SPATA6 domain-containing protein

Overview
NameSPATA6 domain-containing protein
Smed IDSMED30022233
Length (bp)1523
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SPATA6 domain-containing protein (SMED30022233) t-SNE clustered cells

Violin plots show distribution of expression levels for SPATA6 domain-containing protein (SMED30022233) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SPATA6 domain-containing protein (SMED30022233) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SPATA6 domain-containing protein (SMED30022233) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022233

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 22

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30022233h1SMcG0003334 SmedASXL_011059SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30022233h1SMcG0003334 SmedASXL_011059SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
X2 cellSMED30022233 SmedASXL_074446SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30022233 SmedASXL_074446SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30022233h1SMcG0003334 dd_Smed_v4_4304_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30022233h1SMcG0003334 dd_Smed_v4_4304_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30022233h1SMcG0003334 dd_Smed_v4_4304_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022233h1SMcG0003334 dd_Smed_v4_4304_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30022233h1SMcG0003334 dd_Smed_v4_4304_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30022233h1SMcG0003334 dd_Smed_v4_4304_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
pharynxSMED30022233h1SMcG0003334 dd_Smed_v4_4304_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30022233h1SMcG0003334 dd_Smed_v4_4304_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30022233h1SMcG0003334 dd_Smed_v4_4304_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022233h1SMcG0003334 dd_Smed_v4_4304_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30022233h1SMcG0003334 dd_Smed_v4_4304_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30022233h1SMcG0003334 dd_Smed_v4_4304_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30022233h1SMcG0003334 dd_Smed_v6_4304_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30022233h1SMcG0003334 dd_Smed_v6_4304_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30022233h1SMcG0003334 OX_Smed_1.0.10806ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
head regionSMED30022233h1SMcG0003334 OX_Smed_1.0.10806ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30022233h1SMcG0003334 dd_Smed_v4_4304_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022233h1SMcG0003334 dd_Smed_v4_4304_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SPATA6 domain-containing protein vs. Ensembl Human
Match: SPATA6 (spermatogenesis associated 6 [Source:HGNC Symbol;Acc:HGNC:18309])

HSP 1 Score: 72.7886 bits (177), Expect = 4.716e-13
Identity = 77/274 (28.10%), Postives = 132/274 (48.18%), Query Frame = 2
Query:   92 LNLHLLSSIGNHDCPGQL------VYLSVEMFGTVHKTKPQHSYYPLLFNEVINFQKTFYSPSNENEVLDMLEDSSVVIELRRLDPCFYSGLLLSYFDGNAKEFLFSRFSRIPCSMNG-----QEIYLDRTVDFSGTAPRLRYSIFADIKKVASSIETFNSESKYGVNNRSSDDGYYSPSQSVDKSY-RGQSRRSRSKKMAYDSGSIENLSNSKPYYTRQTVASALRSRSPSPVIN-KLSDYRDDSGIKDSEMSDVAYD---DYQKPPFVVRKV 865
            L   L   I +  CPG +      +YLS+ +FG   KT+   + +PL+FN  + F+K F    +  +V+  LE  + V EL +L P    G  LS +D N ++F+F      P  M+G     +++ + R     G APRL +S  + I +   S    +++ K+          + +P   V+KS+ R Q+R SRS+K    S        +   Y + T++S  +S SPSP    ++ +  +D+  + + ++   Y+   +  KPPFV+R V
Sbjct:    7 LQCALALEISSVTCPGVVLKDKEDIYLSICVFGQYKKTQCVPATFPLVFNARMVFEKVFPDAVDPGDVVTQLEYDTAVFELIQLVPPV--GETLSTYDENTRDFMFPG----PNQMSGHHDSNRQVTMRRISGLRGNAPRLEFSTTSVITECLISSRKCHTQDKFIY--------HLAP---VEKSHGRLQNRTSRSQKKKSKSPERSKYCINAKNYEQPTISS--KSHSPSPYTKRRMCELSEDTRRRLAHLNLGPYEFKKETDKPPFVIRHV 261          
BLAST of SPATA6 domain-containing protein vs. Ensembl Human
Match: SPATA6 (spermatogenesis associated 6 [Source:HGNC Symbol;Acc:HGNC:18309])

HSP 1 Score: 72.7886 bits (177), Expect = 4.762e-13
Identity = 77/274 (28.10%), Postives = 132/274 (48.18%), Query Frame = 2
Query:   92 LNLHLLSSIGNHDCPGQL------VYLSVEMFGTVHKTKPQHSYYPLLFNEVINFQKTFYSPSNENEVLDMLEDSSVVIELRRLDPCFYSGLLLSYFDGNAKEFLFSRFSRIPCSMNG-----QEIYLDRTVDFSGTAPRLRYSIFADIKKVASSIETFNSESKYGVNNRSSDDGYYSPSQSVDKSY-RGQSRRSRSKKMAYDSGSIENLSNSKPYYTRQTVASALRSRSPSPVIN-KLSDYRDDSGIKDSEMSDVAYD---DYQKPPFVVRKV 865
            L   L   I +  CPG +      +YLS+ +FG   KT+   + +PL+FN  + F+K F    +  +V+  LE  + V EL +L P    G  LS +D N ++F+F      P  M+G     +++ + R     G APRL +S  + I +   S    +++ K+          + +P   V+KS+ R Q+R SRS+K    S        +   Y + T++S  +S SPSP    ++ +  +D+  + + ++   Y+   +  KPPFV+R V
Sbjct:    7 LQCALALEISSVTCPGVVLKDKEDIYLSICVFGQYKKTQCVPATFPLVFNARMVFEKVFPDAVDPGDVVTQLEYDTAVFELIQLVPPV--GETLSTYDENTRDFMFPG----PNQMSGHHDSNRQVTMRRISGLRGNAPRLEFSTTSVITECLISSRKCHTQDKFIY--------HLAP---VEKSHGRLQNRTSRSQKKKSKSPERSKYCINAKNYEQPTISS--KSHSPSPYTKRRMCELSEDTRRRLAHLNLGPYEFKKETDKPPFVIRHV 261          
BLAST of SPATA6 domain-containing protein vs. Ensembl Human
Match: SPATA6 (spermatogenesis associated 6 [Source:HGNC Symbol;Acc:HGNC:18309])

