Histone-binding protein RBBP4

Overview
NameHistone-binding protein RBBP4
Smed IDSMED30022238
Length (bp)1427
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Histone-binding protein RBBP4 (SMED30022238) t-SNE clustered cells

Violin plots show distribution of expression levels for Histone-binding protein RBBP4 (SMED30022238) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Histone-binding protein RBBP4 (SMED30022238) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Histone-binding protein RBBP4 (SMED30022238) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022238

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30022238SMESG000062893.1 SmedASXL_001240SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30022238SMESG000062893.1 dd_Smed_v4_5055_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022238SMESG000062893.1 Contig45477newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022238SMESG000062893.1 Contig45477uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
zeta neoblastSMED30022238SMESG000062893.1 dd_Smed_v4_5055_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Histone-binding protein RBBP4 vs. Ensembl Human
Match: RBBP4 (RB binding protein 4, chromatin remodeling factor [Source:HGNC Symbol;Acc:HGNC:9887])

HSP 1 Score: 582.793 bits (1501), Expect = 0.000e+0
Identity = 269/404 (66.58%), Postives = 330/404 (81.68%), Query Frame = 1
Query:  163 DYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTERFDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARPF-GMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADIMYNDNDADSTVLP 1371
            +YKIWK++TPFLYD +M H LEWPSLTAQWLP + RP  KD+++HRL+LGTHTSDEQNHL+IAS+ +PND  +FDAS YD+E+ ++GGFG  +GK+EI + INHEGEVNRARYMPQN   +ATKTP++DVL+F+Y  HP++P    E  P+LRL+GH KEGYGLSWNP  +G++LSASDD TIC+WD +       EG  ++    F GH  VVEDV+WHL H  +FGSVADD+KLMIWD RS+NTSKP   VDAHTAEVNC++FNP+++ ++ TGSADKTVA+WD+RNL+LKLHSFE+H+DEIFQVQWSPHNETI ASSGTDRRL++WD SKIG EQ   +  DGPPELLFIH GHTAKISDFSWN  EPW ICSV+EDNI+QVWQMA+ +YND D + +V P
Sbjct:   20 EYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAV---PKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDP 420          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Human
Match: RBBP4 (RB binding protein 4, chromatin remodeling factor [Source:HGNC Symbol;Acc:HGNC:9887])

HSP 1 Score: 582.022 bits (1499), Expect = 0.000e+0
Identity = 269/404 (66.58%), Postives = 330/404 (81.68%), Query Frame = 1
Query:  163 DYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTERFDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARPF-GMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADIMYNDNDADSTVLP 1371
            +YKIWK++TPFLYD +M H LEWPSLTAQWLP + RP  KD+++HRL+LGTHTSDEQNHL+IAS+ +PND  +FDAS YD+E+ ++GGFG  +GK+EI + INHEGEVNRARYMPQN   +ATKTP++DVL+F+Y  HP++P    E  P+LRL+GH KEGYGLSWNP  +G++LSASDD TIC+WD +       EG  ++    F GH  VVEDV+WHL H  +FGSVADD+KLMIWD RS+NTSKP   VDAHTAEVNC++FNP+++ ++ TGSADKTVA+WD+RNL+LKLHSFE+H+DEIFQVQWSPHNETI ASSGTDRRL++WD SKIG EQ   +  DGPPELLFIH GHTAKISDFSWN  EPW ICSV+EDNI+QVWQMA+ +YND D + +V P
Sbjct:   19 EYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAV---PKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDP 419          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Human
Match: RBBP4 (RB binding protein 4, chromatin remodeling factor [Source:HGNC Symbol;Acc:HGNC:9887])

HSP 1 Score: 569.311 bits (1466), Expect = 0.000e+0
Identity = 262/392 (66.84%), Postives = 321/392 (81.89%), Query Frame = 1
Query:  163 DYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTERFDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARPF-GMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADIM 1335
            +YKIWK++TPFLYD +M H LEWPSLTAQWLP + RP  KD+++HRL+LGTHTSDEQNHL+IAS+ +PND  +FDAS YD+E+ ++GGFG  +GK+EI + INHEGEVNRARYMPQN   +ATKTP++DVL+F+Y  HP++P    E  P+LRL+GH KEGYGLSWNP  +G++LSASDD TIC+WD +       EG  ++    F GH  VVEDV+WHL H  +FGSVADD+KLMIWD RS+NTSKP   VDAHTAEVNC++FNP+++ ++ TGSADKTVA+WD+RNL+LKLHSFE+H+DEIFQVQWSPHNETI ASSGTDRRL++WD SKIG EQ   +  DGPPELLFIH GHTAKISDFSWN  EPW ICSV+EDNI+QVWQM  ++
Sbjct:   20 EYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAV---PKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMELVL 408          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Human
Match: RBBP7 (RB binding protein 7, chromatin remodeling factor [Source:HGNC Symbol;Acc:HGNC:9890])

HSP 1 Score: 558.91 bits (1439), Expect = 0.000e+0
Identity = 257/402 (63.93%), Postives = 321/402 (79.85%), Query Frame = 1
Query:  163 DYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTERFDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARPF-GMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADIMYNDNDADSTV 1365
            +YKIWK++TPFLYD +M H L+WPSLT QWLP + +P  KDY +H L+LGTHTSDEQNHL++A +++PND  +FDAS  D+++ ++GGFG   GK+E  + INHEGEVNRARYMPQN   +ATKTP++DVL+F+Y  HPA+P    E  P+LRL+GH KEGYGLSWN   +G++LSASDD T+C+WD N       EG  ++    F GH+ VVEDVAWHL H  +FGSVADD+KLMIWD RS+ TSKP   VDAHTAEVNC++FNP+++ ++ TGSADKTVA+WD+RNL+LKLH+FE+H+DEIFQV WSPHNETI ASSGTDRRL++WD SKIG EQ   +  DGPPELLFIH GHTAKISDFSWN  EPW ICSV+EDNI+Q+WQMA+ +YND ++D T 
Sbjct:   63 EYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAG---PKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYNDEESDVTT 461          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Human
Match: RBBP7 (RB binding protein 7, chromatin remodeling factor [Source:HGNC Symbol;Acc:HGNC:9890])

HSP 1 Score: 558.525 bits (1438), Expect = 0.000e+0
Identity = 257/402 (63.93%), Postives = 321/402 (79.85%), Query Frame = 1
Query:  163 DYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTERFDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARPF-GMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADIMYNDNDADSTV 1365
            +YKIWK++TPFLYD +M H L+WPSLT QWLP + +P  KDY +H L+LGTHTSDEQNHL++A +++PND  +FDAS  D+++ ++GGFG   GK+E  + INHEGEVNRARYMPQN   +ATKTP++DVL+F+Y  HPA+P    E  P+LRL+GH KEGYGLSWN   +G++LSASDD T+C+WD N       EG  ++    F GH+ VVEDVAWHL H  +FGSVADD+KLMIWD RS+ TSKP   VDAHTAEVNC++FNP+++ ++ TGSADKTVA+WD+RNL+LKLH+FE+H+DEIFQV WSPHNETI ASSGTDRRL++WD SKIG EQ   +  DGPPELLFIH GHTAKISDFSWN  EPW ICSV+EDNI+Q+WQMA+ +YND ++D T 
Sbjct:   19 EYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAG---PKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYNDEESDVTT 417          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Celegans
Match: lin-53 (Probable histone-binding protein lin-53 [Source:UniProtKB/Swiss-Prot;Acc:P90916])

HSP 1 Score: 548.895 bits (1413), Expect = 0.000e+0
Identity = 262/399 (65.66%), Postives = 312/399 (78.20%), Query Frame = 1
Query:  163 DYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTERFDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARPFGMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADIMYNDNDADS 1359
            +YKIWK++TPFLYD +M H LEWPSL+ QWLP + + N  D+T+HRLILGTHTSDEQNHLLI+ I MP D  +FDAS YDTER +YGGFG  NGK+E  + INHEGEVNRARYMPQ    +ATK+P ADV IF+Y  H A P      P +RLKGH KEGYGLSWNP K G ILSASDD+T+C WD N   N + E   +     F GH +VVEDVAWH+ H  VFGSV DDKKL+IWD+R   TS P   +DAH+AEVNC+AFNP+++ ++ TGSADKTVA+WD+RNL++KLHSFE+H+DEIFQVQWSPHNETI ASSGTD+RLH+WD SKIG +Q   +  DGPPELLFIH GHTAKISDFSWN  EPW +CSV+EDNILQVWQMAD +YN+ D ++
Sbjct:   17 EYKIWKKNTPFLYDLVMTHALEWPSLSVQWLPDVAKDN-SDHTIHRLILGTHTSDEQNHLLISKICMPTDDAQFDASRYDTERSEYGGFGAVNGKVEPDIRINHEGEVNRARYMPQKSNIIATKSPHADVYIFDYLKHSAVPRDNTFNPLIRLKGHTKEGYGLSWNPNKEGLILSASDDQTVCHWDINANQNVAGE---LQAKDVFKGHESVVEDVAWHVLHDGVFGSVGDDKKLLIWDVR---TSTPGHCIDAHSAEVNCLAFNPYSEFILATGSADKTVALWDLRNLRMKLHSFESHRDEIFQVQWSPHNETILASSGTDKRLHVWDLSKIGEDQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVVCSVSEDNILQVWQMADNIYNEVDEET 408          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Celegans
Match: rba-1 (Probable histone-binding protein rba-1 [Source:UniProtKB/Swiss-Prot;Acc:P90917])

HSP 1 Score: 395.586 bits (1015), Expect = 6.163e-135
Identity = 187/395 (47.34%), Postives = 268/395 (67.85%), Query Frame = 1
Query:  163 DYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDE-QNHLLIASINMPNDQTEFDASAYDTERFDYGGFGFPNG-KLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARPFGMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIG--LEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADIM 1335
            +++IWK++ P+LYD ++   +EWPSL+ QW+P + +  + D ++HR+I GTHT    QNHL+I+   +  D  EFD + +D+ER ++GG+G  +  K +  + INH GEV+RARYMP N   +A++ P+ DV IF+Y  HP+ P   + +P+LRLKGH  EGYG+SW+  + G++L+A DD  IC WD N     S +   I P  +F GH++  EDV++H  H  VFGSV DD+KL +WD+R    SKP +    HTAEVNCI FNPF+++++ TGS DKTVA+WDMRN++ K+++ + H DEIFQV +SPH ET+ ASSG+D R+ +WD SKI              PPE++FIH GHT K++DFSWN   PWTICS  E N LQVW++++ +
Sbjct:   13 EHRIWKKNVPYLYDTVVTKEVEWPSLSVQWMPDVTKTENSDSSMHRMIHGTHTCGGVQNHLMISKFTITTDTPEFDDAKWDSEREEFGGYGEGSAAKWDTEIKINHPGEVHRARYMPHNPFIIASRGPSDDVYIFDYTKHPSEPKDTKFRPQLRLKGHEGEGYGMSWSNTREGHLLTAGDDGMICHWDINANQTISGQ---IVPQSKFKGHSSNAEDVSFHALHNFVFGSVGDDRKLNLWDLRQ---SKPQLTAVGHTAEVNCITFNPFSEYILATGSVDKTVALWDMRNMRKKMYTLKHHNDEIFQVSFSPHYETVLASSGSDDRVIVWDISKIQDPSSSSAASSDSVPPEVIFIHAGHTGKVADFSWNPNRPWTICSSDEFNALQVWEVSNSL 401          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Celegans
Match: Y54H5A.1 (pep chromosome:WBcel235:III:5153543:5155465:1 gene:WBGene00021899.1 transcript:Y54H5A.1.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y54H5A.1)

HSP 1 Score: 115.161 bits (287), Expect = 1.165e-27
Identity = 85/283 (30.04%), Postives = 133/283 (47.00%), Query Frame = 1
Query:  466 INHEGEVNRARY-MPQNETFVATKTPTADVLIFNY--AIHPARPFGMEVKPELRL--------KGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVD-AHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLK--LHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEP 1272
            I H G +NR R     + T  A  +    V ++N   A++       E K E++          G  KEGYGL+W+ +K G + +    K I +W     G  +      NPL    GH   VED+AW      +  S + D  + +WD RS      V  V  AH ++VN I++N  +++L+V+G  D  + +W ++ +Q    +  F+ H   I  V W PH  T F +SG D +  IWD +     Q  +E V  PP+L+F+H G   ++ +  W+Q  P
Sbjct:  162 IPHYGGINRIRSDRLGDSTVCACWSDQGRVQVWNITDALNYTHGMSGESKTEVQKIDRPLFTNNGSGKEGYGLAWSSLKTGDLATGDIIKKIYLWQMKEGGQWAVGA---NPL---TGHKKSVEDLAWSPTETGLLASCSADGSIKLWDTRSAPKDACVCTVQKAHESDVNVISWN-RHENLIVSGGDDGELKIWSLKTIQFGQPVALFKYHNSPITSVDWHPHETTTFMASGEDDQTTIWDIATEADGQTNIEGV--PPQLMFVHMGQN-EVKEVHWHQQIP 434          

HSP 2 Score: 56.6102 bits (135), Expect = 1.990e-8
Identity = 52/206 (25.24%), Postives = 89/206 (43.20%), Query Frame = 1
Query:  730 AGNSSSEGPYIN-PLMQFIGHNTVVEDVAWH-LRHGDVF-GSVADDKKLMIWDIRSDNT-SKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNL---QLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMA 1326
            +G S +E   I+ PL    G       +AW  L+ GD+  G +   KK+ +W ++     +     +  H   V  +A++P    L+ + SAD ++ +WD R+           +AH+ ++  + W+ H E +  S G D  L IW    I           G P  LF +  H + I+   W+  E  T  +  ED+   +W +A
Sbjct:  207 SGESKTEVQKIDRPLFTNNGSGKEGYGLAWSSLKTGDLATGDII--KKIYLWQMKEGGQWAVGANPLTGHKKSVEDLAWSPTETGLLASCSADGSIKLWDTRSAPKDACVCTVQKAHESDVNVISWNRH-ENLIVSGGDDGELKIWSLKTIQF---------GQPVALFKY--HNSPITSVDWHPHETTTFMASGEDDQTTIWDIA 398          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Celegans
Match: Y54H5A.1 (pep chromosome:WBcel235:III:5153464:5155465:1 gene:WBGene00021899.1 transcript:Y54H5A.1.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y54H5A.1)

HSP 1 Score: 115.161 bits (287), Expect = 1.165e-27
Identity = 85/283 (30.04%), Postives = 133/283 (47.00%), Query Frame = 1
Query:  466 INHEGEVNRARY-MPQNETFVATKTPTADVLIFNY--AIHPARPFGMEVKPELRL--------KGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVD-AHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLK--LHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEP 1272
            I H G +NR R     + T  A  +    V ++N   A++       E K E++          G  KEGYGL+W+ +K G + +    K I +W     G  +      NPL    GH   VED+AW      +  S + D  + +WD RS      V  V  AH ++VN I++N  +++L+V+G  D  + +W ++ +Q    +  F+ H   I  V W PH  T F +SG D +  IWD +     Q  +E V  PP+L+F+H G   ++ +  W+Q  P
Sbjct:  162 IPHYGGINRIRSDRLGDSTVCACWSDQGRVQVWNITDALNYTHGMSGESKTEVQKIDRPLFTNNGSGKEGYGLAWSSLKTGDLATGDIIKKIYLWQMKEGGQWAVGA---NPL---TGHKKSVEDLAWSPTETGLLASCSADGSIKLWDTRSAPKDACVCTVQKAHESDVNVISWN-RHENLIVSGGDDGELKIWSLKTIQFGQPVALFKYHNSPITSVDWHPHETTTFMASGEDDQTTIWDIATEADGQTNIEGV--PPQLMFVHMGQN-EVKEVHWHQQIP 434          

HSP 2 Score: 56.6102 bits (135), Expect = 1.990e-8
Identity = 52/206 (25.24%), Postives = 89/206 (43.20%), Query Frame = 1
Query:  730 AGNSSSEGPYIN-PLMQFIGHNTVVEDVAWH-LRHGDVF-GSVADDKKLMIWDIRSDNT-SKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNL---QLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMA 1326
            +G S +E   I+ PL    G       +AW  L+ GD+  G +   KK+ +W ++     +     +  H   V  +A++P    L+ + SAD ++ +WD R+           +AH+ ++  + W+ H E +  S G D  L IW    I           G P  LF +  H + I+   W+  E  T  +  ED+   +W +A
Sbjct:  207 SGESKTEVQKIDRPLFTNNGSGKEGYGLAWSSLKTGDLATGDII--KKIYLWQMKEGGQWAVGANPLTGHKKSVEDLAWSPTETGLLASCSADGSIKLWDTRSAPKDACVCTVQKAHESDVNVISWNRH-ENLIVSGGDDGELKIWSLKTIQF---------GQPVALFKY--HNSPITSVDWHPHETTTFMASGEDDQTTIWDIA 398          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Celegans
Match: Y54H5A.1 (pep chromosome:WBcel235:III:5153406:5155436:1 gene:WBGene00021899.1 transcript:Y54H5A.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y54H5A.1)

