1 [Source:HGNC Symbol;Acc:HGNC:24741][more]
MIGA17.968e-4035.21mitoguardin 1 [Source:HGNC Symbol;Acc:HGNC:24741][more]
back to top
BLAST of Mitoguardin 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
K01D12.63.334e-2426.80pep chromosome:WBcel235:V:12398759:12400859:-1 gen... [more]
back to top
BLAST of Mitoguardin 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Miga3.429e-4333.21gene:FBgn0030037 transcript:FBtr0071246[more]
Miga3.429e-4333.21gene:FBgn0030037 transcript:FBtr0300383[more]
Miga3.429e-4333.21gene:FBgn0030037 transcript:FBtr0345986[more]
back to top
BLAST of Mitoguardin 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
miga24.374e-4234.98mitoguardin 2 [Source:NCBI gene;Acc:541431][more]
miga16.111e-3931.99mitoguardin 1 [Source:NCBI gene;Acc:450070][more]
back to top
BLAST of Mitoguardin 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a304.775e-3934.57solute carrier family 25 member 30 [Source:Xenbase... [more]
slc25a307.360e-3934.57solute carrier family 25 member 30 [Source:Xenbase... [more]
miga12.123e-3733.58mitoguardin 1 [Source:NCBI gene;Acc:100145180][more]
slc25a304.820e-3634.31solute carrier family 25 member 30 [Source:Xenbase... [more]
slc25a307.404e-3634.31solute carrier family 25 member 30 [Source:Xenbase... [more]
back to top
BLAST of Mitoguardin 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Miga22.014e-4236.47mitoguardin 2 [Source:MGI Symbol;Acc:MGI:1922035][more]
Miga22.014e-4236.47mitoguardin 2 [Source:MGI Symbol;Acc:MGI:1922035][more]
Miga15.387e-3635.17mitoguardin 1 [Source:MGI Symbol;Acc:MGI:1924567][more]
Miga19.077e-2636.84mitoguardin 1 [Source:MGI Symbol;Acc:MGI:1924567][more]
Miga17.999e-2337.74mitoguardin 1 [Source:MGI Symbol;Acc:MGI:1924567][more]
back to top
BLAST of Mitoguardin 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9W3F7|MIGA_DROME3.437e-4233.21Mitoguardin OS=Drosophila melanogaster OX=7227 GN=... [more]
sp|Q8BK03|MIGA2_MOUSE1.409e-4136.47Mitoguardin 2 OS=Mus musculus OX=10090 GN=Miga2 PE... [more]
sp|Q1JPG0|MIGA2_BOVIN2.008e-4136.43Mitoguardin 2 OS=Bos taurus OX=9913 GN=MIGA2 PE=2 ... [more]
sp|Q5BLE2|MIGA2_DANRE3.270e-4134.98Mitoguardin 2 OS=Danio rerio OX=7955 GN=miga2 PE=2... [more]
sp|Q7L4E1|MIGA2_HUMAN4.885e-4035.34Mitoguardin 2 OS=Homo sapiens OX=9606 GN=MIGA2 PE=... [more]
back to top
BLAST of Mitoguardin 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504YS689.252e-6640.88Protein FAM73A OS=Fasciola gigantica OX=46835 GN=F... [more]
A0A267FWQ73.684e-6136.44Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DZR14.494e-6136.44Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267EQX35.538e-5936.44Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A075AJS62.034e-5435.92Uncharacterized protein OS=Opisthorchis viverrini ... [more]
back to top
BLAST of Mitoguardin 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
miga21.491e-4035.58mitoguardin 2 [Source:NCBI gene;Acc:103027239][more]
miga15.564e-4035.19mitoguardin 1 [Source:NCBI gene;Acc:103029709][more]
back to top
BLAST of Mitoguardin 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mitoguardin 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mitoguardin 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO433957.820e-2035.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Mitoguardin 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
miga25.971e-4235.58mitoguardin 2 [Source:NCBI gene;Acc:101158215][more]