HSP 1 Score: 61.6178 bits (148), Expect = 1.792e-9
Identity = 72/274 (26.28%), Postives = 125/274 (45.62%), Query Frame = 2
Query:   92 LNLHLLSSIGNHDCPGQL------VYLSVEMFGTVHKTKPQHSYYPLLFNEVINFQKTFYSPSNENEVLDMLEDSSVVIELRRLDPCFYSGLLLSYFDGNAKEFLFSRFSRIPCSMNG-----QEIYLDRTVDFSGTAPRLRYSIFADIKKVASSIETFNSESKYGVNNRSSDDGYYSPSQSVDKSY-RGQSRRSRSKKMAYDSGSIENLSNSKPYYTRQTVASALRSRSPSPVIN-KLSDYRDDSGIKDSEMSDVAYD---DYQKPPFVVRKV 865
            L   L   I +  CPG +      +YLS+ +FG   KT+   + +PL+FN  + F+K F    +  +V+  LE                 G  LS +D N ++F+F      P  M+G     +++ + R     G APRL +S  + I +   S    +++ K+          + +P   V+KS+ R Q+R SRS+K    S        +   Y + T++S  +S SPSP    ++ +  +D+  + + ++   Y+   +  KPPFV+R V
Sbjct:    7 LQCALALEISSVTCPGVVLKDKEDIYLSICVFGQYKKTQCVPATFPLVFNARMVFEKVFPDAVDPGDVVTQLE----------------LGETLSTYDENTRDFMFPG----PNQMSGHHDSNRQVTMRRISGLRGNAPRLEFSTTSVITECLISSRKCHTQDKFIY--------HLAP---VEKSHGRLQNRTSRSQKKKSKSPERSKYCINAKNYEQPTISS--KSHSPSPYTKRRMCELSEDTRRRLAHLNLGPYEFKKETDKPPFVIRHV 247          
BLAST of SPATA6 domain-containing protein vs. Ensembl Human
Match: SPATA6L (spermatogenesis associated 6 like [Source:HGNC Symbol;Acc:HGNC:25472])

HSP 1 Score: 56.225 bits (134), Expect = 9.097e-9
Identity = 43/163 (26.38%), Postives = 77/163 (47.24%), Query Frame = 2
Query:   86 VELNLHLLSSIGNHDCPGQLVYLSVEMFGTVHKTKPQHSYYPLLFNEVINFQKTFYSPSNENEVLDMLEDSSVVIELRRLDPCFYSGLLLSYFDGNAKEFLFSRFSRIPC-SMNGQEIYLDRTVDFSGTAPRLRYSIFADIKKVASSIETFNSESKYGVNNRS 571
            VEL +  +S  G      Q VYL V +     +T    S +P++  E + F+K F S  +   V+D+LE      EL +L P  +    L+Y++ N ++FLF      P      +E+ +   + F G AP++ +S    I++       F   +++ V+++S
Sbjct:    7 VELQIRAISCPGVFLPGKQDVYLGVYLMNQYLETNSFPSAFPIMIQESMRFEKVFESAVDPGAVVDLLESFLARFELIQLVPPVWDE--LAYYEENTRDFLFPEPKLTPSHPRRCREVLMKTALGFPGIAPKIEFSTRTAIREC-----VFLHRNRFLVDSKS 162          
BLAST of SPATA6 domain-containing protein vs. Ensembl Human
Match: SPATA6L (spermatogenesis associated 6 like [Source:HGNC Symbol;Acc:HGNC:25472])

HSP 1 Score: 56.225 bits (134), Expect = 9.097e-9
Identity = 43/163 (26.38%), Postives = 77/163 (47.24%), Query Frame = 2
Query:   86 VELNLHLLSSIGNHDCPGQLVYLSVEMFGTVHKTKPQHSYYPLLFNEVINFQKTFYSPSNENEVLDMLEDSSVVIELRRLDPCFYSGLLLSYFDGNAKEFLFSRFSRIPC-SMNGQEIYLDRTVDFSGTAPRLRYSIFADIKKVASSIETFNSESKYGVNNRS 571
            VEL +  +S  G      Q VYL V +     +T    S +P++  E + F+K F S  +   V+D+LE      EL +L P  +    L+Y++ N ++FLF      P      +E+ +   + F G AP++ +S    I++       F   +++ V+++S
Sbjct:    7 VELQIRAISCPGVFLPGKQDVYLGVYLMNQYLETNSFPSAFPIMIQESMRFEKVFESAVDPGAVVDLLESFLARFELIQLVPPVWDE--LAYYEENTRDFLFPEPKLTPSHPRRCREVLMKTALGFPGIAPKIEFSTRTAIREC-----VFLHRNRFLVDSKS 162          
BLAST of SPATA6 domain-containing protein vs. Ensembl Zebrafish
Match: spata6 (spermatogenesis associated 6 [Source:ZFIN;Acc:ZDB-GENE-050417-351])