HSP 1 Score: 115.161 bits (287), Expect = 1.165e-27
Identity = 85/283 (30.04%), Postives = 133/283 (47.00%), Query Frame = 1
Query:  466 INHEGEVNRARY-MPQNETFVATKTPTADVLIFNY--AIHPARPFGMEVKPELRL--------KGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVD-AHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLK--LHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEP 1272
            I H G +NR R     + T  A  +    V ++N   A++       E K E++          G  KEGYGL+W+ +K G + +    K I +W     G  +      NPL    GH   VED+AW      +  S + D  + +WD RS      V  V  AH ++VN I++N  +++L+V+G  D  + +W ++ +Q    +  F+ H   I  V W PH  T F +SG D +  IWD +     Q  +E V  PP+L+F+H G   ++ +  W+Q  P
Sbjct:  162 IPHYGGINRIRSDRLGDSTVCACWSDQGRVQVWNITDALNYTHGMSGESKTEVQKIDRPLFTNNGSGKEGYGLAWSSLKTGDLATGDIIKKIYLWQMKEGGQWAVGA---NPL---TGHKKSVEDLAWSPTETGLLASCSADGSIKLWDTRSAPKDACVCTVQKAHESDVNVISWN-RHENLIVSGGDDGELKIWSLKTIQFGQPVALFKYHNSPITSVDWHPHETTTFMASGEDDQTTIWDIATEADGQTNIEGV--PPQLMFVHMGQN-EVKEVHWHQQIP 434          

HSP 2 Score: 56.6102 bits (135), Expect = 1.990e-8
Identity = 52/206 (25.24%), Postives = 89/206 (43.20%), Query Frame = 1
Query:  730 AGNSSSEGPYIN-PLMQFIGHNTVVEDVAWH-LRHGDVF-GSVADDKKLMIWDIRSDNT-SKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNL---QLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMA 1326
            +G S +E   I+ PL    G       +AW  L+ GD+  G +   KK+ +W ++     +     +  H   V  +A++P    L+ + SAD ++ +WD R+           +AH+ ++  + W+ H E +  S G D  L IW    I           G P  LF +  H + I+   W+  E  T  +  ED+   +W +A
Sbjct:  207 SGESKTEVQKIDRPLFTNNGSGKEGYGLAWSSLKTGDLATGDII--KKIYLWQMKEGGQWAVGANPLTGHKKSVEDLAWSPTETGLLASCSADGSIKLWDTRSAPKDACVCTVQKAHESDVNVISWNRH-ENLIVSGGDDGELKIWSLKTIQF---------GQPVALFKY--HNSPITSVDWHPHETTTFMASGEDDQTTIWDIA 398          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Fly
Match: Caf1-55 (gene:FBgn0263979 transcript:FBtr0083052)

HSP 1 Score: 573.933 bits (1478), Expect = 0.000e+0
Identity = 268/399 (67.17%), Postives = 324/399 (81.20%), Query Frame = 1
Query:  163 DYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTERFDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARPF-GMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADIMYNDNDAD 1356
            +YKIWK++TPFLYD +M H LEWPSLTAQWLP + + + KDY+VHRLILGTHTSDEQNHLLIAS+ +P++  +FD S YD E+ ++GGFG   GK+EI + INHEGEVNRARYMPQN   +ATKTP++DVL+F+Y  HP++P    E +P+LRL+GH KEGYGLSWNP   GY+LSASDD TIC+WD N    +  E   I+    F GH  VVEDVAWHL H  +FGSVADD+KLMIWD R++NTSKP   VDAHTAEVNC++FNP+++ ++ TGSADKTVA+WD+RNL+LKLHSFE+H+DEIFQVQWSPHNETI ASSGTDRRLH+WD SKIG EQ   +  DGPPELLFIH GHTAKISDFSWN  EPW ICSV+EDNI+QVWQMA+ +YND + +
Sbjct:   24 EYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTKQDGKDYSVHRLILGTHTSDEQNHLLIASVQLPSEDAQFDGSHYDNEKGEFGGFGSVCGKIEIEIKINHEGEVNRARYMPQNACVIATKTPSSDVLVFDYTKHPSKPEPSGECQPDLRLRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINA---TPKEHRVIDAKNIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWDTRNNNTSKPSHTVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQSTEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAENVYNDEEPE 419          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Fly
Match: Caf1-55 (gene:FBgn0263979 transcript:FBtr0301845)

HSP 1 Score: 573.933 bits (1478), Expect = 0.000e+0
Identity = 268/399 (67.17%), Postives = 324/399 (81.20%), Query Frame = 1
Query:  163 DYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTERFDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARPF-GMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADIMYNDNDAD 1356
            +YKIWK++TPFLYD +M H LEWPSLTAQWLP + + + KDY+VHRLILGTHTSDEQNHLLIAS+ +P++  +FD S YD E+ ++GGFG   GK+EI + INHEGEVNRARYMPQN   +ATKTP++DVL+F+Y  HP++P    E +P+LRL+GH KEGYGLSWNP   GY+LSASDD TIC+WD N    +  E   I+    F GH  VVEDVAWHL H  +FGSVADD+KLMIWD R++NTSKP   VDAHTAEVNC++FNP+++ ++ TGSADKTVA+WD+RNL+LKLHSFE+H+DEIFQVQWSPHNETI ASSGTDRRLH+WD SKIG EQ   +  DGPPELLFIH GHTAKISDFSWN  EPW ICSV+EDNI+QVWQMA+ +YND + +
Sbjct:   23 EYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTKQDGKDYSVHRLILGTHTSDEQNHLLIASVQLPSEDAQFDGSHYDNEKGEFGGFGSVCGKIEIEIKINHEGEVNRARYMPQNACVIATKTPSSDVLVFDYTKHPSKPEPSGECQPDLRLRGHQKEGYGLSWNPNLNGYLLSASDDHTICLWDINA---TPKEHRVIDAKNIFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWDTRNNNTSKPSHTVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQSTEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWIICSVSEDNIMQVWQMAENVYNDEEPE 418          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Fly
Match: l(2)09851 (gene:FBgn0022288 transcript:FBtr0335269)

HSP 1 Score: 117.472 bits (293), Expect = 2.541e-28
Identity = 83/297 (27.95%), Postives = 136/297 (45.79%), Query Frame = 1
Query:  463 MINHEGEVNRARYMP-QNETFVATKTPTADVLIFNY-----AIHPARPFGM----EVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEV-DAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLK--LHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCS-------KIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVA 1293
            ++ H+G VNR R     N  + A+ +    V I++      A+  A+        E +P     GH +EG+ + W+P   G + +    + I +W          +G +        GH+  VED+ W      V  S + DK + IWD R+      ++   DAH ++VN I++N  N+  + +G  D  + +WD+R  Q K  + +F+ H D I  V+WSP   T+ AS G D ++ +WD +        +   Q E      PP+LLFIH G   +I +  W+   P  + S A
Sbjct:  156 LVKHQGCVNRVRARRLGNSVYAASWSELGRVNIWDLTQPLQAVENAQLAKQYEQSEARPVFTFGGHQQEGFAIDWSPSADGVLATGDCRRDIHVW------TPVEDGTWKVDQRPLAGHSQSVEDLQWSPNERSVLASCSVDKTIRIWDCRASPQKACMLTCEDAHQSDVNVISWN-RNEPFIASGGDDGYLHIWDLRQFQSKKPIATFKHHTDHITTVEWSPAEATVLASGGDDDQIALWDLAVEKDIDQAVDPAQNEDVLNKLPPQLLFIHQGQK-EIKELHWHPQLPGVLLSTA 444          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Fly
Match: l(2)09851 (gene:FBgn0022288 transcript:FBtr0086043)

HSP 1 Score: 117.472 bits (293), Expect = 2.541e-28
Identity = 83/297 (27.95%), Postives = 136/297 (45.79%), Query Frame = 1
Query:  463 MINHEGEVNRARYMP-QNETFVATKTPTADVLIFNY-----AIHPARPFGM----EVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEV-DAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLK--LHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCS-------KIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVA 1293
            ++ H+G VNR R     N  + A+ +    V I++      A+  A+        E +P     GH +EG+ + W+P   G + +    + I +W          +G +        GH+  VED+ W      V  S + DK + IWD R+      ++   DAH ++VN I++N  N+  + +G  D  + +WD+R  Q K  + +F+ H D I  V+WSP   T+ AS G D ++ +WD +        +   Q E      PP+LLFIH G   +I +  W+   P  + S A
Sbjct:  156 LVKHQGCVNRVRARRLGNSVYAASWSELGRVNIWDLTQPLQAVENAQLAKQYEQSEARPVFTFGGHQQEGFAIDWSPSADGVLATGDCRRDIHVW------TPVEDGTWKVDQRPLAGHSQSVEDLQWSPNERSVLASCSVDKTIRIWDCRASPQKACMLTCEDAHQSDVNVISWN-RNEPFIASGGDDGYLHIWDLRQFQSKKPIATFKHHTDHITTVEWSPAEATVLASGGDDDQIALWDLAVEKDIDQAVDPAQNEDVLNKLPPQLLFIHQGQK-EIKELHWHPQLPGVLLSTA 444          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Fly
Match: Pex7 (gene:FBgn0035922 transcript:FBtr0076568)

HSP 1 Score: 95.9005 bits (237), Expect = 1.998e-21
Identity = 68/230 (29.57%), Postives = 116/230 (50.43%), Query Frame = 1
Query:  604 KPELRLKGHLKEGYGLSWNPIKAGY--ILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDE--IFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEV-----EFVDGPPELLFIHPGHTAKISDFSWNQF 1266
            +P + L+ H  E Y L W   K  Y  +LS S D T+ +WD N            N +  F+GHN ++    +     ++F SV+ D  L +W+   D   KP++ ++AH +E  C  ++ F+++++VTG +D  +  WD+R  +++ H FE +  E  + ++  SPH+  + AS+  D    IW+  + G   QEV     EFV G    L  +P  T +++D  W+  
Sbjct:  114 QPLICLQEHKNEVYSLDWGE-KWNYHTLLSGSWDCTLKLWDCNRQ----------NSITTFVGHNDLIYGAKFSPLIANLFASVSTDGHLNLWN-SLDFAGKPLMSIEAHASEALCCDWSHFDRNVLVTGGSDGLIRGWDLR--KMRTHVFELYSGEFAVRRLACSPHSAAVLASANYDFTTRIWNLER-GESAQEVNARHTEFVCG----LDWNPHRTHQLADCGWDSL 324          

HSP 2 Score: 73.559 bits (179), Expect = 5.315e-14
Identity = 61/246 (24.80%), Postives = 115/246 (46.75%), Query Frame = 1
Query:  634 KEGYGLSWNPIKAGYILSASDD-------KTICMWDTNTAGNSSS-EGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIW-DIRSDNTS------KPVIEVDAHTAEVNCIAFN-PFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQM 1323
            + GY L ++P +A Y+L A+          ++ + + N+  NSSS +G  +  L +    + +  DVAW     D+  + + D  L IW  +  ++ S      +P+I +  H  EV  + +   +N H +++GS D T+ +WD  N Q  + +F  H D I+  ++SP    +FAS  TD  L++W+          ++F   P   L     H ++     W+ F+   + +   D +++ W +
Sbjct:   11 RHGYSLRFSPFEANYLLLATSQLYGLAGGGSLFLLEQNSNTNSSSTDGQSLGELCRLEWSDGLF-DVAWCPYAADIAATASGDGSLQIWCGLDGESASNQLTPKQPLICLQEHKNEVYSLDWGEKWNYHTLLSGSWDCTLKLWDC-NRQNSITTFVGHNDLIYGAKFSPLIANLFASVSTDGHLNLWN---------SLDFAGKP---LMSIEAHASEALCCDWSHFDRNVLVTGGSDGLIRGWDL 242          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Zebrafish
Match: rbbp4 (retinoblastoma binding protein 4 [Source:NCBI gene;Acc:321726])

HSP 1 Score: 582.022 bits (1499), Expect = 0.000e+0
Identity = 270/402 (67.16%), Postives = 327/402 (81.34%), Query Frame = 1
Query:  163 DYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTERFDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARPF-GMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADIMYNDNDADSTV 1365
            +YKIWK++TPFLYD +M H LEWPSLTAQWLP + RP  KD++VHRL+LGTHTSDEQNHL+IAS+ +PND  +FDAS YD+E+ ++GGFG  +GK+EI + INHEGEVNRARYMPQN   +ATKTPT+DVL+F+Y  HP++P    E  P+LRL+GH KEGYGLSWNP  +G +LSASDD TIC+WD +T      EG  ++    F GH  VVEDV+WHL H  +FGSVADD+KLMIWD RS+NTSKP   VDAHTAEVNC++FNP+++ ++ TGSADKTVA+WD+RNL+LKLHSFE+H+DEIFQVQWSPHNETI ASSGTDRRL++WD SKIG EQ   +  DGPPELLFIH GHTAKISDFSWN  EPW ICSV+EDNI+QVWQMA+ +YND D +   
Sbjct:   20 EYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSVHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPTSDVLVFDYTKHPSKPDPSGECTPDLRLRGHQKEGYGLSWNPNLSGCLLSASDDHTICLWDISTV---PKEGKIVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHAVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGAA 418          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Zebrafish
Match: rbb4l (retinoblastoma binding protein 4, like [Source:NCBI gene;Acc:322129])

HSP 1 Score: 580.482 bits (1495), Expect = 0.000e+0
Identity = 269/400 (67.25%), Postives = 327/400 (81.75%), Query Frame = 1
Query:  163 DYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTERFDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARPF-GMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADIMYNDNDADS 1359
            +YKIWK++TPFLYD +M H LEWPSLT QWLP ++RP  KDY VHRL+LGTHTSDEQNHL+IAS+ +PND  +FDAS YD+E+ ++GGFG  +GK+EI + INHEGEVNRARYMPQN   +ATKTPT+DVL+F+Y  HP++P    +  P+LRL+GH KEGYGLSWNP  +G +LSASDD TIC+WD + A     EG  ++    F GH  VVEDV+WHL H  +FGSVADD+KLMIWD RS+NTSKP   VDAHTAEVNC++FNP+++ ++ TGSADKTVA+WD+RNL+LKLHSFE+H+DEIFQVQWSPHNETI ASSGTDRRL++WD SKIG EQ   +  DGPPELLFIH GHTAKISDFSWN  EPW ICSV+EDNI+QVWQMA+ +YND + D+
Sbjct:   19 EYKIWKKNTPFLYDLVMTHALEWPSLTVQWLPDVNRPEGKDYVVHRLVLGTHTSDEQNHLVIASVQIPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPTSDVLVFDYTKHPSKPDPSGDCSPDLRLRGHQKEGYGLSWNPNLSGNLLSASDDHTICLWDISGA---PKEGKIVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEEPDT 415          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Zebrafish
Match: rbb4l (retinoblastoma binding protein 4, like [Source:NCBI gene;Acc:322129])

HSP 1 Score: 576.244 bits (1484), Expect = 0.000e+0
Identity = 269/401 (67.08%), Postives = 327/401 (81.55%), Query Frame = 1
Query:  163 DYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTER-FDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARPF-GMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADIMYNDNDADS 1359
            +YKIWK++TPFLYD +M H LEWPSLT QWLP ++RP  KDY VHRL+LGTHTSDEQNHL+IAS+ +PND  +FDAS YD+E+  ++GGFG  +GK+EI + INHEGEVNRARYMPQN   +ATKTPT+DVL+F+Y  HP++P    +  P+LRL+GH KEGYGLSWNP  +G +LSASDD TIC+WD + A     EG  ++    F GH  VVEDV+WHL H  +FGSVADD+KLMIWD RS+NTSKP   VDAHTAEVNC++FNP+++ ++ TGSADKTVA+WD+RNL+LKLHSFE+H+DEIFQVQWSPHNETI ASSGTDRRL++WD SKIG EQ   +  DGPPELLFIH GHTAKISDFSWN  EPW ICSV+EDNI+QVWQMA+ +YND + D+
Sbjct:   19 EYKIWKKNTPFLYDLVMTHALEWPSLTVQWLPDVNRPEGKDYVVHRLVLGTHTSDEQNHLVIASVQIPNDDAQFDASHYDSEKGAEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPTSDVLVFDYTKHPSKPDPSGDCSPDLRLRGHQKEGYGLSWNPNLSGNLLSASDDHTICLWDISGA---PKEGKIVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEEPDT 416          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Zebrafish
Match: rbb4l (retinoblastoma binding protein 4, like [Source:NCBI gene;Acc:322129])