miga22.751e-4035.45mitoguardin 2 [Source:NCBI gene;Acc:101158215][more]
miga23.049e-3835.83mitoguardin 2 [Source:NCBI gene;Acc:101158215][more]
miga23.049e-3835.83mitoguardin 2 [Source:NCBI gene;Acc:101158215][more]
miga13.158e-3734.32mitoguardin 1 [Source:NCBI gene;Acc:101172683][more]
back to top
BLAST of Mitoguardin 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000007053.10.000e+099.37SMESG000007053.1[more]
SMESG000007053.11.830e-1099.07SMESG000007053.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022242 ID=SMED30022242|Name=Mitoguardin 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1560bp
AATGAATATCATACATTAGATATTTATTTTTTCTCTAAACAATTTTCACA
TACTTTTTTTAAAAATATTTCGTCAAATAATTTAACAATTAATTATTTTC
AATGCCTATTTCAAACATTCAAATTAAAGCTGTGTTTGTTGGCAGTATTA
TCGGCGTTTCTGCTATTGTAATATATATTTACCGGAGGAATAGAAATAAA
CAATTACAGATTTCAAATCAAGATGAAATAAATAAAGAATACGTACCGGG
TCTTAACTCTAATTTTAATCATTATACAGACAGCAGGGAAAAAACATTCA
CCAGTGTTGCTATAGGAAAATCAGATAAAACTGCATCAATAAGTTCTAAA
AACTCAACTGCTAAAGAATTAGAACAGCACTTATATGAAGATTCCACAGA
CGAATTAAATTATGGTAGACTATGCCTTAAAAGTCTCGATGATGTTATTG
GAAATTTGCAATCTTCAATTTTTAAATTGAATAAGTACGAAGCAGAGCAT
GTATTAAATGAAACACAGTCAGATTCACATTTATTATTTAATGACATGAA
ACATTTGCTAGAAGAAGCATTTAGAATTCGTGAAAAGTTTAAACAGAAAT
TAATTATTACATCCAGTAGTTATGTTGGATCTGATTCTGATACAAGTTCC
AATGATTCTTTTGTATCGGCCAAAGAATACTATCAAGATGACAGTGTAAT
TGATGAATATTTAGAGATTACTACTAAAGAAAACAAGCACTTATTTAAAG
AGGCTTTATTAGAATTAGAGAGTGGCAGCATTTATTATCGCACAAAAAGA
ACGGAATTGGTCAATTGTCAAAATGATACCGAGTACTTAGCTAAATTATA
TTGCCTGCGTTCCGGATTCGAAGTGATTAGTGAAATAGAATCCATGAGTA
AAGAACTAGAAGACATAGGATTGGACATTGGTTGTGGAATATTGACTGCC
CTCGGTTATGAAATTGATTCTTTTCAGAGTGCATATCTAAGAATGATGCA
ATTTTTACATTCCCCGAATTCGTTTGGAATCATTAAAGAGGAACTTTCTG
ATCGAGGGATCGAAGTTGTTTCTCTTTACGACATTCTGTTCGACTTTATT
CTATTAGATGCTTTGGAATCATTGGAGAATCCTCCGTCTTCTTTGGTTTC
CGTTATCAATAATCGCTGGCTCTCTGAAGGTTTTAAAAAAACGACTTTGA
ATTCGAGCATTTGGACGATTCTGTTAGCCAAACGGAAATTTCTCAAATAC
AAAAGCGGATTTAAAGCTCATTTCTATGATATCATGGATGCTATTGGTGC
GCCGTTGGCATGGAGCTTTTTGGGATCGGAAATAAAAGCCAATCAAATTG
CAAATCAATTTAAAGATTCGCTTAATGTATTAATTAGGTACCTGTATTCT
GATTCTCCGAGATTGACATCTAGACAAGATCTTGCCGAGGATATCATGCT
AAAAATCCACTCATTGAAAAATAGTCTAAATAATGAACTAGCAGTAATTG
ATGCCGACTTCAGCACTATGTGAAATAGGTTTTTCATTTTGTGAAAAATA
AACGAATAAC
back to top

protein sequence of SMED30022242-orf-1

>SMED30022242-orf-1 ID=SMED30022242-orf-1|Name=SMED30022242-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=474bp
MPISNIQIKAVFVGSIIGVSAIVIYIYRRNRNKQLQISNQDEINKEYVPG
LNSNFNHYTDSREKTFTSVAIGKSDKTASISSKNSTAKELEQHLYEDSTD
ELNYGRLCLKSLDDVIGNLQSSIFKLNKYEAEHVLNETQSDSHLLFNDMK
HLLEEAFRIREKFKQKLIITSSSYVGSDSDTSSNDSFVSAKEYYQDDSVI
DEYLEITTKENKHLFKEALLELESGSIYYRTKRTELVNCQNDTEYLAKLY
CLRSGFEVISEIESMSKELEDIGLDIGCGILTALGYEIDSFQSAYLRMMQ
FLHSPNSFGIIKEELSDRGIEVVSLYDILFDFILLDALESLENPPSSLVS
VINNRWLSEGFKKTTLNSSIWTILLAKRKFLKYKSGFKAHFYDIMDAIGA
PLAWSFLGSEIKANQIANQFKDSLNVLIRYLYSDSPRLTSRQDLAEDIML
KIHSLKNSLNNELAVIDADFSTM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR019392Miga
Vocabulary: biological process
TermDefinition
GO:0008053mitochondrial fusion
GO:0010635regulation of mitochondrial fusion
GO:0045494photoreceptor cell maintenance
GO:0070584mitochondrion morphogenesis
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
GO:0005741mitochondrial outer membrane
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019392MitoguardinPFAMPF10265Migacoord: 155..458
e-value: 1.2E-77
score: 262.2
IPR019392MitoguardinPANTHERPTHR21508UNCHARACTERIZEDcoord: 7..464
NoneNo IPR availableTMHMMTMhelixcoord: 10..27