HSP 1 Score: 73.9442 bits (180), Expect = 1.244e-13
Identity = 75/284 (26.41%), Postives = 130/284 (45.77%), Query Frame = 2
Query:   59 MTGKGFVCEVELNLHLLSSIGNHDCPGQL------VYLSVEMFGTVHKTKPQHSYYPLLFNEVINFQKTFYSPSNENEVLDMLEDSSVVIELRRLDPCFYSGLLLSYFDGNAKEFLFSRFSRIPCSMNGQ-EIYLDRTVDFSGTAPRLRYSIFADIKKVASSIETFNSESKYGVNNRSSDDGYYSPSQSVDKSYRGQSRRSRSKKMAYDSGSIENLSNSKPYYTRQTVASALRSRSPSPVIN-KLSDYRDDSGIKDSEMSDVAY----DDYQKPPFVVRKVPDS 874
            M  K   C VEL +  ++      CPG +      +YLSV + G   K+K     +PLL +E + F KTF    +   V + LE+ +  +EL +L P    G +L+ F+ + +EFL+      P S   + EI + R++ F G +PR+ +S  + I++          + K+G +  SS  G  S   S  ++    +++ +        G           Y + TVAS  RSR+PSP  + K+    +++  + S +    Y    +   + PFVV + P++
Sbjct:    1 MRQKANKCTVELKVQAIT------CPGVMLPSQEDIYLSVRIMGQYQKSKCVPPVFPLLLHEKMVFVKTFVGMLDPAAVAEHLENDTTSLELIQLVP--PEGEILATFEADTREFLYPGPRLTPRSPGPEREILMKRSISFPGISPRVEFSTTSIIEEC---------DVKHGQSAVSS-HGRSSAKPSSMRTCLSSAKKKKKSDKVSSCG-----------YEKSTVAS--RSRAPSPYTHRKMCQLSEEARQRLSHLKLGPYTFQKETAPQAPFVVPRSPNT 253          
BLAST of SPATA6 domain-containing protein vs. Ensembl Zebrafish
Match: spata6l (spermatogenesis associated 6-like [Source:ZFIN;Acc:ZDB-GENE-040426-1369])

HSP 1 Score: 69.3218 bits (168), Expect = 2.085e-12
Identity = 47/156 (30.13%), Postives = 80/156 (51.28%), Query Frame = 2
Query:   59 MTGKGFVCEVELNLHLLSSIGNHDCPGQLVYLSVEMFGTVHKTKPQHSYYPLLFNEVINFQKTFYSPSNENEVLDMLEDSSVVIELRRLDPCFYSGLLLSYFDGNAKEFLFSRFSRIPCSMNG--QEIYLDRTVDFSGTAPRLRYSIFADIKKVAS 520
            M  K     VEL+L  ++  G H      VYLSV +     K++   + +P+L  E I F+K     ++   + + L+  +V IEL +L P   +G +L+ F+ +A+ FLF     +P S +G  +E+ + R   F G +PRL +S    I +++S
Sbjct:    1 MPHKAVKVIVELHLRAITCPGVHLPAKDDVYLSVSLMNRYRKSECLPAVFPILIREKIRFEKILNYATDPEAIAEFLQYEAVKIELIQLIP--PAGEILASFEEDARSFLFPEPKLVP-SFSGVEREVLMTRHPTFPGISPRLEFSTKTTISEISS 153          
BLAST of SPATA6 domain-containing protein vs. Ensembl Zebrafish
Match: spata6l (spermatogenesis associated 6-like [Source:ZFIN;Acc:ZDB-GENE-040426-1369])

HSP 1 Score: 61.6178 bits (148), Expect = 1.879e-10
Identity = 42/138 (30.43%), Postives = 72/138 (52.17%), Query Frame = 2
Query:  131 CPG------QLVYLSVEMFGTVHKTKPQHSYYPLLFNEVINFQKTFYSPSNENEVLDMLEDSSVVIELRRLDPCFYSGLLLSYFDGNAKEFLFSRFSRIPCSMNG--QEIYLDRTVDFSGTAPRLRYSIFADIKKVAS 520
            CPG        VYLSV +     K++   + +P+L  E I F+K     ++   + + L+  +V IEL +L P   +G +L+ F+ +A+ FLF     +P S +G  +E+ + R   F G +PRL +S    I +++S
Sbjct:    9 CPGVHLPAKDDVYLSVSLMNRYRKSECLPAVFPILIREKIRFEKILNYATDPEAIAEFLQYEAVKIELIQLIPP--AGEILASFEEDARSFLFPEPKLVP-SFSGVEREVLMTRHPTFPGISPRLEFSTKTTISEISS 143          
BLAST of SPATA6 domain-containing protein vs. Ensembl Xenopus
Match: spata6l (spermatogenesis associated 6-like [Source:NCBI gene;Acc:779679])

HSP 1 Score: 58.151 bits (139), Expect = 1.472e-8
Identity = 42/149 (28.19%), Postives = 70/149 (46.98%), Query Frame = 2
Query:   86 VELNLHLLSSIGNHDCPGQL------VYLSVEMFGTVHKTKPQHSYYPLLFNEVINFQKTFYSPSNENEVLDMLEDSSVVIELRRLDPCFYSGLLLSYFDGNAKEFLFSRFSRIPCSMNGQEIYLDRTVD-FSGTAPRLRYSIFADIKK 511
            +EL +H ++      CPG        + L+V + G   +T    S +PLLF+E + F+K F    +   +   LE+     EL +L    +S  +L+ F+ N ++FLF      P         L +TV+ F G AP++ +S    IK+
Sbjct:    7 IELQIHAVT------CPGVFLPEKDDILLNVSILGQHKETGCLPSVFPLLFHEKMRFEKVFLKAVDPAALAQSLENHITRFELIQLT---HSADILAVFEENTRQFLFPEPKLTPAYPGVDREVLMKTVNGFPGIAPKIEFSTRTTIKE 146          
BLAST of SPATA6 domain-containing protein vs. Ensembl Mouse
Match: Spata6 (spermatogenesis associated 6 [Source:MGI Symbol;Acc:MGI:1915196])