HSP 1 Score: 576.244 bits (1484), Expect = 0.000e+0
Identity = 269/401 (67.08%), Postives = 327/401 (81.55%), Query Frame = 1
Query:  163 DYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTER-FDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARPF-GMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADIMYNDNDADS 1359
            +YKIWK++TPFLYD +M H LEWPSLT QWLP ++RP  KDY VHRL+LGTHTSDEQNHL+IAS+ +PND  +FDAS YD+E+  ++GGFG  +GK+EI + INHEGEVNRARYMPQN   +ATKTPT+DVL+F+Y  HP++P    +  P+LRL+GH KEGYGLSWNP  +G +LSASDD TIC+WD + A     EG  ++    F GH  VVEDV+WHL H  +FGSVADD+KLMIWD RS+NTSKP   VDAHTAEVNC++FNP+++ ++ TGSADKTVA+WD+RNL+LKLHSFE+H+DEIFQVQWSPHNETI ASSGTDRRL++WD SKIG EQ   +  DGPPELLFIH GHTAKISDFSWN  EPW ICSV+EDNI+QVWQMA+ +YND + D+
Sbjct:   19 EYKIWKKNTPFLYDLVMTHALEWPSLTVQWLPDVNRPEGKDYVVHRLVLGTHTSDEQNHLVIASVQIPNDDAQFDASHYDSEKGAEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPTSDVLVFDYTKHPSKPDPSGDCSPDLRLRGHQKEGYGLSWNPNLSGNLLSASDDHTICLWDISGA---PKEGKIVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEEPDT 416          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Zebrafish
Match: CR450764.7 (pep chromosome:GRCz11:CHR_ALT_CTG11_3_1:12801933:12802332:1 gene:ENSDARG00000110109.1 transcript:ENSDART00000179997.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR450764.7)

HSP 1 Score: 137.887 bits (346), Expect = 4.795e-39
Identity = 58/83 (69.88%), Postives = 71/83 (85.54%), Query Frame = 1
Query:  163 DYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTER 411
            +YKIWK++TPFLYD +M H LEWPSLT QWLP ++RP  KDY VHRL+LGTHTSDEQNHL+IAS+ +PND  +FDAS YD+E+
Sbjct:   19 EYKIWKKNTPFLYDLVMTHALEWPSLTVQWLPDVNRPEGKDYVVHRLVLGTHTSDEQNHLVIASVQIPNDDAQFDASHYDSEK 101          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Xenopus
Match: rbbp4 (retinoblastoma binding protein 4 [Source:NCBI gene;Acc:496866])

HSP 1 Score: 581.637 bits (1498), Expect = 0.000e+0
Identity = 269/404 (66.58%), Postives = 329/404 (81.44%), Query Frame = 1
Query:  163 DYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTERFDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARPF-GMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADIMYNDNDADSTVLP 1371
            +YKIWK++TPFLYD +M H LEWPSLTAQWLP + RP+ KD+++HRL+LGTHTSDEQNHL+IAS+ +PND  +FDAS YD+E+ ++GGFG  +GK+EI + INHEGEVNRARYMPQN   +ATKTP++DVL+F+Y  HP++P    E  P+LRL+GH KEGYGLSWNP  +G +LSASDD TIC+WD +       EG  ++    F GH  VVEDV+WHL H  +FGSVADD+KLMIWD RS+NTSKP   VDAHTAEVNC++FNP+++ ++ TGSADKTVA+WD+RNL+LKLHSFE+H+DEIFQVQWSPHNETI ASSGTDRRL++WD SKIG EQ   +  DGPPELLFIH GHTAKISDFSWN  EPW ICSV+EDNI+QVWQMA+ +YND D +  V P
Sbjct:   50 EYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPDGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGNLLSASDDHTICLWDISAV---PKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDTEGGVDP 450          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Xenopus
Match: rbbp4 (retinoblastoma binding protein 4 [Source:NCBI gene;Acc:496866])

HSP 1 Score: 581.637 bits (1498), Expect = 0.000e+0
Identity = 269/404 (66.58%), Postives = 329/404 (81.44%), Query Frame = 1
Query:  163 DYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTERFDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARPF-GMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADIMYNDNDADSTVLP 1371
            +YKIWK++TPFLYD +M H LEWPSLTAQWLP + RP+ KD+++HRL+LGTHTSDEQNHL+IAS+ +PND  +FDAS YD+E+ ++GGFG  +GK+EI + INHEGEVNRARYMPQN   +ATKTP++DVL+F+Y  HP++P    E  P+LRL+GH KEGYGLSWNP  +G +LSASDD TIC+WD +       EG  ++    F GH  VVEDV+WHL H  +FGSVADD+KLMIWD RS+NTSKP   VDAHTAEVNC++FNP+++ ++ TGSADKTVA+WD+RNL+LKLHSFE+H+DEIFQVQWSPHNETI ASSGTDRRL++WD SKIG EQ   +  DGPPELLFIH GHTAKISDFSWN  EPW ICSV+EDNI+QVWQMA+ +YND D +  V P
Sbjct:   26 EYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPDGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGNLLSASDDHTICLWDISAV---PKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDTEGGVDP 426          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Xenopus
Match: rbbp4 (retinoblastoma binding protein 4 [Source:NCBI gene;Acc:496866])

HSP 1 Score: 567.77 bits (1462), Expect = 0.000e+0
Identity = 262/389 (67.35%), Postives = 319/389 (82.01%), Query Frame = 1
Query:  163 DYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTERFDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARPF-GMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMA 1326
            +YKIWK++TPFLYD +M H LEWPSLTAQWLP + RP+ KD+++HRL+LGTHTSDEQNHL+IAS+ +PND  +FDAS YD+E+ ++GGFG  +GK+EI + INHEGEVNRARYMPQN   +ATKTP++DVL+F+Y  HP++P    E  P+LRL+GH KEGYGLSWNP  +G +LSASDD TIC+WD +       EG  ++    F GH  VVEDV+WHL H  +FGSVADD+KLMIWD RS+NTSKP   VDAHTAEVNC++FNP+++ ++ TGSADKTVA+WD+RNL+LKLHSFE+H+DEIFQVQWSPHNETI ASSGTDRRL++WD SKIG EQ   +  DGPPELLFIH GHTAKISDFSWN  EPW ICSV+EDNI+QVWQM 
Sbjct:   18 EYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPDGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGNLLSASDDHTICLWDISAV---PKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMV 403          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Xenopus
Match: rbbp4 (retinoblastoma binding protein 4 [Source:NCBI gene;Acc:496866])

HSP 1 Score: 563.918 bits (1452), Expect = 0.000e+0
Identity = 269/437 (61.56%), Postives = 330/437 (75.51%), Query Frame = 1
Query:  163 DYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTERFDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARPF-GMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDD---------------------------------KTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADIMYNDNDADSTVLP 1371
            +YKIWK++TPFLYD +M H LEWPSLTAQWLP + RP+ KD+++HRL+LGTHTSDEQNHL+IAS+ +PND  +FDAS YD+E+ ++GGFG  +GK+EI + INHEGEVNRARYMPQN   +ATKTP++DVL+F+Y  HP++P    E  P+LRL+GH KEGYGLSWNP  +G +LSASDD                                 +TIC+WD +       EG  ++    F GH  VVEDV+WHL H  +FGSVADD+KLMIWD RS+NTSKP   VDAHTAEVNC++FNP+++ ++ TGSADKTVA+WD+RNL+LKLHSFE+H+DEIFQVQWSPHNETI ASSGTDRRL++WD SKIG EQ   +  DGPPELLFIH GHTAKISDFSWN  EPW ICSV+EDNI+QVWQMA+ +YND D +  V P
Sbjct:   18 EYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPDGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGNLLSASDDHVSRRSYFYFPPLLRSPYLIIFLFYFFSLQFCLQTICLWDISAV---PKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDTEGGVDP 451          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Xenopus
Match: rbbp7 (retinoblastoma binding protein 7 [Source:NCBI gene;Acc:394900])

HSP 1 Score: 563.533 bits (1451), Expect = 0.000e+0
Identity = 259/399 (64.91%), Postives = 320/399 (80.20%), Query Frame = 1
Query:  163 DYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTERFDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARPF-GMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADIMYNDNDAD 1356
            +YKIWK++TPFLYD +M H LEWPSLT QWLP + RP  KDY +H L+LGTHTSDEQNHL++A + +PND  +FDAS YD+E+ ++GGFG  +GK+E  + INHEGEVNRARYMPQN   +ATKTP+ADVL+F+Y  HP++P    +  P+LRL+GH KEGYGLSWN   +G++LSASDD T+C+WD +       EG  ++    F GH+ VVEDVAWHL H  +FGSVADD+KLMIWD RS+ TSKP   VDAHTAEVNC++FNP+++ ++ TGSADKTVA+WD+RNL+LKLHSFE+H+DEIFQV WSPHNETI ASSGTDRRL++WD SKIG EQ   +  DGPPELLFIH GHTAKISDFSWN  EPW ICSV+EDNI+Q+WQMA+ +YND + D
Sbjct:   19 EYKIWKKNTPFLYDLVMTHALEWPSLTVQWLPDVTRPEGKDYALHWLVLGTHTSDEQNHLVVARVQIPNDDAQFDASHYDSEKGEFGGFGSVSGKIETEIKINHEGEVNRARYMPQNPCIIATKTPSADVLVFDYTKHPSKPDPSGDCSPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDISAG---PKEGKVVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYNDEEPD 414          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Mouse
Match: Rbbp4 (retinoblastoma binding protein 4, chromatin remodeling factor [Source:MGI Symbol;Acc:MGI:1194912])

HSP 1 Score: 582.793 bits (1501), Expect = 0.000e+0
Identity = 269/404 (66.58%), Postives = 330/404 (81.68%), Query Frame = 1
Query:  163 DYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTERFDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARPF-GMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADIMYNDNDADSTVLP 1371
            +YKIWK++TPFLYD +M H LEWPSLTAQWLP + RP  KD+++HRL+LGTHTSDEQNHL+IAS+ +PND  +FDAS YD+E+ ++GGFG  +GK+EI + INHEGEVNRARYMPQN   +ATKTP++DVL+F+Y  HP++P    E  P+LRL+GH KEGYGLSWNP  +G++LSASDD TIC+WD +       EG  ++    F GH  VVEDV+WHL H  +FGSVADD+KLMIWD RS+NTSKP   VDAHTAEVNC++FNP+++ ++ TGSADKTVA+WD+RNL+LKLHSFE+H+DEIFQVQWSPHNETI ASSGTDRRL++WD SKIG EQ   +  DGPPELLFIH GHTAKISDFSWN  EPW ICSV+EDNI+QVWQMA+ +YND D + +V P
Sbjct:   20 EYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAV---PKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDP 420          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Mouse
Match: Rbbp7 (retinoblastoma binding protein 7, chromatin remodeling factor [Source:MGI Symbol;Acc:MGI:1194910])

HSP 1 Score: 558.525 bits (1438), Expect = 0.000e+0
Identity = 257/402 (63.93%), Postives = 321/402 (79.85%), Query Frame = 1
Query:  163 DYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTERFDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARPF-GMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADIMYNDNDADSTV 1365
            +YKIWK++TPFLYD +M H L+WPSLT QWLP + +P  KDY +H L+LGTHTSDEQNHL++A +++PND  +FDAS  D+++ ++GGFG   GK+E  + INHEGEVNRARYMPQN   +ATKTP++DVL+F+Y  HPA+P    E  P+LRL+GH KEGYGLSWN   +G++LSASDD T+C+WD N       EG  ++    F GH+ VVEDVAWHL H  +FGSVADD+KLMIWD RS+ TSKP   VDAHTAEVNC++FNP+++ ++ TGSADKTVA+WD+RNL+LKLH+FE+H+DEIFQV WSPHNETI ASSGTDRRL++WD SKIG EQ   +  DGPPELLFIH GHTAKISDFSWN  EPW ICSV+EDNI+Q+WQMA+ +YND ++D T 
Sbjct:   19 EYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAG---PKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYNDEESDVTA 417          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Mouse
Match: Rbbp7 (retinoblastoma binding protein 7, chromatin remodeling factor [Source:MGI Symbol;Acc:MGI:1194910])

HSP 1 Score: 541.962 bits (1395), Expect = 0.000e+0
Identity = 253/402 (62.94%), Postives = 315/402 (78.36%), Query Frame = 1
Query:  163 DYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTERFDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARPF-GMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADIMYNDNDADSTV 1365
            +YKIWK++TPFLYD +M H L+WPSLT QWLP + +P  KDY +H L+LGTHTSDEQNHL++A +++PND  +FDAS  D+++          GK+E  + INHEGEVNRARYMPQN   +ATKTP++DVL+F+Y  HPA+P    E  P+LRL+GH KEGYGLSWN   +G++LSASDD T+C+WD N       EG  ++    F GH+ VVEDVAWHL H  +FGSVADD+KLMIWD RS+ TSKP   VDAHTAEVNC++FNP+++ ++ TGSADKTVA+WD+RNL+LKLH+FE+H+DEIFQV WSPHNETI ASSGTDRRL++WD SKIG EQ   +  DGPPELLFIH GHTAKISDFSWN  EPW ICSV+EDNI+Q+WQMA+ +YND ++D T 
Sbjct:   19 EYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDK---------GGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAG---PKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYNDEESDVTA 408          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Mouse
Match: Rbbp7 (retinoblastoma binding protein 7, chromatin remodeling factor [Source:MGI Symbol;Acc:MGI:1194910])

HSP 1 Score: 479.174 bits (1232), Expect = 7.735e-168
Identity = 221/351 (62.96%), Postives = 278/351 (79.20%), Query Frame = 1
Query:  163 DYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTERFDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARPF-GMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELL 1212
            +YKIWK++TPFLYD +M H L+WPSLT QWLP + +P  KDY +H L+LGTHTSDEQNHL++A +++PND  +FDAS  D+++ ++GGFG   GK+E  + INHEGEVNRARYMPQN   +ATKTP++DVL+F+Y  HPA+P    E  P+LRL+GH KEGYGLSWN   +G++LSASDD T+C+WD N       EG  ++    F GH+ VVEDVAWHL H  +FGSVADD+KLMIWD RS+ TSKP   VDAHTAEVNC++FNP+++ ++ TGSADKTVA+WD+RNL+LKLH+FE+H+DEIFQV WSPHNETI ASSGTDRRL++WD SKIG EQ   +  DGPPELL
Sbjct:   19 EYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAG---PKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELL 366          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Mouse
Match: Rbbp7 (retinoblastoma binding protein 7, chromatin remodeling factor [Source:MGI Symbol;Acc:MGI:1194910])

HSP 1 Score: 258.455 bits (659), Expect = 1.372e-83
Identity = 115/189 (60.85%), Postives = 150/189 (79.37%), Query Frame = 1
Query:  163 DYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTERFDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARP-FGMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTN 726
            +YKIWK++TPFLYD +M H L+WPSLT QWLP + +P  KDY +H L+LGTHTSDEQNHL++A +++PND  +FDAS  D+++ ++GGFG   GK+E  + INHEGEVNRARYMPQN   +ATKTP++DVL+F+Y  HPA+P    E  P+LRL+GH KEGYGLSWN   +G++LSASDD T+C+WD N
Sbjct:   47 EYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDIN 235          
BLAST of Histone-binding protein RBBP4 vs. UniProt/SwissProt
Match: sp|Q60972|RBBP4_MOUSE (Histone-binding protein RBBP4 OS=Mus musculus OX=10090 GN=Rbbp4 PE=1 SV=5)

HSP 1 Score: 582.793 bits (1501), Expect = 0.000e+0
Identity = 269/404 (66.58%), Postives = 330/404 (81.68%), Query Frame = 1
Query:  163 DYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTERFDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARPF-GMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADIMYNDNDADSTVLP 1371
            +YKIWK++TPFLYD +M H LEWPSLTAQWLP + RP  KD+++HRL+LGTHTSDEQNHL+IAS+ +PND  +FDAS YD+E+ ++GGFG  +GK+EI + INHEGEVNRARYMPQN   +ATKTP++DVL+F+Y  HP++P    E  P+LRL+GH KEGYGLSWNP  +G++LSASDD TIC+WD +       EG  ++    F GH  VVEDV+WHL H  +FGSVADD+KLMIWD RS+NTSKP   VDAHTAEVNC++FNP+++ ++ TGSADKTVA+WD+RNL+LKLHSFE+H+DEIFQVQWSPHNETI ASSGTDRRL++WD SKIG EQ   +  DGPPELLFIH GHTAKISDFSWN  EPW ICSV+EDNI+QVWQMA+ +YND D + +V P
Sbjct:   20 EYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAV---PKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDP 420          
BLAST of Histone-binding protein RBBP4 vs. UniProt/SwissProt
Match: sp|Q09028|RBBP4_HUMAN (Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4 PE=1 SV=3)

HSP 1 Score: 582.793 bits (1501), Expect = 0.000e+0
Identity = 269/404 (66.58%), Postives = 330/404 (81.68%), Query Frame = 1
Query:  163 DYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTERFDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARPF-GMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADIMYNDNDADSTVLP 1371
            +YKIWK++TPFLYD +M H LEWPSLTAQWLP + RP  KD+++HRL+LGTHTSDEQNHL+IAS+ +PND  +FDAS YD+E+ ++GGFG  +GK+EI + INHEGEVNRARYMPQN   +ATKTP++DVL+F+Y  HP++P    E  P+LRL+GH KEGYGLSWNP  +G++LSASDD TIC+WD +       EG  ++    F GH  VVEDV+WHL H  +FGSVADD+KLMIWD RS+NTSKP   VDAHTAEVNC++FNP+++ ++ TGSADKTVA+WD+RNL+LKLHSFE+H+DEIFQVQWSPHNETI ASSGTDRRL++WD SKIG EQ   +  DGPPELLFIH GHTAKISDFSWN  EPW ICSV+EDNI+QVWQMA+ +YND D + +V P
Sbjct:   20 EYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAV---PKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDP 420          
BLAST of Histone-binding protein RBBP4 vs. UniProt/SwissProt
Match: sp|Q3MHL3|RBBP4_BOVIN (Histone-binding protein RBBP4 OS=Bos taurus OX=9913 GN=RBBP4 PE=1 SV=3)

HSP 1 Score: 582.793 bits (1501), Expect = 0.000e+0
Identity = 269/404 (66.58%), Postives = 330/404 (81.68%), Query Frame = 1
Query:  163 DYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTERFDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARPF-GMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADIMYNDNDADSTVLP 1371
            +YKIWK++TPFLYD +M H LEWPSLTAQWLP + RP  KD+++HRL+LGTHTSDEQNHL+IAS+ +PND  +FDAS YD+E+ ++GGFG  +GK+EI + INHEGEVNRARYMPQN   +ATKTP++DVL+F+Y  HP++P    E  P+LRL+GH KEGYGLSWNP  +G++LSASDD TIC+WD +       EG  ++    F GH  VVEDV+WHL H  +FGSVADD+KLMIWD RS+NTSKP   VDAHTAEVNC++FNP+++ ++ TGSADKTVA+WD+RNL+LKLHSFE+H+DEIFQVQWSPHNETI ASSGTDRRL++WD SKIG EQ   +  DGPPELLFIH GHTAKISDFSWN  EPW ICSV+EDNI+QVWQMA+ +YND D + +V P
Sbjct:   20 EYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAV---PKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDP 420          
BLAST of Histone-binding protein RBBP4 vs. UniProt/SwissProt
Match: sp|Q6INH0|RBP4B_XENLA (Histone-binding protein RBBP4-B OS=Xenopus laevis OX=8355 GN=rbbp4-b PE=1 SV=3)

HSP 1 Score: 582.408 bits (1500), Expect = 0.000e+0
Identity = 269/404 (66.58%), Postives = 329/404 (81.44%), Query Frame = 1
Query:  163 DYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTERFDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARPF-GMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADIMYNDNDADSTVLP 1371
            +YKIWK++TPFLYD +M H LEWPSLTAQWLP + RP+ KD+++HRL+LGTHTSDEQNHL+IAS+ +PND  +FDAS YD+E+ ++GGFG  +GK+EI + INHEGEVNRARYMPQN   +ATKTP+ DVL+F+Y  HP++P    E  P+LRL+GH KEGYGLSWNP  +G +LSASDD TIC+WD +       EG  ++    F GH  VVEDV+WHL H  +FGSVADD+KLMIWD RS+NTSKP   VDAHTAEVNC++FNP+++ ++ TGSADKTVA+WD+RNL+LKLHSFE+H+DEIFQVQWSPHNETI ASSGTDRRL++WD SKIG EQ   +  DGPPELLFIH GHTAKISDFSWN  EPW ICSV+EDNI+QVWQMA+ +YND D + +V P
Sbjct:   20 EYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPDGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSCDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGNLLSASDDHTICLWDISAV---PKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDTEGSVDP 420          
BLAST of Histone-binding protein RBBP4 vs. UniProt/SwissProt
Match: sp|Q5M7K4|RBBP4_XENTR (Histone-binding protein RBBP4 OS=Xenopus tropicalis OX=8364 GN=rbbp4 PE=2 SV=3)

HSP 1 Score: 581.637 bits (1498), Expect = 0.000e+0
Identity = 269/404 (66.58%), Postives = 329/404 (81.44%), Query Frame = 1
Query:  163 DYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTERFDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARPF-GMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADIMYNDNDADSTVLP 1371
            +YKIWK++TPFLYD +M H LEWPSLTAQWLP + RP+ KD+++HRL+LGTHTSDEQNHL+IAS+ +PND  +FDAS YD+E+ ++GGFG  +GK+EI + INHEGEVNRARYMPQN   +ATKTP++DVL+F+Y  HP++P    E  P+LRL+GH KEGYGLSWNP  +G +LSASDD TIC+WD +       EG  ++    F GH  VVEDV+WHL H  +FGSVADD+KLMIWD RS+NTSKP   VDAHTAEVNC++FNP+++ ++ TGSADKTVA+WD+RNL+LKLHSFE+H+DEIFQVQWSPHNETI ASSGTDRRL++WD SKIG EQ   +  DGPPELLFIH GHTAKISDFSWN  EPW ICSV+EDNI+QVWQMA+ +YND D +  V P
Sbjct:   20 EYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPDGKDFSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGNLLSASDDHTICLWDISAV---PKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDTEGGVDP 420          
BLAST of Histone-binding protein RBBP4 vs. TrEMBL
Match: A0A556TPH8 (Histone-binding protein RBBP4 OS=Bagarius yarrelli OX=175774 GN=Baya_3521 PE=4 SV=1)

HSP 1 Score: 591.652 bits (1524), Expect = 0.000e+0
Identity = 272/402 (67.66%), Postives = 328/402 (81.59%), Query Frame = 1
Query:  163 DYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTERFDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARPF-GMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADIMYNDNDADSTV 1365
            +YKIWK++TPFLYD +M H LEWPSLTAQWLP + RP  KDY+VHRL+LGTHTSDEQNHL+IAS+ +PND T+FDAS YD+E+ ++GGFG  +GK+EI + INHEGEVNRARYMPQN   +ATKTPT+DVL+F+Y  HP++P    E  P+LRL+GH KEGYGLSWNP  +G +LSASDD TIC+WD +T      EG  ++    F GH  VVEDV+WHL H  +FGSVADD+KLMIWD RS+NTSKP   VDAHTAEVNC++FNP+++ ++ TGSADKTVA+WD+RNL+LKLHSFE+H+DEIFQVQWSPHNETI ASSGTDRRL++WD SKIG EQ   +  DGPPELLFIH GHTAKISDFSWN  EPW ICSV+EDNI+QVWQMA+ +YND D +   
Sbjct:  468 EYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDYSVHRLVLGTHTSDEQNHLVIASVQLPNDDTQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPTSDVLVFDYTKHPSKPDPSGECTPDLRLRGHQKEGYGLSWNPNLSGCLLSASDDHTICLWDISTV---PKEGKIVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHAVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGAA 866          
BLAST of Histone-binding protein RBBP4 vs. TrEMBL
Match: T1JFL0 (WD_REPEATS_REGION domain-containing protein OS=Strigamia maritima OX=126957 PE=4 SV=1)

HSP 1 Score: 589.341 bits (1518), Expect = 0.000e+0
Identity = 271/400 (67.75%), Postives = 328/400 (82.00%), Query Frame = 1
Query:  163 DYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTERFDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARPF-GMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADIMYNDNDADS 1359
            +YKIWK++TPFLYD +M H LEWPSLTAQWLP + RP  KDY+VHRLILGTHTSDEQNHLLIAS+ +P++  +FDAS YD E+ ++GGFG  +GK+EI + INHEGEVNRAR+MPQN   +ATKTP++DVL+F+Y  HP++P    E +P+LRL+GH KEGYGLSWNP   G++LSASDD TIC+WD N+A     E   I+    F GH  VVEDVAWHL H  +FGSVADD+KLMIWD RS+NTSKP   VDAHTAEVNC++FNP+++ ++ TGSADKTVA+WD+RNL+LKLHSFE+H+DEIFQVQWSPHNETI ASSGTDRRLH+WD SKIG EQ   +  DGPPELLFIH GHTAKISDFSWN  EPW ICSV+EDNI+QVWQMA+ +YND + ++
Sbjct:  457 EYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDYSVHRLILGTHTSDEQNHLLIASVQLPSEDAQFDASHYDNEKGEFGGFGSVSGKIEIEIKINHEGEVNRARFMPQNPCVIATKTPSSDVLVFDYTKHPSKPDPSGECQPDLRLRGHQKEGYGLSWNPNLNGHLLSASDDHTICLWDINSA---PRENRVIDAKTVFTGHTAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHTVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEEPET 853          
BLAST of Histone-binding protein RBBP4 vs. TrEMBL
Match: C1LIR1 (Putative histone-binding protein Caf1 OS=Schistosoma japonicum OX=6182 GN=EWB00_006314 PE=2 SV=1)

HSP 1 Score: 589.341 bits (1518), Expect = 0.000e+0
Identity = 276/397 (69.52%), Postives = 335/397 (84.38%), Query Frame = 1
Query:  163 DYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTERFDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPAR-PFGMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADIMYNDND 1350
            +YKIWKR+TPFLYD LM H LEWPSLTAQWLP+++R   +DY+VHRLILGTHTSDEQNHLLI ++++PNDQ EFDASAYD+ER D+GGF FP+GKLEI+M INHEGEVNRAR+MPQN   +ATKTP+ DVLIFNY  HP + P     +P+LRLKGH KEGYGLSWN    G++LSASDD+TIC+WD N A     +G  ++ +  F GH++VVEDV+WHL HG++FGSVADD KLM+WD R+ N +KP  +VDAHTAEVNC+AFNPF++ ++ TGSADKTVA+WD+RNL+LKLHSFE+H+DEIFQVQWSPHNETI ASSGTDRRLH+WD SKIG++Q   +  DGPPELLFIH GHTAKISDFSWN  +PWTICSV+EDNILQ+WQMA+ +YND++
Sbjct:   20 EYKIWKRNTPFLYDMLMSHCLEWPSLTAQWLPSVERTG-RDYSVHRLILGTHTSDEQNHLLIVTVHLPNDQAEFDASAYDSERGDFGGFFFPSGKLEISMKINHEGEVNRARFMPQNSDIIATKTPSGDVLIFNYPRHPPKTPSDRGCQPDLRLKGHQKEGYGLSWNVSLNGHLLSASDDQTICLWDVNAA---PLDGCDLDAMAIFTGHHSVVEDVSWHLFHGNIFGSVADDNKLMVWDTRTANRTKPQHQVDAHTAEVNCLAFNPFSEFIIATGSADKTVALWDLRNLRLKLHSFESHRDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGIDQTAEDADDGPPELLFIHAGHTAKISDFSWNINDPWTICSVSEDNILQIWQMAENIYNDDE 412          
BLAST of Histone-binding protein RBBP4 vs. TrEMBL
Match: A0A210PT87 (Histone-binding protein RBBP7 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT07913 PE=4 SV=1)

HSP 1 Score: 588.956 bits (1517), Expect = 0.000e+0
Identity = 276/400 (69.00%), Postives = 330/400 (82.50%), Query Frame = 1
Query:  163 DYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTERFDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARPF-GMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADIMYNDNDADS 1359
            +YKIWK++TPFLYD +M H LEWPSLTAQWLP + RP  KDY++HRLILGTHTSDEQNHLLIAS+ +PND  +FDAS YD+E+ ++GGFG  +GK+EI + INHEGEVNRARYMPQN   +ATKTP++DVL+F+Y  HP++P    E  PELRLKGH KEGYGLSWNP   G++LSASDD TIC+WD NTA     EG  I+    F GH +VVEDVAWHL H  +FGSVADD+KLMIWD RS++T+KP   VDAHTAEVNC++FNP+++ ++ TGSADKTVA+WD+RNL+LKLHSFE+H+DEIFQVQWSPHNETI ASSGTDRRLH+WD SKIG EQ   +  DGPPELLFIH GHTAKISDFSWN  EPW ICSV+EDNI+QVWQMA+ +YND + D+
Sbjct:   22 EYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDYSLHRLILGTHTSDEQNHLLIASVQLPNDNAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCVLATKTPSSDVLVFDYTKHPSKPDPSGECTPELRLKGHQKEGYGLSWNPNLNGHLLSASDDHTICLWDINTA---PKEGRVIDAHTIFTGHTSVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNDTTKPSHTVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEEPDT 418          
BLAST of Histone-binding protein RBBP4 vs. TrEMBL
Match: A0A504Z751 (Histone-binding protein RBBP4 OS=Fasciola gigantica OX=46835 GN=FGIG_03044 PE=4 SV=1)

HSP 1 Score: 588.956 bits (1517), Expect = 0.000e+0
Identity = 278/399 (69.67%), Postives = 333/399 (83.46%), Query Frame = 1
Query:  163 DYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTERFDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARPF-GMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADIMYNDNDAD 1356
            +YKIWKR+TPFLYD LM H LEWPSLTAQWLP ++R  D D ++HRLILGTHTSDEQNHLLI ++++PNDQ EFDASAYD+ER DYGGF FP+GKLEI+M INHEGEVNRARYMPQN   +ATKTP+ DVLIF Y  HPA+       +P+LRLKGH KEGYGLSWN    G++LSASDD+TIC+WD N    S  +G  ++ +  F GH++VVEDVAWHL HG +FGSVADD KLM+WD RS+N +KP  +VDAHTAEVNC+AFNPF++ ++ TGSADKTVA+WD+RNL+LKLHSFE+H+DEIFQVQWSPHNETI ASSGTDRRLH+WD SKIG++Q   +  DGPPELLFIH GHTAKISDFSWN  +PWTICSV+EDNILQ+WQMA+ +YND++ +
Sbjct:   44 EYKIWKRNTPFLYDMLMSHCLEWPSLTAQWLPGVER-TDGDVSIHRLILGTHTSDEQNHLLIVTVHLPNDQAEFDASAYDSERGDYGGFYFPSGKLEISMKINHEGEVNRARYMPQNPDIIATKTPSGDVLIFEYPRHPAKSSPDRGCQPDLRLKGHQKEGYGLSWNASIHGHLLSASDDQTICLWDINA---SPLDGRCLDAMAIFTGHHSVVEDVAWHLFHGHIFGSVADDNKLMVWDTRSNNRNKPQHQVDAHTAEVNCLAFNPFSEFIIATGSADKTVALWDLRNLRLKLHSFESHRDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGVDQTAEDAEDGPPELLFIHAGHTAKISDFSWNANDPWTICSVSEDNILQIWQMAENIYNDDEIE 438          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Cavefish
Match: rbbp4 (RB binding protein 4, chromatin remodeling factor [Source:NCBI gene;Acc:103039809])

HSP 1 Score: 582.408 bits (1500), Expect = 0.000e+0
Identity = 271/402 (67.41%), Postives = 327/402 (81.34%), Query Frame = 1
Query:  163 DYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTERFDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARPF-GMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADIMYNDNDADSTV 1365
            +YKIWK++TPFLYD +M H LEWPSLTAQWLP + RP  KDY+VHRL+LGTHTSDEQNHL+IAS+ +PND  +FDAS YD+E+ ++GGFG  +GK+EI + INHEGEVNRARYMPQN   +ATKTPT+DVL+F+Y  HP++P    E  P+LRL+GH KEGYGLSWNP  +G +LSASDD TIC+WD +T      EG  ++    F GH  VVEDV+WHL H  +FGSVADD+KLMIWD RS+NTSKP   VDAHTAEVNC++FNP+++ ++ TGSADKTVA+WD+RNL+LKLHSFE+H+DEIFQVQWSPHNETI ASSGTDRRL++WD SKIG EQ   +  DGPPELLFIH GHTAKISDFSWN  EPW ICSV+EDNI+QVWQMA+ +YND D +   
Sbjct:   20 EYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDYSVHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPTSDVLVFDYTKHPSKPDPSGECTPDLRLRGHQKEGYGLSWNPNLSGCLLSASDDHTICLWDISTV---PKEGKIVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHAVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGAA 418          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Cavefish
Match: rbb4l (histone-binding protein RBBP7 [Source:NCBI gene;Acc:103023991])