HSP 1 Score: 72.4034 bits (176), Expect = 3.865e-13
Identity = 76/274 (27.74%), Postives = 129/274 (47.08%), Query Frame = 2
Query:   92 LNLHLLSSIGNHDCPGQL------VYLSVEMFGTVHKTKPQHSYYPLLFNEVINFQKTFYSPSNENEVLDMLEDSSVVIELRRLDPCFYSGLLLSYFDGNAKEFLFSRFSRIPCSMNG-----QEIYLDRTVDFSGTAPRLRYSIFADIKKVASSIETFNSESKYGVNNRSSDDGYYSPSQSVDKSY-RGQSRRSRSKKMAYDSGSIENLSNSKPYYTRQTVASALRSRSPSPVIN-KLSDYRDDSGIKDSEMSDVAYD---DYQKPPFVVRKV 865
            L   L   I +  CPG +      +YLS+ +FG   KT+   + +PL+FN  + F+K F    +  +V+  LE  + V EL +L P    G  LS +D N ++F+F      P  M+G     +++ + R     G AP+L +S  + I +   S     ++ K+  +           S  V+KS+ R Q R SRS+K    S        +   Y + T++S  +S SPSP    ++ +  +D+  + + ++   Y+   +  KPPFV+R V
Sbjct:    7 LQCALALEIRSVTCPGVVLKDKEDIYLSICVFGQYKKTQCVPATFPLVFNARMVFEKVFPEAVDPGDVVAQLEYDTAVFELIQLVPPV--GETLSTYDENTRDFMFPG----PNQMSGHHDSNRQVTMRRISGLRGIAPKLEFSTTSVITECLISSRKCRTQDKFTYH-----------SAPVEKSHGRLQCRTSRSQKKKSKSPERSKYCINTKNYEQPTISS--KSHSPSPYTKRRMCELSEDTRRRLAHLNLGPYEFKKETDKPPFVIRHV 261          
BLAST of SPATA6 domain-containing protein vs. Ensembl Mouse
Match: Spata6 (spermatogenesis associated 6 [Source:MGI Symbol;Acc:MGI:1915196])

HSP 1 Score: 72.4034 bits (176), Expect = 4.042e-13
Identity = 76/274 (27.74%), Postives = 129/274 (47.08%), Query Frame = 2
Query:   92 LNLHLLSSIGNHDCPGQL------VYLSVEMFGTVHKTKPQHSYYPLLFNEVINFQKTFYSPSNENEVLDMLEDSSVVIELRRLDPCFYSGLLLSYFDGNAKEFLFSRFSRIPCSMNG-----QEIYLDRTVDFSGTAPRLRYSIFADIKKVASSIETFNSESKYGVNNRSSDDGYYSPSQSVDKSY-RGQSRRSRSKKMAYDSGSIENLSNSKPYYTRQTVASALRSRSPSPVIN-KLSDYRDDSGIKDSEMSDVAYD---DYQKPPFVVRKV 865
            L   L   I +  CPG +      +YLS+ +FG   KT+   + +PL+FN  + F+K F    +  +V+  LE  + V EL +L P    G  LS +D N ++F+F      P  M+G     +++ + R     G AP+L +S  + I +   S     ++ K+  +           S  V+KS+ R Q R SRS+K    S        +   Y + T++S  +S SPSP    ++ +  +D+  + + ++   Y+   +  KPPFV+R V
Sbjct:    7 LQCALALEIRSVTCPGVVLKDKEDIYLSICVFGQYKKTQCVPATFPLVFNARMVFEKVFPEAVDPGDVVAQLEYDTAVFELIQLVP--PVGETLSTYDENTRDFMFPG----PNQMSGHHDSNRQVTMRRISGLRGIAPKLEFSTTSVITECLISSRKCRTQDKFTYH-----------SAPVEKSHGRLQCRTSRSQKKKSKSPERSKYCINTKNYEQPTISS--KSHSPSPYTKRRMCELSEDTRRRLAHLNLGPYEFKKETDKPPFVIRHV 261          
BLAST of SPATA6 domain-containing protein vs. Ensembl Mouse
Match: Spata6 (spermatogenesis associated 6 [Source:MGI Symbol;Acc:MGI:1915196])

HSP 1 Score: 62.3882 bits (150), Expect = 6.914e-11
Identity = 44/144 (30.56%), Postives = 71/144 (49.31%), Query Frame = 2
Query:   92 LNLHLLSSIGNHDCPGQL------VYLSVEMFGTVHKTKPQHSYYPLLFNEVINFQKTFYSPSNENEVLDMLEDSSVVIELRRLDPCFYSGLLLSYFDGNAKEFLFSRFSRIPCSMNG-----QEIYLDRTVDFSGTAPRLRYS 490
            L   L   I +  CPG +      +YLS+ +FG   KT+   + +PL+FN  + F+K F    +  +V+  LE  + V EL +L P    G  LS +D N ++F+F      P  M+G     +++ + R     G AP+L +S
Sbjct:    7 LQCALALEIRSVTCPGVVLKDKEDIYLSICVFGQYKKTQCVPATFPLVFNARMVFEKVFPEAVDPGDVVAQLEYDTAVFELIQLVP--PVGETLSTYDENTRDFMFPG----PNQMSGHHDSNRQVTMRRISGLRGIAPKLEFS 144          
BLAST of SPATA6 domain-containing protein vs. Ensembl Mouse
Match: 4430402I18Rik (RIKEN cDNA 4430402I18 gene [Source:MGI Symbol;Acc:MGI:1918036])