HSP 1 Score: 577.4 bits (1487), Expect = 0.000e+0
Identity = 269/401 (67.08%), Postives = 327/401 (81.55%), Query Frame = 1
Query:  163 DYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTER-FDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARPF-GMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADIMYNDNDADS 1359
            +YKIWK++TPFLYD +M H LEWPSLT QWLP ++RP  KDY VHRL+LGTHTSDEQNHL+IAS+ +PND  +FDAS YD+E+  ++GGFG  +GK+EI + INHEGEVNRARYMPQN   +ATKTPT+DVL+F+Y  HP++P    E  P+LRL+GH KEGYGLSWNP  +G +LSASDD TIC+WD +    S  EG  ++    F GH  VVEDV+WHL H  +FGSVADD+KLMIWD RS+NT+KP   VDAHTAEVNC++FNP+++ ++ TGSADKTVA+WD+RNL+LKLHSFE+H+DEIFQVQWSPHNETI ASSGTDRRL++WD SKIG EQ   +  DGPPELLFIH GHTAKISDFSWN  EPW ICSV+EDNI+QVWQMA+ +YND + D+
Sbjct:   19 EYKIWKKNTPFLYDLVMTHALEWPSLTVQWLPDVNRPEGKDYAVHRLVLGTHTSDEQNHLVIASVQIPNDDAQFDASHYDSEKGAEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPTSDVLVFDYTKHPSKPDPSGECSPDLRLRGHQKEGYGLSWNPNLSGNLLSASDDHTICLWDIS---GSPKEGKIVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTAKPSHAVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEEPDT 416          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Cavefish
Match: grwd1 (glutamate rich WD repeat containing 1 [Source:NCBI gene;Acc:103032799])

HSP 1 Score: 121.709 bits (304), Expect = 9.503e-30
Identity = 80/293 (27.30%), Postives = 142/293 (48.46%), Query Frame = 1
Query:  463 MINHEGEVNRARYMPQNE-TFVATKTPTADVLIFNY-----AIHPARPFGM------EVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQ--LKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCS--KIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVA 1293
            M+ H G +NR R   + E +  A  +    V IF+      A++ +           E+ P     GH+ EG+ + W+P   G ++S    K I +W+    G S     +      F  H   VED+ W      VF S + D+ + +WDIR+   S   +  +AH+++VN I++N   +  +++G  D  + +WD+R  +    + SF+ H   +  V+W+P + ++FA++G D  +  WD S     + ++  +  D PP+LLF+H G T ++ +  W+   P T+ S A
Sbjct:  159 MVPHYGGINRVRVTRRGEQSLAAVWSEKGQVEIFDLRPQLEAVYNSSVMAAFIKQNKEITPLFSFSGHMAEGFAVDWSPKVPGRLVSGDCKKNIHVWEPREGGVS-----WQIDQRPFSSHTKSVEDLQWSPTEATVFASCSVDQSIRVWDIRAPPNSMLSVN-EAHSSDVNVISWN-RTEPFLLSGGDDGLLKVWDLRQFKSGRAVASFKQHSAPVTSVEWNPVDSSVFAAAGADDVVSQWDLSVESCDMGERANDVKDLPPQLLFLHQGQT-EVKELHWHPQLPGTLISTA 443          

HSP 2 Score: 69.3218 bits (168), Expect = 2.368e-12
Identity = 40/161 (24.84%), Postives = 77/161 (47.83%), Query Frame = 1
Query:  856 DKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMR----NLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPP-ELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQM 1323
            +  +M   I+ +    P+     H AE   + ++P     +V+G   K + +W+ R    + Q+    F +H   +  +QWSP   T+FAS   D+ + +WD             +  PP  +L ++  H++ ++  SWN+ EP+ + S  +D +L+VW +
Sbjct:  203 NSSVMAAFIKQNKEITPLFSFSGHMAEGFAVDWSPKVPGRLVSGDCKKNIHVWEPREGGVSWQIDQRPFSSHTKSVEDLQWSPTEATVFASCSVDQSIRVWD-------------IRAPPNSMLSVNEAHSSDVNVISWNRTEPF-LLSGGDDGLLKVWDL 349          

HSP 3 Score: 53.9138 bits (128), Expect = 1.933e-7
Identity = 41/192 (21.35%), Postives = 76/192 (39.58%), Query Frame = 1
Query:  760 INPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIE--VDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSF-EAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMA 1326
            I PL  F GH      V W  +      S    K + +W+ R    S  + +    +HT  V  + ++P    +  + S D+++ +WD+R     + S  EAH  ++  + W+   E    S G D  L +WD  +    +    F             H+A ++   WN  +     +   D+++  W ++
Sbjct:  217 ITPLFSFSGHMAEGFAVDWSPKVPGRLVSGDCKKNIHVWEPREGGVSWQIDQRPFSSHTKSVEDLQWSPTEATVFASCSVDQSIRVWDIRAPPNSMLSVNEAHSSDVNVISWN-RTEPFLLSGGDDGLLKVWDLRQFKSGRAVASFKQ-----------HSAPVTSVEWNPVDSSVFAAAGADDVVSQWDLS 396          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Cavefish
Match: pex7 (peroxisomal biogenesis factor 7 [Source:NCBI gene;Acc:103024267])

HSP 1 Score: 80.8777 bits (198), Expect = 1.832e-16
Identity = 57/224 (25.45%), Postives = 101/224 (45.09%), Query Frame = 1
Query:  607 PELRLKGHLKEGYGLSWNPIKA-GYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSK----IGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQ 1263
            P   LK H +E Y + W+  +    ++S S D T  +WD                +    GH  V+    W       F S + D  L +WD++S +     + + AH  E+    +  ++Q+++VTGS D ++ +WD+R ++  +    +H   I +V++SP  +T+ AS   D  +  WD S+    +   +   EFV G    L I      ++ D SW++
Sbjct:   95 PIQVLKEHTQEVYSVDWSQTRGENLVVSGSWDHTAKVWDPER----------FQSVCTLQGHEGVLYSTIWSPHISSCFASASGDGTLRVWDVKSGSCR---MAIPAHKTEILSCDWCKYDQNILVTGSVDCSLCVWDLRTVRQPVAQMLSHTYAIRRVKFSPFYKTVLASCSYDFTVRFWDYSRSPMLLDAMEHHSEFVCGLDFNLHI----PNQVVDCSWDE 301          

HSP 2 Score: 65.855 bits (159), Expect = 1.682e-11
Identity = 49/189 (25.93%), Postives = 84/189 (44.44%), Query Frame = 1
Query:  769 LMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPF-NQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADI 1332
            L++    N  + DV W   +  V  +   D  L IWD  + N   P+  +  HT EV  + ++    ++LVV+GS D T  +WD    Q  + + + H+  ++   WSPH  + FAS+  D  L +WD  K G  +  +             P H  +I    W +++   + + + D  L VW +  +
Sbjct:   52 LLRSFDWNDGLFDVTWSESNEHVLVTGGGDGSLQIWD--TANPKGPIQVLKEHTQEVYSVDWSQTRGENLVVSGSWDHTAKVWDPERFQ-SVCTLQGHEGVLYSTIWSPHISSCFASASGDGTLRVWD-VKSGSCRMAI-------------PAHKTEILSCDWCKYDQNILVTGSVDCSLCVWDLRTV 223          

HSP 3 Score: 62.7734 bits (151), Expect = 1.960e-10
Identity = 51/224 (22.77%), Postives = 98/224 (43.75%), Query Frame = 1
Query:  430 GFPNGKLEITMMINHEGEVNRARYMPQNETFVA-TKTPTADVLIFNYAIHPARPFGME-VKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPH 1095
            G  +G L+I    N +G +   +   Q    V  ++T   ++++     H A+ +  E  +    L+GH    Y   W+P  +    SAS D T+ +WD  +           +  M    H T +    W     ++  + + D  L +WD+R+    +PV ++ +HT  +  + F+PF + ++ + S D TV  WD     + L + E H + +  + ++ H
Sbjct:   78 GGGDGSLQIWDTANPKGPIQVLKEHTQEVYSVDWSQTRGENLVVSGSWDHTAKVWDPERFQSVCTLQGHEGVLYSTIWSPHISSCFASASGDGTLRVWDVKSG----------SCRMAIPAHKTEILSCDWCKYDQNILVTGSVDCSLCVWDLRT--VRQPVAQMLSHTYAIRRVKFSPFYKTVLASCSYDFTVRFWDYSRSPMLLDAMEHHSEFVCGLDFNLH 289          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Cavefish
Match: taf5 (TATA-box binding protein associated factor 5 [Source:NCBI gene;Acc:103038729])

HSP 1 Score: 80.4925 bits (197), Expect = 1.143e-15
Identity = 67/233 (28.76%), Postives = 110/233 (47.21%), Query Frame = 1
Query:  619 LKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVW 1317
            L GH    YG+S++P +  Y+LS+S+D TI +W   T             L+ + GHN  V D  +   +G  F S   D+   +W   + +  +P+     H A++ C  F+P N + V TGSAD+T+ +WD+ N    +     H+  I  + +SP N    AS  TD R+ +WD    GL   E++             GHT  I    +++ +   + S + DN +++W
Sbjct:  467 LYGHSGPVYGVSFSPDR-NYLLSSSEDGTIRLWSLQT----------FTCLVAYKGHNYPVWDTQFS-PYGYYFVSGGHDRVARLW---ATDHYQPLRMFAGHLADITCTRFHP-NSNYVATGSADRTIRLWDVLNGHC-VRVLTGHKGPIHSLAFSP-NGKYLASGSTDGRVLLWDIGH-GLMIGELK-------------GHTDTIYALRFSR-DGEILASGSMDNTVRLW 666          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008002.1 (pep scaffold:Pmarinus_7.0:GL477852:421:9512:1 gene:ENSPMAG00000007189.1 transcript:ENSPMAT00000008002.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 575.089 bits (1481), Expect = 0.000e+0
Identity = 266/402 (66.17%), Postives = 325/402 (80.85%), Query Frame = 1
Query:  163 DYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTERFDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARPF-GMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADIMYNDNDADSTV 1365
            +YKIWK++TPFLYD +M H LEWPSLTAQWLP + RP  KDY+VHRLILGTHTSDEQNHL+IAS+ +PND  +FDAS YD+E+ ++GGFG    K+E+ + INHEGEVNRARYMPQN   +ATKTPT++VL+F+Y  HP+ P    E  P+LRL+GH KEGYGLSWNP  +G++LSASDD T+C+WD +    +  EG  +     F GH  VVEDV+WHL H  +FGSVADD+KLMIWD RS+NTSKP   VDAHTAEVNC++FNP+++ ++ TGSAD+TVA+WD+RNL+LKLHSFE+H+DEIFQVQWSPHNETI ASSGTDRRL++WD SKIG EQ   +  DGPPELLF+H GHTAKISDFSWN  EPW ICSV+EDNI+QVWQMA+ +YND D +  V
Sbjct:   20 EYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDYSVHRLILGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVGTKIEVEIKINHEGEVNRARYMPQNPYIIATKTPTSEVLVFDYTKHPSVPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTVCLWDIS---GTPREGKVVEAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADQTVALWDLRNLKLKLHSFESHRDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQAAEDVEDGPPELLFVHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDTEPGV 418          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Sea Lamprey
Match: pex7 (peroxisomal biogenesis factor 7 [Source:ZFIN;Acc:ZDB-GENE-050320-105])

HSP 1 Score: 88.9669 bits (219), Expect = 8.241e-20
Identity = 55/186 (29.57%), Postives = 93/186 (50.00%), Query Frame = 1
Query:  604 KPE--LRL-KGHLKEGYGLSWNPIKA-GYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWD 1149
            +PE  LR+ +GH KE Y + W+  +    ++S S D T  +WD            +++ L ++ GH  VV    W       F S + D+ L +WD++S + ++ VI   AH  EV    +  ++Q+L+V+ + D  +  WD+RN++  + S   H   I +V+ SP   T+ AS   D  +  WD
Sbjct:   99 QPEGPLRVYQGHTKEVYSVDWSQTRGENLVVSGSWDHTARVWDPA----------FLSSLAEYRGHEGVVYSTVWSPHIPSCFASASGDQTLRVWDVKSPHAARIVIP--AHQEEVLSCDWCKYDQNLLVSAAVDCGIRGWDLRNIRQPVFSLLGHSYAIRRVRCSPFQPTVLASCSYDFSVRFWD 272          

HSP 2 Score: 69.3218 bits (168), Expect = 3.219e-13
Identity = 59/235 (25.11%), Postives = 104/235 (44.26%), Query Frame = 1
Query:  634 KEGYGLSWNPI-KAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPF-NQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADI 1332
            + GY + ++P   A    +AS    I    +    + + EG  I  L +F  ++++  DVAW   +  V  + + D  L +WD  +     P+     HT EV  + ++    ++LVV+GS D T  +WD   L   L  +  H+  ++   WSPH  + FAS+  D+ L +WD             V  P     + P H  ++    W +++   + S A D  ++ W + +I
Sbjct:   17 RHGYSVKFSPFFPAQLACAASQYFGIAGSGSLLILHQTPEG--ITELRRFEWNDSLF-DVAWSEDNEHVLVTGSGDGSLQLWD--ASQPEGPLRVYQGHTKEVYSVDWSQTRGENLVVSGSWDHTARVWDPAFLS-SLAEYRGHEGVVYSTVWSPHIPSCFASASGDQTLRVWD-------------VKSPHAARIVIPAHQEEVLSCDWCKYDQNLLVSAAVDCGIRGWDLRNI 232          

HSP 3 Score: 59.6918 bits (143), Expect = 3.735e-10
Identity = 50/226 (22.12%), Postives = 93/226 (41.15%), Query Frame = 1
Query:  643 YGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGD-VFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVW 1317
            + ++W+      +++ S D ++ +WD      S  EGP    L  + GH   V  V W    G+ +  S + D    +WD    ++   + E   H   V    ++P       + S D+T+ +WD+++         AHQ+E+    W  +++ +  S+  D  +  WD   I   +Q V          F   GH+  I     + F+P  + S + D  ++ W
Sbjct:   71 FDVAWSEDNEHVLVTGSGDGSLQLWDA-----SQPEGP----LRVYQGHTKEVYSVDWSQTRGENLVVSGSWDHTARVWDPAFLSS---LAEYRGHEGVVYSTVWSPHIPSCFASASGDQTLRVWDVKSPHAARIVIPAHQEEVLSCDWCKYDQNLLVSAAVDCGIRGWDLRNI---RQPV----------FSLLGHSYAIRRVRCSPFQPTVLASCSYDFSVRFW 271          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Sea Lamprey
Match: wdr12 (WD repeat domain 12 [Source:NCBI gene;Acc:321652])

HSP 1 Score: 77.7962 bits (190), Expect = 8.260e-16
Identity = 51/183 (27.87%), Postives = 92/183 (50.27%), Query Frame = 1
Query:  589 FGMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRL 1137
             G+   P + + GH +    + W+  +   I SAS D TI +WD  T    +S G   N ++  I ++ + + +A          S + D+ + IWD RS   S   + + +HT  V  + ++P N   +++G+ DK V +WD R+ +  L+   AH+++I  V+W+ +N  +  S G D +L
Sbjct:  244 LGLTRTPIMTISGHNEAVSSVLWS--EDLEICSASWDHTIRLWDAETGEQKASLGG--NKVVNSISYSPLCKRIA----------SGSTDRHIRIWDPRSKGGSLVQLSLTSHTGWVTSVKWSPHNDKQLISGAIDKMVKLWDTRSPKAPLYDMAAHEEKILCVEWAENN--MLLSGGADNKL 410          

HSP 2 Score: 56.9954 bits (136), Expect = 3.983e-9
Identity = 71/333 (21.32%), Postives = 120/333 (36.04%), Query Frame = 1
Query:  412 FDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTAD--VLIFNYAIHPARPFGMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMW--------DTNTAGNSSSE---------GPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNL--QLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADIMYNDN 1347
            +D  G  +      +T +  H   V    ++ + E      T + D   +I+ + +   +      KP    +GH      ++ N     +  S S DK I +W        D    G+S+           G    P+M   GHN  V  V W         S + D  + +WD  +      +         VN I+++P  +  + +GS D+ + +WD R+    L   S  +H   +  V+WSPHN+    S   D+ + +WD                P   L+    H  KI    W +     + S   DN L  +  +D +  D 
Sbjct:  119 YDKTGRVWTTDGKPLTTLSGHTEVVKDVEWINKGEESCLLLTASQDQTAIIWEWNVRRNK-----AKPRHCCRGHAGSVEAVAVNNTYTKF-CSGSWDKMIKIWSAVPNDQEDVVEEGSSARPKKKQKMEKLGLTRTPIMTISGHNEAVSSVLWS--EDLEICSASWDHTIRLWDAETGEQKASL----GGNKVVNSISYSPLCKR-IASGSTDRHIRIWDPRSKGGSLVQLSLTSHTGWVTSVKWSPHNDKQLISGAIDKMVKLWD-------------TRSPKAPLYDMAAHEEKILCVEWAENN--MLLSGGADNKLVTFNYSDTVTGDG 423          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Sea Lamprey
Match: sec31b (SEC31 homolog B, COPII coat complex component [Source:ZFIN;Acc:ZDB-GENE-060418-2])

HSP 1 Score: 73.559 bits (179), Expect = 4.153e-14
Identity = 45/173 (26.01%), Postives = 79/173 (45.66%), Query Frame = 1
Query:  646 GLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNC--IAFNP-FNQHLVVTGSADK--TVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWD 1149
             L +NP +A  + S ++D  I +WD N  G   + G    P    +        VAW+ +   +  S +   K ++WD+R +   +P+I+V  H+  + C  +A++P     LVV+   D+   + MWD+R     L   E+H   I  + W   +  +  S   D R+  W+
Sbjct:  125 ALDFNPFQANLLASGANDSEIYIWDLNNFGTPMTPGSKSQPAEDVVC-------VAWNRQVQHILASASPSGKAVVWDLRKN---EPIIKVSDHSNRMRCSGMAWHPDVATQLVVSSEDDRMPVIQMWDLRFATSPLKVLESHSRGILAIAWCQADPELLLSCAKDNRILCWN 287          

HSP 2 Score: 53.1434 bits (126), Expect = 9.191e-8
Identity = 53/249 (21.29%), Postives = 105/249 (42.17%), Query Frame = 1
Query:  610 ELRLKGHL---KEGYGLSWN-PI----KAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIG----HNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMR-NLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVW 1317
            +L+L+G L      + L W  P+     AG ++  SD+  + ++  +   +  ++          IG    H   V  + ++    ++  S A+D ++ IWD+ +  T            +V C+A+N   QH++ + S      +WD+R N  +   S  +++     + W P   T    S  D R+ +       ++  ++ F   P ++L     H+  I   +W Q +P  + S A+DN +  W
Sbjct:   56 DLKLRGTLTTENRYHKLVWGAPLPGEEGAGVVVGGSDNGVLILYAADKVLSGDADA--------IIGENDRHTGPVRALDFNPFQANLLASGANDSEIYIWDLNNFGTPMTPGSKSQPAEDVVCVAWNRQVQHILASASPSGKAVVWDLRKNEPIIKVSDHSNRMRCSGMAWHPDVATQLVVSSEDDRMPV-------IQMWDLRFATSPLKVL---ESHSRGILAIAWCQADPELLLSCAKDNRILCW 286          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002506.1 (pep scaffold:Pmarinus_7.0:GL479076:26529:32136:-1 gene:ENSPMAG00000002224.1 transcript:ENSPMAT00000002506.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.3958 bits (163), Expect = 1.007e-12
Identity = 55/196 (28.06%), Postives = 92/196 (46.94%), Query Frame = 1
Query:  610 ELRLKGHLKEGYG----LSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNET-IFASSGTDRRLHIWDCSKIGLEQQEV 1182
            ++ L+G LK   G    ++  P     ILSAS DKT+ MW       +  E  Y  P     GH   V DV      G    S + D  L +WD+ +  T++  +    HT +V  +AF+  N+  +V+GS DKT+ +W+   +       + H + +  V++SP+N   I  S G D+ + +W+ +   L+   +
Sbjct:    4 QMTLRGTLKGHNGWVTQIATTPQFPDMILSASRDKTLIMWKL-----TRDETNYGIPQRSLHGHGHFVSDVVIS-SDGQFALSGSWDGTLRLWDLTTGTTTRRFV---GHTKDVLSVAFSADNRQ-IVSGSRDKTIKLWNTLGVCKYTIQEDGHTEWVSCVRFSPNNNNPIIVSCGWDKLVKVWNLTNCKLKTNHI 189          

HSP 2 Score: 49.6766 bits (117), Expect = 7.687e-7
Identity = 47/192 (24.48%), Postives = 83/192 (43.23%), Query Frame = 1
Query:  784 GHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSK--PVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKIS--DFSWNQFEPWTICSVAEDNILQVWQMADIMYNDN 1347
            GHN  V  +A   +  D+  S + DK L++W +  D T+   P   +  H   V+ +  +   Q   ++GS D T+ +WD+         F  H  ++  V +S  N  I + S  D+ + +W+   +G+ +  ++             GHT  +S   FS N   P  I S   D +++VW + +     N
Sbjct:   13 GHNGWVTQIATTPQFPDMILSASRDKTLIMWKLTRDETNYGIPQRSLHGHGHFVSDVVISSDGQ-FALSGSWDGTLRLWDLTT-GTTTRRFVGHTKDVLSVAFSADNRQIVSGS-RDKTIKLWN--TLGVCKYTIQ-----------EDGHTEWVSCVRFSPNNNNP-IIVSCGWDKLVKVWNLTNCKLKTN 187          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Yeast
Match: HAT2 (Subunit of the Hat1p-Hat2p histone acetyltransferase complex; required for high affinity binding of the complex to free histone H4, thereby enhancing Hat1p activity; similar to human RbAp46 and 48; has a role in telomeric silencing [Source:SGD;Acc:S000000782])

HSP 1 Score: 242.276 bits (617), Expect = 4.375e-76
Identity = 133/389 (34.19%), Postives = 209/389 (53.73%), Query Frame = 1
Query:  163 DYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTS-DEQNHLLIASINMPNDQTEFDASAYDTERFDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARPFGMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMA 1326
            +Y +WK + P +YD +    L WPSLT QWLPT  +  D  +    LI+GTHTS +E+N+L  A IN+P +    +    +           P   + IT    HE E+ RARYMPQ+   VAT      V ++      +R  G++      LK H   GY LS++ +  G +LS SDD T+ +W+  + G+ +      N L     H+ ++ D  WH  + D+FG+V++D  L I D+R++NT+   I+        N +AF+  + +L+     D  V ++D+RN++  LH    H+D +  +++S H + +  SSG+D RL +WD  +IG EQ   +  DG PEL+ +H GH + ++DF  N   PW + S  E+NILQVW+ +
Sbjct:   13 EYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELIIGTHTSGEEENYLKFAEINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEEITRARYMPQDPNIVATINGQGTVFLY------SRSEGLQST----LKFHKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDL-----HSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRANNTT---IDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHVDGVVVSSGSDNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENILQVWKCS 383          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Yeast
Match: MSI1 (Subunit of chromatin assembly factor I (CAF-1); chromatin assembly by CAF-1 affects multiple processes including silencing at telomeres, mating type loci, and rDNA; maintenance of kinetochore structure; deactivation of DNA damage checkpoint after DNA repair; chromatin dynamics during transcription; and repression of divergent noncoding transcription; Msi1p localizes to nucleus and cytoplasm and independently regulates the RAS/cAMP pathway via sequestration of Npr1p kinase [Source:SGD;Acc:S000000399])

HSP 1 Score: 156.377 bits (394), Expect = 2.916e-43
Identity = 110/416 (26.44%), Postives = 190/416 (45.67%), Query Frame = 1
Query:  166 YKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSD---EQNHLLIASINMPNDQTEFDASAYDTERFDY---GGFGFPNGKL--EITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPA--------------RPFG-----MEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYIN-PLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGT-DRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMA 1326
            Y  WK++T  LYD L  +  +WPSLT Q+ P +D  +D+    HR++L + TS    E   + I+ I+          + +D +  ++       FP+  L  +I++   + GE NRARY+PQN   +A  +    + IF+   H +              + FG      +V+        + E   L+WN  +   +LS+  +  + +WD       S E P I+ PL+      T V DV W   H  +F +  +   + + D+R+    K     + H   VN   FN  N  ++ +  ++  + +WD+RN+     +   H   +  ++WSP+ +T+ A++G  D  + +WD S                E +F H GH   ++D SW+  +PW +CSVA DN + +W+ A
Sbjct:   23 YSHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTSDE----HRILLSSFTSSQKPEDETIYISKISTLGHIKWSSLNNFDMDEMEFKPENSTRFPSKHLVNDISIFFPN-GECNRARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFETKLFGSHGVIQDVEAMDTSSADINEATSLAWNLQQEALLLSSHSNGQVQVWDIKQY---SHENPIIDLPLVSINSDGTAVNDVTWMPTHDSLFAACTEGNAVSLLDLRT-KKEKLQSNREKHDGGVNSCRFNYKNSLILASADSNGRLNLWDIRNMNKSPIATMEHGTSVSTLEWSPNFDTVLATAGQEDGLVKLWDTS--------------CEETIFTHGGHMLGVNDISWDAHDPWLMCSVANDNSVHIWKPA 415          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Yeast
Match: RRB1 (Specific chaperone for ribosomal protein Rpl3p; binds to nascent Rpl3p during translation; essential gene [Source:SGD;Acc:S000004738])

HSP 1 Score: 101.293 bits (251), Expect = 1.518e-23
Identity = 83/312 (26.60%), Postives = 140/312 (44.87%), Query Frame = 1
Query:  484 VNRARYMP----QNETFVATKTPTADVLIFNYAIHPARPF---GMEV-----KPELRLKGHLK-EGYGLSWNP-IKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLK-------LHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEV--------EFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADI 1332
             NR +  P      E   AT +   DV I+N A   ++ F   G ++     +P   +K H   EGYGL W+P IK G +LS      I     +T+   + + P+       + +N  +ED+ W      VF +   D  + IWD RS    KP I V A   +VN I+++    +L+ +G  + T  +WD+R            +  ++ H+  I  + ++P +E+I A    D  + +WD S +  + +E+        E  + PP+LLF+H     ++ D  W++  P  + S   D  L VW+   +
Sbjct:  212 TNRLKVSPFAISNQEVLTATMSENGDVYIYNLAPQ-SKAFSTPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLIKTGALLSGDCSGQIYFTQRHTSRWVTDKQPFT------VSNNKSIEDIQWSRTESTVFATAGCDGYIRIWDTRS-KKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSNADAVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLS-VEADDEEIKQQAAETKELQEIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWKTISV 511          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Yeast
Match: PRP46 (Member of the NineTeen Complex (NTC); this complex contains Prp19p and stabilizes U6 snRNA in catalytic forms of the spliceosome containing U2, U5, and U6 snRNAs [Source:SGD;Acc:S000006072])

HSP 1 Score: 65.855 bits (159), Expect = 4.820e-12
Identity = 47/178 (26.40%), Postives = 86/178 (48.31%), Query Frame = 1
Query:  619 LKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDC 1152
            + GHL     ++ +P+   + ++ S+D T+ +WD  T    ++            GH   V DVA   RH  +F SV++DK +  WD+  +     + +   H + V  ++ +P    L+ T   D  + +WDMR  ++ + +   H+  I QVQ +P +  + +SS TD  + +WD 
Sbjct:  135 INGHLGWVRCVAIDPVDNEWFITGSNDTTMKVWDLATGKLKTT----------LAGHVMTVRDVAVSDRHPYLF-SVSEDKTVKCWDLEKNQI---IRDYYGHLSGVRTVSIHP-TLDLIATAGRDSVIKLWDMRT-RIPVITLVGHKGPINQVQCTPVDPQVVSSS-TDATVRLWDV 295          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Yeast
Match: YPL247C_mRNA (Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm and nucleus; similar to the petunia WD repeat protein an11; overexpression causes a cell cycle delay or arrest [Source:SGD;Acc:S000006168])

HSP 1 Score: 63.1586 bits (152), Expect = 3.283e-11
Identity = 49/216 (22.69%), Postives = 92/216 (42.59%), Query Frame = 1
Query:  574 HPARPFGMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSK-----PVIEVDAHTAEVNC-----------IAFNPFNQHLVVTGSADKT-VAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLE 1170
            HPA P   +   ++++ G         WN +    I+S+S D T  +WD  ++        Y+    Q I H++ V DV +  +   +F S   D  + ++D+RS   S      P   V   TA               +  +P++ +++ T +AD   + + DMRN +  + + + H   +  ++W P    +  S G D ++  WD +   +E
Sbjct:  227 HPANPAAAD---DMKVIGTFPPITSFDWNTVDTNLIISSSIDTTCIVWDLQSSH-------YVK--TQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPSSSVSGATAGTITPSSKGSDALLRLEPSPYDPNVLATFAADSNKIIILDMRNPESPILNLQGHGSSVNGIKWHPTKRNVLLSCGDDCQVLYWDLNSSFME 430          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Nematostella
Match: EDO42058 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2K4])

HSP 1 Score: 564.303 bits (1453), Expect = 0.000e+0
Identity = 260/400 (65.00%), Postives = 323/400 (80.75%), Query Frame = 1
Query:  163 DYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTERFDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARPF-GMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADIMYNDNDADS 1359
            +YKIWK++TPFLYD +M H LEWPSLT QWLP + +P  KDY+VHRLILGTHTSDEQNH++IAS+ +PND+ +FDAS YD ++ ++GGF   +GK++I + INHEGEVNRAR+MPQN   +ATKTP+ADVL+F+Y  HP++P    E  P+LRLKGH KEGYGLSWNP   G +LSASDD TIC+WD ++    S E   ++ +  F GH+ VVEDV+WHL H  +FGSVADD KLMIWD R  N++K    VDAHTAEVNC++FNP+++ ++ TGSADKTVA+WD+RNL+LKLHSFE+H+DEIFQVQWSPHNETI ASSGTDRRLH+WD SKIG EQ   +  DGPPELLFIH GHTAKISDFSWN  EPW +CSV+EDNI+QVWQMA+ +YND + ++
Sbjct:    5 EYKIWKKNTPFLYDLVMTHALEWPSLTVQWLPDVTKPEGKDYSVHRLILGTHTSDEQNHVVIASVQLPNDEAQFDASHYDNDKGEFGGFASVSGKIDIEIKINHEGEVNRARFMPQNPCIIATKTPSADVLVFDYTKHPSKPDPNGECSPDLRLKGHTKEGYGLSWNPNVNGNLLSASDDHTICLWDISSG--ISKEQKTVDAMRIFTGHSAVVEDVSWHLLHESLFGSVADDHKLMIWDTRQTNSNKAAHTVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLHVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVLCSVSEDNIMQVWQMAENIYNDEELET 402          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Nematostella
Match: EDO34980 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMS9])

HSP 1 Score: 121.324 bits (303), Expect = 3.221e-30
Identity = 88/299 (29.43%), Postives = 141/299 (47.16%), Query Frame = 1
Query:  457 TMMINHEGEVNRARY--MPQNETFVATKTPTADVLIFNYAIH---------PARPFGMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLK---LHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEV-----EFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAE 1296
            T+M+ H G VNR R+  +P N   VA+ +    V I++              ++P   E  P     GH  EG+ + W+    G +L+      + +W      N    G +      F  H   VEDV W     +VF S + DK + IWD R+  +   +I  +AH A+VN I++N  N+  +V+G  D  + +WD+R LQ +   +  F+     I  V+W P + ++FA+S  D ++ +WD   + +E+ E        +D PP+LLFIH G    I +  W+   P  + S AE
Sbjct:  122 TVMLKHNGGVNRIRHGHIP-NRHIVASWSERGSVHIWDVEAQIIASDNPGSSSQP--RESSPLFTFSGHASEGFAMDWSRNTHGRLLTGDCKHNVHLW------NPQEGGSWHVDQRPFNAHTDSVEDVQWSPNENNVFASCSVDKTIRIWDARAMPSKACMISTNAHDADVNVISWNR-NEPFIVSGGDDGILKVWDLRQLQKQGQPVALFKHSTGPITSVEWHPTDGSVFAASSADNQITLWD---LAVERDEAAEGPGRHLDVPPQLLFIHMGQK-DIKELHWHPQLPGVLISTAE 406          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Nematostella
Match: EDO38818 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBS0])

HSP 1 Score: 97.0561 bits (240), Expect = 2.246e-22
Identity = 63/196 (32.14%), Postives = 93/196 (47.45%), Query Frame = 1
Query:  598 EVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVE 1185
            E +P    KGH  E YG+ W   +  ++LSAS D TI +WD        +E P +     F GH  VV    W       F S + D+ + IWD+      +P   + AH  EV    +  ++QHLVV+GS D  +  WD+RN    + SF+AH   + +++ SPH   I AS   D  +  WD +      + +E
Sbjct:   94 EPQPVRVFKGHTAEVYGVDWCR-EQDFVLSASWDHTIRLWDP-----LRTEIPTV---AMFTGHQNVVYSSIWSPHIPRTFASASGDQHIGIWDMACPG--RPQQLIRAHEGEVLTCDWAKYDQHLVVSGSVDTLIKGWDVRNTNAPVFSFKAHPYAVRRLKCSPHQGNIIASCSYDFTIKTWDTTSTLAPLETIE 278          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Nematostella
Match: EDO33060 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST98])

HSP 1 Score: 81.2629 bits (199), Expect = 1.917e-16
Identity = 69/247 (27.94%), Postives = 115/247 (46.56%), Query Frame = 1
Query:  616 RLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADIMYNDNDAD 1356
            RL GH    + +S +     ++LS S+DKTI +W   T             L+ + GHN  V DV +  R G  F S + D+   +W   S +  +P+     H ++VN IAF+P N + + TGS+D+TV +WD++     +  F  H+  +  + +S  N     SSG D RL +WD ++ G    E++             GHT  +    +++ +   + S   DN +++W  +     D D D
Sbjct:  342 RLVGHSGPVFAVSIDH-DNKFLLSCSEDKTIRLWSLFT----------FTTLVAYRGHNYPVWDVQFCPR-GHYFASTSHDRTARLW---STDHQQPLRIFAGHVSDVNVIAFHP-NCNYIATGSSDRTVRLWDIQTGS-SVRLFTGHKAAVQSLAFS-RNGRHLISSGVDTRLLVWDLAE-GTLVAELK-------------GHTDTVYSLCFSR-DGTILASAGLDNCIKLWNTSVFCNQDEDDD 555          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Nematostella
Match: EDO29288 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T426])