HSP 1 Score: 50.447 bits (119), Expect = 3.168e-6
Identity = 65/271 (23.99%), Postives = 111/271 (40.96%), Query Frame = 2
Query:   86 VELNLHLLSSIGNHDCPG------QLVYLSVEMFGTVHKTKPQHSYYPLLFNEVINFQKTFYSPSNENEVLDMLEDSSVVIELRRL-DPCFYSGLLLSYFDGNAKEFLFSRFSRIPCSMNG--QEIYLDRTVDFSGTAPRLRYSIFADIKKVASSIETFNSESKYGVNNRSSDDGYYSPSQSVDKSY--RGQSRRSRSKKMAYDSGSIENLSNSKPYYTRQTVASALRSRSPSPVINKLSDYRDDSGIKDSEMSDVAYDDYQKPPFVVRKV 865
            VEL +  +S      CPG      + VYL V +     +T      +P++  + + F K F    +   V ++LE      EL +L  P +     L+Y++ N ++FLF    R+  S  G  +E+ +   + F G AP++ +S    I +       F  ++++    R   +      +SV KS+  R Q+   + K    DS  +                   +SR PSP   +L  +R     + +      +   +KPPFVVR V
Sbjct:    7 VELQIRAIS------CPGVFLPDKEAVYLGVYLLNQYLETDCFPPVFPVVIQQSMRFVKVFEEAIDPGAVAELLESFLTRFELVQLVSPAWEE---LAYYEKNTRDFLFPE-PRLASSHLGMQREVLMKTAIWFPGIAPKIEFSTRTAILEC-----VFPCKNRFICEERCRLE------RSVSKSHGQRVQATNRKKKPKEKDSDQL---------------PKGTQSRLPSP--QRLHLHRP---TQRNHGKSFKFPGERKPPFVVRHV 236          
BLAST of SPATA6 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9NWH7|SPAT6_HUMAN (Spermatogenesis-associated protein 6 OS=Homo sapiens OX=9606 GN=SPATA6 PE=1 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 2.287e-12
Identity = 77/274 (28.10%), Postives = 132/274 (48.18%), Query Frame = 2
Query:   92 LNLHLLSSIGNHDCPGQL------VYLSVEMFGTVHKTKPQHSYYPLLFNEVINFQKTFYSPSNENEVLDMLEDSSVVIELRRLDPCFYSGLLLSYFDGNAKEFLFSRFSRIPCSMNG-----QEIYLDRTVDFSGTAPRLRYSIFADIKKVASSIETFNSESKYGVNNRSSDDGYYSPSQSVDKSY-RGQSRRSRSKKMAYDSGSIENLSNSKPYYTRQTVASALRSRSPSPVIN-KLSDYRDDSGIKDSEMSDVAYD---DYQKPPFVVRKV 865
            L   L   I +  CPG +      +YLS+ +FG   KT+   + +PL+FN  + F+K F    +  +V+  LE  + V EL +L P    G  LS +D N ++F+F      P  M+G     +++ + R     G APRL +S  + I +   S    +++ K+          + +P   V+KS+ R Q+R SRS+K    S        +   Y + T++S  +S SPSP    ++ +  +D+  + + ++   Y+   +  KPPFV+R V
Sbjct:    7 LQCALALEISSVTCPGVVLKDKEDIYLSICVFGQYKKTQCVPATFPLVFNARMVFEKVFPDAVDPGDVVTQLEYDTAVFELIQLVPPV--GETLSTYDENTRDFMFPG----PNQMSGHHDSNRQVTMRRISGLRGNAPRLEFSTTSVITECLISSRKCHTQDKFIY--------HLAP---VEKSHGRLQNRTSRSQKKKSKSPERSKYCINAKNYEQPTISS--KSHSPSPYTKRRMCELSEDTRRRLAHLNLGPYEFKKETDKPPFVIRHV 261          
BLAST of SPATA6 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q3U6K5|SPAT6_MOUSE (Spermatogenesis-associated protein 6 OS=Mus musculus OX=10090 GN=Spata6 PE=1 SV=2)