HSP 1 Score: 75.8702 bits (185), Expect = 8.545e-16
Identity = 62/216 (28.70%), Postives = 100/216 (46.30%), Query Frame = 1
Query:  580 ARPFGMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPG 1227
            A  F        RL GH    + +S +     ++LS S+DKTI +W   T             L+ + GHN  V DV +  R G  F S + D+   +W   S +  +P+     H ++VN +AF+P N + + TGS+D+TV +WD++     +  F  H+  +  + +S +   +  SSG D RL +WD ++  L  +     D    L F   G
Sbjct:    4 AFCFDRTASESRRLVGHSGPVFAVSIDHDNK-FLLSCSEDKTIRLWSLFT----------FTTLVAYRGHNYPVWDVQFCPR-GHYFASTSHDRTARLW---STDHQQPLRIFAGHVSDVNKVAFHP-NCNYIATGSSDRTVRLWDIQTGS-SVRLFTGHKAAVQSLAFSRNGRHLI-SSGVDTRLLVWDLAEGTLVAELKGHTDTVYSLCFSRDG 201          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Medaka
Match: rbbp4 (RB binding protein 4, chromatin remodeling factor [Source:NCBI gene;Acc:101155071])

HSP 1 Score: 582.793 bits (1501), Expect = 0.000e+0
Identity = 275/406 (67.73%), Postives = 330/406 (81.28%), Query Frame = 1
Query:  163 DYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTERFDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARPF-GMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADIMYNDND----ADSTV 1365
            +YKIWK++TPFLYD +M H LEWPSLTAQWLP + RP  KDY+VHRL+LGTHTSDEQNHL+IAS+ +PND  +FDAS YD+E+ ++GGFG  +GK+EI + INHEGEVNRARYMPQN   +ATKTPT+DVL+F+Y  HP++P    E  P+LRL+GH KEGYGLSWNP  +G +LSASDD TIC+WD +T      EG  ++    F GH  VVEDV+WHL H  +FGSVADD+KLMIWD RS+NTSKP   VDAHTAEVNC++FNP+++ ++ TGSADKTVA+WD+RNL+LKLHSFE+H+DEIFQVQWSPHNETI ASSGTDRRL++WD SKIG EQ   +  DGPPELLFIH GHTAKISDFSWN  EPW ICSV+EDNI+QVWQMA+ +YND D    ADS V
Sbjct:   20 EYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKDYSVHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIKINHEGEVNRARYMPQNPCIIATKTPTSDVLVFDYTKHPSKPDPSGECTPDLRLRGHQKEGYGLSWNPNLSGCLLSASDDHTICLWDISTV---PKEGKIVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHAVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGAADSEV 422          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Medaka
Match: rbb4l (histone-binding protein RBBP7 [Source:NCBI gene;Acc:101156710])

HSP 1 Score: 576.244 bits (1484), Expect = 0.000e+0
Identity = 271/402 (67.41%), Postives = 325/402 (80.85%), Query Frame = 1
Query:  163 DYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTER-FDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARPF-GMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADIMYNDNDADST 1362
            +YKIWK++TPFLYD +M H LEWPSLT QWLP + RP  KDY VHRL+LGTHTSDEQNHL+IAS+ +PND  +FDAS YD+E+  ++GGFG  +GK+EI + INH+GEVNRARYMPQN   +ATKTPT+DVL+F+Y  HPA+P    E  P+LRLKGH KEGYGLSWNP  +G +LSASDD TIC+WD    G    EG  ++    F GH  VVEDV+WHL H  +FGSVADD+KLMIWD RS+NTSK    VDAHTAEVNC++FNP+++ ++ TGSADKTVA+WD+RNL+LKLHSFE+H+DEIFQVQWSPHNETI ASSGTDRRL++WD SKIG EQ   +  DGPPELLFIH GHTAKISDFSWN  EPW ICSV+EDNI+QVWQMA+ +YND + D+T
Sbjct:   56 EYKIWKKNTPFLYDLVMTHALEWPSLTVQWLPDVSRPEGKDYAVHRLVLGTHTSDEQNHLVIASVQVPNDDAQFDASHYDSEKGAEFGGFGSVSGKIEIEIKINHDGEVNRARYMPQNPCIIATKTPTSDVLVFDYTKHPAKPDPSGECSPDLRLKGHQKEGYGLSWNPNLSGNLLSASDDHTICLWDI---GAGPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKASHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPGEPWIICSVSEDNIMQVWQMAENIYNDEEPDNT 454          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Medaka
Match: rbb4l (histone-binding protein RBBP7 [Source:NCBI gene;Acc:101156710])

HSP 1 Score: 550.051 bits (1416), Expect = 0.000e+0
Identity = 265/415 (63.86%), Postives = 315/415 (75.90%), Query Frame = 1
Query:  163 DYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTER-FDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARPF-GMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELL--------------------------FIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQM 1323
            +YKIWK++TPFLYD +M H LEWPSLT QWLP + RP  KDY VHRL+LGTHTSDEQNHL+IAS+ +PND  +FDAS YD+E+  ++GGFG  +GK+EI + INH+GEVNRARYMPQN   +ATKTPT+DVL+F+Y  HPA+P    E  P+LRLKGH KEGYGLSWNP  +G +LSASDD TIC+WD    G    EG  ++    F GH  VVEDV+WHL H  +FGSVADD+KLMIWD RS+NTSK    VDAHTAEVNC++FNP+++ ++ TGSADKTVA+WD+RNL+LKLHSFE+H+DEIFQVQWSPHNETI ASSGTDRRL++WD SKIG EQ   +  DGPPELL                          FIH GHTAKISDFSWN  EPW ICSV+EDNI+QVWQM
Sbjct:   56 EYKIWKKNTPFLYDLVMTHALEWPSLTVQWLPDVSRPEGKDYAVHRLVLGTHTSDEQNHLVIASVQVPNDDAQFDASHYDSEKGAEFGGFGSVSGKIEIEIKINHDGEVNRARYMPQNPCIIATKTPTSDVLVFDYTKHPAKPDPSGECSPDLRLKGHQKEGYGLSWNPNLSGNLLSASDDHTICLWDI---GAGPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKASHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLVGPLASRLVGGLLKVLMWSFPVVLHQFIHGGHTAKISDFSWNPGEPWIICSVSEDNIMQVWQM 467          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Medaka
Match: grwd1 (glutamate rich WD repeat containing 1 [Source:NCBI gene;Acc:101163517])

HSP 1 Score: 122.865 bits (307), Expect = 3.837e-30
Identity = 84/296 (28.38%), Postives = 144/296 (48.65%), Query Frame = 1
Query:  463 MINHEGEVNRARYMP-QNETFVATKTPTADVLIFNY-----AIHPARPFGM------EVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVD-AHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQL--KLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWD----CSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVA 1293
            M  H G VNR R      ++  A  +    V IF+      A+H +           E KP     GH+ EG+ + W+P   G ++S    K I +W+    G++     +      F  H+  VED+ W      VF S + D+ + +WDIR+   S  ++ VD AH +++N I++N  ++  +++G  D  + +WD+R  +    + +F+ H   I  V+WSP + ++FA+SG D  +  WD     S +G   + ++  D PP+LLF+H G + +I +  W+   P  + S A
Sbjct:  151 MTPHYGGVNRVRVTQCGQQSLAAVWSEKGQVEIFDLRPQLEAVHSSAAMSAFLQQQKEAKPLFSFSGHMSEGFAIDWSPKAPGRLVSGDCKKNIHVWEPREGGSA-----WQIDQRPFSSHSKSVEDLQWSPTEATVFASCSVDQSIRVWDIRAPPNS--MLSVDGAHASDINVISWN-RSEPFLLSGGDDGLLKVWDLRQFKTGRAVANFKQHSAPITSVEWSPADSSVFAASGADDVISQWDLSVESSDVGARVEGLK--DLPPQLLFLHQGQS-EIKEIHWHPQIPGVMISTA 435          
BLAST of Histone-binding protein RBBP4 vs. Ensembl Medaka
Match: pex7 (peroxisomal biogenesis factor 7 [Source:NCBI gene;Acc:101156454])

HSP 1 Score: 83.1889 bits (204), Expect = 3.485e-17
Identity = 50/177 (28.25%), Postives = 86/177 (48.59%), Query Frame = 1
Query:  622 KGHLKEGYGLSWNPIKA-GYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWD 1149
            K H +E Y +SW+  +    I+S S D T+ +WD + +            L    GH  VV    W         S + D  L IWD+++       + V AH AE+    +  ++Q++V TGS D ++ +WD+RN++  ++    H   I ++++SP ++T+ AS   D  +  WD
Sbjct:  101 KEHTQEVYSVSWSQTRGENLIVSGSWDHTVKVWDPSLS----------RSLTTLRGHEGVVYSTIWSPHIPGCIASASGDGTLRIWDVKAAVCR---LAVPAHQAEILACDWCKYDQNIVATGSVDCSINVWDLRNIRQPVNHLLGHTYAIRRLKFSPFSQTVLASCSYDFTVRFWD 264          

HSP 2 Score: 65.855 bits (159), Expect = 1.826e-11
Identity = 48/177 (27.12%), Postives = 81/177 (45.76%), Query Frame = 1
Query:  805 DVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPF-NQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADI 1332
            DVAW   +  +  +   D  L +WD  + N   P+     HT EV  ++++    ++L+V+GS D TV +WD  +L   L +   H+  ++   WSPH     AS+  D  L IWD  K  + +  V             P H A+I    W +++   + + + D  + VW + +I
Sbjct:   65 DVAWSEANEHLLVAGGGDGSLQLWD--TANQHAPLKVAKEHTQEVYSVSWSQTRGENLIVSGSWDHTVKVWD-PSLSRSLTTLRGHEGVVYSTIWSPHIPGCIASASGDGTLRIWDV-KAAVCRLAV-------------PAHQAEILACDWCKYDQNIVATGSVDCSINVWDLRNI 224          

HSP 3 Score: 58.5362 bits (140), Expect = 5.220e-9
Identity = 51/224 (22.77%), Postives = 94/224 (41.96%), Query Frame = 1
Query:  430 GFPNGKLEITMMINHEGEVNRARYMPQNETFVA-TKTPTADVLIFNYAIHPARPFGMEVKPELR-LKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPH 1095
            G  +G L++    N    +  A+   Q    V+ ++T   ++++     H  + +   +   L  L+GH    Y   W+P   G I SAS D T+ +WD   A             +    H   +    W     ++  + + D  + +WD+R  N  +PV  +  HT  +  + F+PF+Q ++ + S D TV  WD       L + E H + +  + ++ H
Sbjct:   79 GGGDGSLQLWDTANQHAPLKVAKEHTQEVYSVSWSQTRGENLIVSGSWDHTVKVWDPSLSRSLTTLRGHEGVVYSTIWSPHIPGCIASASGDGTLRIWDVKAAVCR----------LAVPAHQAEILACDWCKYDQNIVATGSVDCSINVWDLR--NIRQPVNHLLGHTYAIRRLKFSPFSQTVLASCSYDFTVRFWDFGMNPPLLDTVEHHSEFVCGLDFNLH 290          
BLAST of Histone-binding protein RBBP4 vs. Planmine SMEST
Match: SMESG000062893.1 (SMESG000062893.1)

HSP 1 Score: 850.121 bits (2195), Expect = 0.000e+0
Identity = 404/404 (100.00%), Postives = 404/404 (100.00%), Query Frame = 1
Query:  163 DYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTERFDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARPFGMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADIMYNDNDADSTVLPM 1374
            DYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTERFDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARPFGMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADIMYNDNDADSTVLPM
Sbjct:   24 DYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTERFDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARPFGMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADIMYNDNDADSTVLPM 427          
BLAST of Histone-binding protein RBBP4 vs. Planmine SMEST
Match: SMESG000007931.1 (SMESG000007931.1)

HSP 1 Score: 380.563 bits (976), Expect = 3.922e-129
Identity = 177/392 (45.15%), Postives = 259/392 (66.07%), Query Frame = 1
Query:  163 DYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTERFDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARP-FGMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADIM 1335
            DY  WK++TPFLYD +M H L WPSLT QW+P I R  DKDY+  R+I+GT   +EQ++LLIAS+ +PN+   F++  YD E+ ++GG+G      +I++ INH+G +NRARY+PQ    +ATK+   +V +F+Y  HP++P    + KP+L LKGH +EG+GLSWN   AG +LS++ D TI +WD N    + ++   +N L Q++GH   VEDV WH     +FGSV  DK L+IWD R    SKP ++V AH+ +V  + FNPF+++++ TGS DKT+ +WD+RN+   L     H+  I Q+QWS H ETI AS G+D ++H+WD  K G  +++    +   EL FIH GH +++ DF+WN  EP  + SV+ DNILQ+WQ ++ +
Sbjct:   15 DYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDVNCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRRE---SKPAVKVMAHSDDVVTLDFNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKEK----NYSEELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSEFL 399          
BLAST of Histone-binding protein RBBP4 vs. Planmine SMEST
Match: SMESG000007931.1 (SMESG000007931.1)

HSP 1 Score: 357.066 bits (915), Expect = 3.212e-120
Identity = 169/392 (43.11%), Postives = 246/392 (62.76%), Query Frame = 1
Query:  163 DYKIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTERFDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARP-FGMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADIM 1335
            DY  WK++TPFLYD +M H L WPSLT QW+P I R  DKDY+  R+I+GT   +EQ++LLIAS+ +PN+   F++  YD E+ ++GG+G      +I++ INH+G +NRARY+PQ    +ATK+   +V +F+Y  HP++P    + KP+L LKGH +EG+GLSWN   AG +LS++ D TI +WD N    + ++   +N L Q++GH   VEDV WH     +FGSV  DK L+IWD                        FNPF+++++ TGS DKT+ +WD+RN+   L     H+  I Q+QWS H ETI AS G+D ++H+WD  K G  +++    +   EL FIH GH +++ DF+WN  EP  + SV+ DNILQ+WQ ++ +
Sbjct:   15 DYIRWKKNTPFLYDLVMTHNLTWPSLTVQWMPDITRLEDKDYSTQRIIVGTQAEEEQDYLLIASVTVPNEYKCFESKHYDAEKDEFGGYGLVTAHTDISIKINHDGCINRARYLPQCPNVIATKSSNGNVYLFDYTRHPSKPDQSGKCKPDLVLKGHSQEGFGLSWNIKNAGVLLSSAVDGTIQLWDVNCTPENKNDFKVLNSLSQYLGHEGSVEDVCWHKFSDQLFGSVGVDKNLLIWDRH----------------------FNPFSEYILATGSEDKTIGLWDLRNMGGSLKYLRGHEGSIGQLQWSLHKETILASGGSDNKVHLWDLKKTGTSKEK----NYSEELAFIHAGHCSRVIDFAWNGNEPLMMASVSYDNILQLWQPSEFL 380          
BLAST of Histone-binding protein RBBP4 vs. Planmine SMEST
Match: SMESG000037114.1 (SMESG000037114.1)

HSP 1 Score: 288.115 bits (736), Expect = 2.992e-93
Identity = 154/396 (38.89%), Postives = 228/396 (57.58%), Query Frame = 1
Query:  169 KIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTERFDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARPFGMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIR---SDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDG-PPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADIMYND 1344
            +IWK + P +Y+      L+WPS T QWLP  ++   +D+T+++++LGTH  +E+N L+ A   + N     +A +      D       NGKL IT  +NH+G+VNRARYMPQN + VATK+   D  I++           +    L L GH  EGYG+SWN    G +L+ S D+TIC +D     + S+ G  +NP     GH   VEDV WH    ++FGSV DD++L+IWD R   + ++S PV +V AH  + NC++++P    L++TG AD  V +WD R L   LH F+  +  +++V WSP  ET+F S+G   ++HIWD  KIG +    +  D  P EL  IH GH   ++D  W+ +   T+ SVAEDN++ VWQ+ D ++ D
Sbjct:   10 RIWKINCPLMYNLAHFDTLDWPSFTCQWLPFEEK--HEDHTIYKILLGTHADEEENKLIYADYIISNSN---EADSIQINGADNKSRLPLNGKLVITKTVNHKGDVNRARYMPQNSSIVATKSSEKDSFIYS-----------DGNCLLTLSGHSDEGYGISWNQQVEGRLLTCSFDQTICAFDI----SQSAGGSTLNPARTITGHQDKVEDVCWHPAEANIFGSVGDDQRLLIWDYRRKEASSSSGPVQQVVAHAGDANCLSWHPVTSCLLLTGGADGLVHLWDQRKLVSALHVFDT-EASVYRVAWSPLQETLFLSAGLQHKIHIWDVEKIGDDVLSYDEEDRFPAELAMIHSGHADAVTDIDWHPYLKATVASVAEDNMVNVWQIKDSIFAD 384          
BLAST of Histone-binding protein RBBP4 vs. Planmine SMEST
Match: SMESG000037114.1 (SMESG000037114.1)