HSP 1 Score: 72.4034 bits (176), Expect = 2.827e-12
Identity = 76/274 (27.74%), Postives = 129/274 (47.08%), Query Frame = 2
Query:   92 LNLHLLSSIGNHDCPGQL------VYLSVEMFGTVHKTKPQHSYYPLLFNEVINFQKTFYSPSNENEVLDMLEDSSVVIELRRLDPCFYSGLLLSYFDGNAKEFLFSRFSRIPCSMNG-----QEIYLDRTVDFSGTAPRLRYSIFADIKKVASSIETFNSESKYGVNNRSSDDGYYSPSQSVDKSY-RGQSRRSRSKKMAYDSGSIENLSNSKPYYTRQTVASALRSRSPSPVIN-KLSDYRDDSGIKDSEMSDVAYD---DYQKPPFVVRKV 865
            L   L   I +  CPG +      +YLS+ +FG   KT+   + +PL+FN  + F+K F    +  +V+  LE  + V EL +L P    G  LS +D N ++F+F      P  M+G     +++ + R     G AP+L +S  + I +   S     ++ K+  +           S  V+KS+ R Q R SRS+K    S        +   Y + T++S  +S SPSP    ++ +  +D+  + + ++   Y+   +  KPPFV+R V
Sbjct:    7 LQCALALEIRSVTCPGVVLKDKEDIYLSICVFGQYKKTQCVPATFPLVFNARMVFEKVFPEAVDPGDVVAQLEYDTAVFELIQLVP--PVGETLSTYDENTRDFMFPG----PNQMSGHHDSNRQVTMRRISGLRGIAPKLEFSTTSVITECLISSRKCRTQDKFTYH-----------SAPVEKSHGRLQCRTSRSQKKKSKSPERSKYCINTKNYEQPTISS--KSHSPSPYTKRRMCELSEDTRRRLAHLNLGPYEFKKETDKPPFVIRHV 261          
BLAST of SPATA6 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q99MU5|SPAT6_RAT (Spermatogenesis-associated protein 6 OS=Rattus norvegicus OX=10116 GN=Spata6 PE=1 SV=2)

HSP 1 Score: 71.633 bits (174), Expect = 5.296e-12
Identity = 74/270 (27.41%), Postives = 128/270 (47.41%), Query Frame = 2
Query:   92 LNLHLLSSIGNHDCPGQL------VYLSVEMFGTVHKTKPQHSYYPLLFNEVINFQKTFYSPSNENEVLDMLEDSSVVIELRRLDPCFYSGLLLSYFDGNAKEFLFSRFSRIPCSMN-GQEIYLDRTVDFSGTAPRLRYSIFADIKKVASSIETFNSESKYGVNNRSSDDGYYSPSQSVDKSY-RGQSRRSRSKKMAYDSGSIENLSNSKPYYTRQTVASALRSRSPSPVIN-KLSDYRDDSGIKDSEMSDVAYD---DYQKPPFVVRKV 865
            L   L   I +  CPG L      +YLS+ +FG   KT+   + +PL+FN  + F+K F    +  +V+  LE  + V EL +L P    G  LS +D N ++F+F   ++I    +  +++ + R     G AP+L +S  + I +   S     ++ K+  +           S  V+K + R Q R SRS+K    S        +   Y + T++S  +S SPSP    ++ +  +D+  + + ++   Y+   +  KPPFV+R V
Sbjct:    7 LQCALALEIRSVTCPGVLLKDKEDIYLSICVFGQYKKTQCVPATFPLVFNARMVFEKVFPEAVDPGDVVAQLEYDTAVFELIQLVP--PVGETLSTYDENTRDFMFPGPNQISGHHDSNRQVTMRRISGLRGIAPKLEFSTTSVITECLISSRKCRTQDKFTYH-----------SAPVEKPHGRLQCRTSRSQKKKSKSPERSKYCINTKNYEQPTISS--KSHSPSPYTKRRMCELSEDTRRRLAHLNLGPYEFKKETDKPPFVIRHV 261          
BLAST of SPATA6 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q2KJG1|SPAT6_BOVIN (Spermatogenesis-associated protein 6 OS=Bos taurus OX=9913 GN=SPATA6 PE=2 SV=2)

HSP 1 Score: 65.4698 bits (158), Expect = 4.865e-10
Identity = 64/277 (23.10%), Postives = 125/277 (45.13%), Query Frame = 2
Query:   68 KGFVCEVELNLHLLSSIGNHDCPGQL------VYLSVEMFGTVHKTKPQHSYYPLLFNEVINFQKTFYSPSNENEVLDMLEDSSVVIELRRLDPCFYSGLLLSYFDGNAKEFLFSRFSRIPCSMN-GQEIYLDRTVDFSGTAPRLRYSIFADIKKVASSIETFNSESKYGVNNRSSDDGYYSPSQSVDKSYRGQSRRSRSKKMAYDSGSIENLSNSKPYYTRQTVASALRSRSPSPVIN-KLSDYRDDSGIKDSEMSDVAYD---DYQKPPFVVRKV 865
            K   C + L +  ++      CPG +      +YLS+ +FG   KT+   + +PL+FN  + F+K F    +  +V+  LE  + + EL +L P    G  LS +D N ++F+F   ++I    +  +++ + R     G AP+L +S  + I +   S     ++ K+  +    +  +        +S + +S+     K   ++ + E  + SK             S SPSP    ++ +  +D+  + + ++   Y+   +  KPPFV+R V
Sbjct:    5 KALQCALALEIRSVT------CPGVVLKDKEDIYLSICVFGQYKKTQCVPANFPLVFNARMVFEKVFPEAVDPGDVVAQLEYDTALFELIQLVPPV--GETLSTYDENTRDFMFPGPNQISGHHDSNRQVTMRRISGLRGIAPKLEFSTTSVITECLISSRKCRTQDKFVYHTAPVEKPHSRLQNRTSRSQKKKSKSPERNKYCINAKNYEQPTTSK-------------SHSPSPYTKRRMCELSEDTRRRLAHLNLGPYEFKKETDKPPFVIRHV 260          
BLAST of SPATA6 domain-containing protein vs. TrEMBL
Match: A0A1I8FZE3 (SPATA6 domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 1.534e-26
Identity = 84/287 (29.27%), Postives = 138/287 (48.08%), Query Frame = 2
Query:   62 TGKGFVCEVELNLHLLSSIGNHDCPGQLVYLSVEMFGTVHKTKPQHSYYPLLFNEVINFQKTFYSPSNENEVLDMLEDSSVVIELRRLDPCFYSGLLLSYFDGNAKEFLFSRFSRIPCSMNGQEIYLDRTVDFSGTAPRLRYSIFADIKKVASSIETFNSESKYGVNNRSSDDGYYSPSQSVDKSYRGQSRRSRSKKMAYDSGSIENLSNSKPYYTRQTVASALRSRSPSPVINKLSDYRDDSGIK------DSEMSDVAYDDYQKPPFVVRKVPDSLITRAPKLHD 904
            +G GF C +EL L ++SS G        ++L V +FG   +T+   + +PL  +E   F++ F++  +   V D+L D+ V +ELR++   +  G LL+Y + N ++F      R   S + ++I + RT+DF G  PRL ++ +A I+++        +    G               SV  +   +SR     +    SG           Y RQT+A+A+RSRSPSP +  L D  D+   +       S  +        +PPFVVR+V +SL+ R P +HD
Sbjct:    3 SGGGFKCTLELTLDVVSSPGTRLPIRDDLFLVVVVFGQAKRTRLLEAAFPLNVHERFQFERLFWTAEDAFVVADLLADAPVTLELRQVTDIYLGGCLLAYHETNCRDFFGPLAGRTSHSAS-RDILMTRTLDFPGVPPRLEFATYAAIEELLPGGGLLATSKANG--------------SSVGVNGARRSRSRSRSRRLRQSGGGGGSGGGANNYERQTLAAAMRSRSPSPRLKALCDDLDEPSTRSKKPPTKSAAAAACGASNGRPPFVVRRVENSLVGRTPNMHD 274          
BLAST of SPATA6 domain-containing protein vs. TrEMBL
Match: A0A267GAS0 (SPATA6 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031691g2 PE=4 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 2.781e-26
Identity = 84/287 (29.27%), Postives = 138/287 (48.08%), Query Frame = 2
Query:   62 TGKGFVCEVELNLHLLSSIGNHDCPGQLVYLSVEMFGTVHKTKPQHSYYPLLFNEVINFQKTFYSPSNENEVLDMLEDSSVVIELRRLDPCFYSGLLLSYFDGNAKEFLFSRFSRIPCSMNGQEIYLDRTVDFSGTAPRLRYSIFADIKKVASSIETFNSESKYGVNNRSSDDGYYSPSQSVDKSYRGQSRRSRSKKMAYDSGSIENLSNSKPYYTRQTVASALRSRSPSPVINKLSDYRDDSGIK------DSEMSDVAYDDYQKPPFVVRKVPDSLITRAPKLHD 904
            +G GF C +EL L ++SS G        ++L V +FG   +T+   + +PL  +E   F++ F++  +   V D+L D+ V +ELR++   +  G LL+Y + N ++F      R   S + ++I + RT+DF G  PRL ++ +A I+++        +    G               SV  +   +SR     +    SG           Y RQT+A+A+RSRSPSP +  L D  D+   +       S  +        +PPFVVR+V +SL+ R P +HD
Sbjct:    3 SGGGFKCTLELTLDVVSSPGTRLPIRDDLFLVVVVFGQAKRTRLLEAAFPLNVHERFQFERLFWTAEDAFVVADLLADAPVTLELRQVTDIYLGGCLLAYHETNCRDFFGPLAGRTSHSAS-RDILMTRTLDFPGVPPRLEFATYAAIEELLPGGGLLATSKANG--------------SSVGVNGARRSRSRSRSRRLRQSGGGGGSGGGANNYERQTLAAAMRSRSPSPRLKALCDDLDEPSTRSKKPPTKSAAAAACGASNGRPPFVVRRVENSLVGRTPNMHD 274          
BLAST of SPATA6 domain-containing protein vs. TrEMBL
Match: A0A267F156 (SPATA6 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig015750g1 PE=4 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 2.891e-26
Identity = 84/287 (29.27%), Postives = 138/287 (48.08%), Query Frame = 2
Query:   62 TGKGFVCEVELNLHLLSSIGNHDCPGQLVYLSVEMFGTVHKTKPQHSYYPLLFNEVINFQKTFYSPSNENEVLDMLEDSSVVIELRRLDPCFYSGLLLSYFDGNAKEFLFSRFSRIPCSMNGQEIYLDRTVDFSGTAPRLRYSIFADIKKVASSIETFNSESKYGVNNRSSDDGYYSPSQSVDKSYRGQSRRSRSKKMAYDSGSIENLSNSKPYYTRQTVASALRSRSPSPVINKLSDYRDDSGIK------DSEMSDVAYDDYQKPPFVVRKVPDSLITRAPKLHD 904