HSP 1 Score: 288.115 bits (736), Expect = 3.053e-93
Identity = 154/396 (38.89%), Postives = 228/396 (57.58%), Query Frame = 1
Query:  169 KIWKRDTPFLYDCLMVHPLEWPSLTAQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDASAYDTERFDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPTADVLIFNYAIHPARPFGMEVKPELRLKGHLKEGYGLSWNPIKAGYILSASDDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFGSVADDKKLMIWDIR---SDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSADKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHIWDCSKIGLEQQEVEFVDG-PPELLFIHPGHTAKISDFSWNQFEPWTICSVAEDNILQVWQMADIMYND 1344
            +IWK + P +Y+      L+WPS T QWLP  ++   +D+T+++++LGTH  +E+N L+ A   + N     +A +      D       NGKL IT  +NH+G+VNRARYMPQN + VATK+   D  I++           +    L L GH  EGYG+SWN    G +L+ S D+TIC +D     + S+ G  +NP     GH   VEDV WH    ++FGSV DD++L+IWD R   + ++S PV +V AH  + NC++++P    L++TG AD  V +WD R L   LH F+  +  +++V WSP  ET+F S+G   ++HIWD  KIG +    +  D  P EL  IH GH   ++D  W+ +   T+ SVAEDN++ VWQ+ D ++ D
Sbjct:   11 RIWKINCPLMYNLAHFDTLDWPSFTCQWLPFEEK--HEDHTIYKILLGTHADEEENKLIYADYIISNSN---EADSIQINGADNKSRLPLNGKLVITKTVNHKGDVNRARYMPQNSSIVATKSSEKDSFIYS-----------DGNCLLTLSGHSDEGYGISWNQQVEGRLLTCSFDQTICAFDI----SQSAGGSTLNPARTITGHQDKVEDVCWHPAEANIFGSVGDDQRLLIWDYRRKEASSSSGPVQQVVAHAGDANCLSWHPVTSCLLLTGGADGLVHLWDQRKLVSALHVFDT-EASVYRVAWSPLQETLFLSAGLQHKIHIWDVEKIGDDVLSYDEEDRFPAELAMIHSGHADAVTDIDWHPYLKATVASVAEDNMVNVWQIKDSIFAD 385          
The following BLAST results are available for this feature:
BLAST of Histone-binding protein RBBP4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RBBP40.000e+066.58RB binding protein 4, chromatin remodeling factor ... [more]
RBBP40.000e+066.58RB binding protein 4, chromatin remodeling factor ... [more]
RBBP40.000e+066.84RB binding protein 4, chromatin remodeling factor ... [more]
RBBP70.000e+063.93RB binding protein 7, chromatin remodeling factor ... [more]
RBBP70.000e+063.93RB binding protein 7, chromatin remodeling factor ... [more]
back to top
BLAST of Histone-binding protein RBBP4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lin-530.000e+065.66Probable histone-binding protein lin-53 [Source:U... [more]
rba-16.163e-13547.34Probable histone-binding protein rba-1 [Source:Un... [more]
Y54H5A.11.165e-2730.04pep chromosome:WBcel235:III:5153543:5155465:1 gene... [more]
Y54H5A.11.165e-2730.04pep chromosome:WBcel235:III:5153464:5155465:1 gene... [more]
Y54H5A.11.165e-2730.04pep chromosome:WBcel235:III:5153406:5155436:1 gene... [more]
back to top
BLAST of Histone-binding protein RBBP4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Caf1-550.000e+067.17gene:FBgn0263979 transcript:FBtr0083052[more]
Caf1-550.000e+067.17gene:FBgn0263979 transcript:FBtr0301845[more]
l(2)098512.541e-2827.95gene:FBgn0022288 transcript:FBtr0335269[more]
l(2)098512.541e-2827.95gene:FBgn0022288 transcript:FBtr0086043[more]
Pex71.998e-2129.57gene:FBgn0035922 transcript:FBtr0076568[more]
back to top
BLAST of Histone-binding protein RBBP4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbbp40.000e+067.16retinoblastoma binding protein 4 [Source:NCBI gene... [more]
rbb4l0.000e+067.25retinoblastoma binding protein 4, like [Source:NCB... [more]
rbb4l0.000e+067.08retinoblastoma binding protein 4, like [Source:NCB... [more]
rbb4l0.000e+067.08retinoblastoma binding protein 4, like [Source:NCB... [more]
CR450764.74.795e-3969.88pep chromosome:GRCz11:CHR_ALT_CTG11_3_1:12801933:1... [more]
back to top
BLAST of Histone-binding protein RBBP4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbbp40.000e+066.58retinoblastoma binding protein 4 [Source:NCBI gene... [more]
rbbp40.000e+066.58retinoblastoma binding protein 4 [Source:NCBI gene... [more]
rbbp40.000e+067.35retinoblastoma binding protein 4 [Source:NCBI gene... [more]
rbbp40.000e+061.56retinoblastoma binding protein 4 [Source:NCBI gene... [more]
rbbp70.000e+064.91retinoblastoma binding protein 7 [Source:NCBI gene... [more]
back to top
BLAST of Histone-binding protein RBBP4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rbbp40.000e+066.58retinoblastoma binding protein 4, chromatin remode... [more]
Rbbp70.000e+063.93retinoblastoma binding protein 7, chromatin remode... [more]
Rbbp70.000e+062.94retinoblastoma binding protein 7, chromatin remode... [more]
Rbbp77.735e-16862.96retinoblastoma binding protein 7, chromatin remode... [more]
Rbbp71.372e-8360.85retinoblastoma binding protein 7, chromatin remode... [more]
back to top
BLAST of Histone-binding protein RBBP4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q60972|RBBP4_MOUSE0.000e+066.58Histone-binding protein RBBP4 OS=Mus musculus OX=1... [more]
sp|Q09028|RBBP4_HUMAN0.000e+066.58Histone-binding protein RBBP4 OS=Homo sapiens OX=9... [more]
sp|Q3MHL3|RBBP4_BOVIN0.000e+066.58Histone-binding protein RBBP4 OS=Bos taurus OX=991... [more]
sp|Q6INH0|RBP4B_XENLA0.000e+066.58Histone-binding protein RBBP4-B OS=Xenopus laevis ... [more]
sp|Q5M7K4|RBBP4_XENTR0.000e+066.58Histone-binding protein RBBP4 OS=Xenopus tropicali... [more]
back to top
BLAST of Histone-binding protein RBBP4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A556TPH80.000e+067.66Histone-binding protein RBBP4 OS=Bagarius yarrelli... [more]
T1JFL00.000e+067.75WD_REPEATS_REGION domain-containing protein OS=Str... [more]
C1LIR10.000e+069.52Putative histone-binding protein Caf1 OS=Schistoso... [more]
A0A210PT870.000e+069.00Histone-binding protein RBBP7 OS=Mizuhopecten yess... [more]
A0A504Z7510.000e+069.67Histone-binding protein RBBP4 OS=Fasciola gigantic... [more]
back to top
BLAST of Histone-binding protein RBBP4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbbp40.000e+067.41RB binding protein 4, chromatin remodeling factor ... [more]
rbb4l0.000e+067.08histone-binding protein RBBP7 [Source:NCBI gene;Ac... [more]
grwd19.503e-3027.30glutamate rich WD repeat containing 1 [Source:NCBI... [more]
pex71.832e-1625.45peroxisomal biogenesis factor 7 [Source:NCBI gene;... [more]
taf51.143e-1528.76TATA-box binding protein associated factor 5 [Sour... [more]
back to top
BLAST of Histone-binding protein RBBP4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008002.10.000e+066.17pep scaffold:Pmarinus_7.0:GL477852:421:9512:1 gene... [more]
pex78.241e-2029.57peroxisomal biogenesis factor 7 [Source:ZFIN;Acc:Z... [more]
wdr128.260e-1627.87WD repeat domain 12 [Source:NCBI gene;Acc:321652][more]
sec31b4.153e-1426.01SEC31 homolog B, COPII coat complex component [Sou... [more]
ENSPMAT00000002506.11.007e-1228.06pep scaffold:Pmarinus_7.0:GL479076:26529:32136:-1 ... [more]
back to top
BLAST of Histone-binding protein RBBP4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
HAT24.375e-7634.19Subunit of the Hat1p-Hat2p histone acetyltransfera... [more]
MSI12.916e-4326.44Subunit of chromatin assembly factor I (CAF-1); ch... [more]
RRB11.518e-2326.60Specific chaperone for ribosomal protein Rpl3p; bi... [more]
PRP464.820e-1226.40Member of the NineTeen Complex (NTC); this complex... [more]
YPL247C_mRNA3.283e-1122.69Putative protein of unknown function; green fluore... [more]
back to top
BLAST of Histone-binding protein RBBP4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO420580.000e+065.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO349803.221e-3029.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388182.246e-2232.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO330601.917e-1627.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO292888.545e-1628.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Histone-binding protein RBBP4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbbp40.000e+067.73RB binding protein 4, chromatin remodeling factor ... [more]
rbb4l0.000e+067.41histone-binding protein RBBP7 [Source:NCBI gene;Ac... [more]
rbb4l0.000e+063.86histone-binding protein RBBP7 [Source:NCBI gene;Ac... [more]
grwd13.837e-3028.38glutamate rich WD repeat containing 1 [Source:NCBI... [more]
pex73.485e-1728.25peroxisomal biogenesis factor 7 [Source:NCBI gene;... [more]
back to top
BLAST of Histone-binding protein RBBP4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000062893.10.000e+0100.00SMESG000062893.1[more]
SMESG000007931.13.922e-12945.15SMESG000007931.1[more]
SMESG000007931.13.212e-12043.11SMESG000007931.1[more]
SMESG000037114.12.992e-9338.89SMESG000037114.1[more]
SMESG000037114.13.053e-9338.89SMESG000037114.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022238 ID=SMED30022238|Name=Histone-binding protein RBBP4|organism=Schmidtea mediterranea sexual|type=transcript|length=1427bp
TTATTACTGTTGTTTAAATATTAAAAATAGAGGTGAATTCAACCATATTA
AAATCTATTAATTTACTAAAAATCTAATTTTACTAATAAATTTATGATTG
GTGGCATAGAAAAAGAAGCAGAAAACGAAAAAGAATGTGAAGAAGAAAGA
ATAATCAATGAAGATTACAAAATTTGGAAGAGAGACACTCCTTTTTTGTA
TGATTGTTTAATGGTTCACCCTCTTGAGTGGCCAAGTTTAACTGCTCAAT
GGTTGCCAACTATCGATAGACCTAACGATAAGGATTATACCGTTCATAGA
CTAATTTTAGGAACTCATACCTCTGATGAGCAAAATCATTTGTTAATTGC
TAGTATAAATATGCCAAATGATCAAACAGAATTTGATGCCAGTGCATATG
ATACTGAAAGATTTGATTATGGTGGTTTCGGTTTCCCTAATGGTAAACTG
GAAATTACGATGATGATTAATCATGAAGGTGAAGTCAATCGAGCAAGATA
TATGCCACAAAATGAAACATTTGTTGCAACAAAAACTCCAACTGCTGACG
TATTAATTTTTAATTATGCTATACATCCAGCTCGTCCATTCGGAATGGAA
GTTAAGCCAGAATTGCGACTGAAAGGGCATTTAAAAGAAGGTTATGGACT
ATCTTGGAACCCAATTAAAGCGGGATATATTTTATCTGCTTCAGACGACA
AAACCATTTGCATGTGGGATACCAACACAGCTGGAAATTCATCAAGTGAA
GGGCCATATATTAATCCTCTAATGCAGTTTATTGGTCACAATACAGTTGT
TGAAGATGTTGCATGGCATTTACGTCATGGTGATGTTTTTGGTTCAGTCG
CCGATGACAAGAAATTAATGATATGGGACATAAGAAGTGACAATACATCA
AAACCTGTCATTGAAGTTGATGCGCACACTGCTGAAGTCAATTGTATTGC
CTTTAATCCATTTAATCAGCATCTGGTTGTAACAGGAAGTGCCGATAAAA
CTGTTGCAATGTGGGATATGAGAAATTTACAGTTAAAACTGCATTCATTT
GAAGCCCACCAAGATGAAATTTTCCAAGTCCAGTGGTCACCTCACAATGA
AACGATATTTGCGTCTAGCGGCACAGATCGACGGCTCCATATCTGGGATT
GTAGTAAAATAGGATTAGAACAGCAGGAGGTGGAATTTGTTGATGGACCA
CCGGAATTGTTGTTCATCCACCCGGGTCACACAGCTAAAATTTCTGATTT
CTCCTGGAATCAGTTCGAACCGTGGACAATTTGTTCAGTTGCCGAGGATA
ACATTTTACAAGTTTGGCAAATGGCCGATATAATGTACAACGATAATGAT
GCAGATTCCACGGTGTTACCAATGTAACTATTGCTTTGTATATGTTTATT
GTGAATACATTCTGATTTATTGTCACG
back to top

protein sequence of SMED30022238-orf-1

>SMED30022238-orf-1 ID=SMED30022238-orf-1|Name=SMED30022238-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=428bp
MIGGIEKEAENEKECEEERIINEDYKIWKRDTPFLYDCLMVHPLEWPSLT
AQWLPTIDRPNDKDYTVHRLILGTHTSDEQNHLLIASINMPNDQTEFDAS
AYDTERFDYGGFGFPNGKLEITMMINHEGEVNRARYMPQNETFVATKTPT
ADVLIFNYAIHPARPFGMEVKPELRLKGHLKEGYGLSWNPIKAGYILSAS
DDKTICMWDTNTAGNSSSEGPYINPLMQFIGHNTVVEDVAWHLRHGDVFG
SVADDKKLMIWDIRSDNTSKPVIEVDAHTAEVNCIAFNPFNQHLVVTGSA
DKTVAMWDMRNLQLKLHSFEAHQDEIFQVQWSPHNETIFASSGTDRRLHI
WDCSKIGLEQQEVEFVDGPPELLFIHPGHTAKISDFSWNQFEPWTICSVA
EDNILQVWQMADIMYNDNDADSTVLPM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006325chromatin organization
GO:0000183chromatin silencing at rDNA
GO:0006260DNA replication
GO:0006335DNA replication-dependent nucleosome assembly
GO:0006336DNA replication-independent nucleosome assembly
GO:0006338chromatin remodeling
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0007049cell cycle
GO:0016569covalent chromatin modification
GO:0031497chromatin assembly
GO:0043044ATP-dependent chromatin remodeling
GO:0060416response to growth hormone
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR020472G-protein_beta_WD-40_rep
IPR001680WD40_repeat
IPR022052Histone-bd_RBBP4_N
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0000978RNA polymerase II core promoter proximal region sequence-specific DNA binding
GO:0000980RNA polymerase II distal enhancer sequence-specific DNA binding
GO:0008094DNA-dependent ATPase activity
GO:0031492nucleosomal DNA binding
GO:0042826histone deacetylase binding
Vocabulary: cellular component
TermDefinition
GO:0000790nuclear chromatin
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005829cytosol
GO:0016581NuRD complex
GO:0016589NURF complex
GO:0033186CAF-1 complex
GO:0035098ESC/E(Z) complex
GO:0043234protein complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020472G-protein beta WD-40 repeatPRINTSPR00320GPROTEINBRPTcoord: 339..353
score: 32.75
coord: 295..309
score: 40.4
coord: 196..210
score: 38.08
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 116..157
e-value: 84.0
score: 4.9
coord: 369..409
e-value: 0.0098
score: 25.1
coord: 312..352
e-value: 1.5E-7
score: 41.1
coord: 169..209
e-value: 6.7E-5
score: 32.3
coord: 222..262
e-value: 0.084
score: 22.0
coord: 268..308
e-value: 2.0E-9
score: 47.3
IPR001680WD40 repeatPFAMPF00400WD40coord: 316..352
e-value: 7.0E-5
score: 23.5
coord: 270..308
e-value: 1.1E-5
score: 26.0
coord: 224..262
e-value: 0.046
score: 14.6
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 319..352
score: 12.213
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 275..311
score: 13.717
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 229..271
score: 10.408
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 176..218
score: 10.843
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 5..424
e-value: 2.4E-143
score: 480.2
IPR022052Histone-binding protein RBBP4, N-terminalPFAMPF12265CAF1C_H4-bdcoord: 23..91
e-value: 3.3E-22
score: 78.5
NoneNo IPR availablePANTHERPTHR22850:SF90HISTONE-BINDING PROTEIN RBBP4coord: 13..423
NoneNo IPR availablePANTHERPTHR22850WD40 REPEAT FAMILYcoord: 13..423
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 295..309
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 196..210
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 176..418
score: 31.929
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 116..411