            +G GF C +EL L ++SS G        ++L V +FG   +T+   + +PL  +E   F++ F++  +   V D+L D+ V +ELR++   +  G LL+Y + N ++F      R   S + ++I + RT+DF G  PRL ++ +A I+++        +    G               SV  +   +SR     +    SG           Y RQT+A+A+RSRSPSP +  L D  D+   +       S  +        +PPFVVR+V +SL+ R P +HD
Sbjct:    3 SGGGFKCTLELTLDVVSSPGTRLPIRDDLFLVVVVFGQAKRTRLLEAAFPLNVHERFQFERLFWTAEDAFVVTDLLADAPVTLELRQVTDIYLGGCLLAYHETNCRDFFGPLAGRTSHSAS-RDILMTRTLDFPGVPPRLEFATYAAIEELLPGGGLLATSKANG--------------SSVGVNGARRSRSRSRSRRLRQSGGGGGSGGGANNYERQTLAAAMRSRSPSPRLKALCDDLDEPSTRSKKPPTKSAAAAACGASNGRPPFVVRRVENSLVGRTPTMHD 274          
BLAST of SPATA6 domain-containing protein vs. TrEMBL
Match: A0A267DQI1 (SPATA6 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig015750g2 PE=4 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 1.039e-25
Identity = 83/287 (28.92%), Postives = 138/287 (48.08%), Query Frame = 2
Query:   62 TGKGFVCEVELNLHLLSSIGNHDCPGQLVYLSVEMFGTVHKTKPQHSYYPLLFNEVINFQKTFYSPSNENEVLDMLEDSSVVIELRRLDPCFYSGLLLSYFDGNAKEFLFSRFSRIPCSMNGQEIYLDRTVDFSGTAPRLRYSIFADIKKVASSIETFNSESKYGVNNRSSDDGYYSPSQSVDKSYRGQSRRSRSKKMAYDSGSIENLSNSKPYYTRQTVASALRSRSPSPVINKLSDYRDDSGIK------DSEMSDVAYDDYQKPPFVVRKVPDSLITRAPKLHD 904
            +G GF C +EL L ++SS G        ++L V +FG   +T+   + +P+  +E   F++ F++  +   V D+L D+ V +ELR++   +  G LL+Y + N ++F      R   S + ++I + RT+DF G  PRL ++ +A I+++        +    G               SV  +   +SR     +    SG           Y RQT+A+A+RSRSPSP +  L D  D+   +       S  +        +PPFVVR+V +SL+ R P +HD
Sbjct:    3 SGGGFKCTLELTLDVVSSPGTRLPIRDDLFLVVIVFGQAKRTRLLEAAFPVNVHERFQFERLFWTAEDAFVVADLLADAPVTLELRQVTDIYLGGCLLAYHETNCRDFFGPLAGRTSHSAS-RDILMTRTLDFPGVPPRLEFATYAAIEELLPGGGLLATSKANG--------------SSVGVNGARRSRSRSRSRRLRQSGGGGGSGGGANNYERQTLAAAMRSRSPSPRLKALCDDLDEPSTRSKKPPTKSAAAAACGASNGRPPFVVRRVENSLVGRTPNMHD 274          
BLAST of SPATA6 domain-containing protein vs. TrEMBL
Match: A0A1I8IJV1 (SPATA6 domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 1.851e-24
Identity = 83/284 (29.23%), Postives = 126/284 (44.37%), Query Frame = 2
Query:   59 MTGKGFVCEVELNLHLLSSIGNHDCPGQLVYLSVEMFGTVHKTKPQHSYYPLLFNEVINFQKTFYSPSNENEVLDMLEDSSVVIELRRLDPCFYSGLLLSYFDGNAKEFLF-SRFSRIPCSMNGQEIYLDRTVDFSGTAPRLRYSIFADIKKVASSIETFNSESKYGVNNRSSDDGYYSPSQSVDKSYRGQ-SRRSRSKKMAYDSGSIENLSNSKPYYTRQTVASALRSRSPSPVINKLSDYRDDSGIKDSEMSDVAYDDYQKPPFVVRKVPDSLITRAPKLHD 904
            M  KGF C  E+ + L+ S G        VYL+++    V +++     +PL  +E   F+K F+  S+  +V+D LE+  + IELR+    F    LL+YFD + +EFLF S  +  P    G+E  + RTVDFSG +P+L +  +  ++++ +S                        S SV   + G+ +R  RS   A DS  +    + K              R PS     +S   D +     E     Y    +PPFVVR V D L  R P LH+
Sbjct:    1 MAPKGFRCTAEITIELVVSPGTWLPHRDDVYLTIDFLNQVKRSRLVAPVFPLRVHERFRFEKNFWPASDPRDVVDRLEELPIAIELRQATDAFRGSRLLAYFDSDGREFLFPSAPTSKPACHTGREALMARTVDFSGVSPKLEFCTYTVVEELRTSY-----------------------SGSVGDDFGGEVTRPRRSAAAAIDSVDLRARRHGK--------------RPPS-----MSKVDDSATAAAGEDRRAGYRTDDRPPFVVRHVADGLTGRKPVLHN 242          
BLAST of SPATA6 domain-containing protein vs. Ensembl Cavefish
Match: spata6 (spermatogenesis associated 6 [Source:NCBI gene;Acc:103025219])

HSP 1 Score: 88.1965 bits (217), Expect = 2.577e-18
Identity = 84/280 (30.00%), Postives = 130/280 (46.43%), Query Frame = 2
Query:   86 VELNLHLLSSIGNHDCPGQL------VYLSVEMFGTVHKTKPQHSYYPLLFNEVINFQKTFYSPSNENEVLDMLEDSSVVIELRRLDPCFYSGLLLSYFDGNAKEFLFSRFSRIPCSMNGQ-EIYLDRTVDFSGTAPRLRYSIFADIKKVASSIETFNSESKYGVNNRSSDDGYYSPSQSVDKSYRGQSRRSRSKKMAYDSGSIENLSNSKPYYTRQTVASALRSRSPSPVIN-KLSDYRDDSGIKDSEMSDVAY----DDYQKPPFVVRKVPDSLITRA 889
            V+L LH ++      CPG L      VYLSV M G  HKTK   S +PLL +E + F K F    +  ++ D LE+ +   EL +L P    G +L+    N ++FL+      P +   + EI + ++V F G +PR+ +S  + I++     +   S+S +  +N S           V  S  G+SR   S   A   G           Y + TVAS  +SRSPSP  + ++    +D+  + S +    Y    +   +PPFVV   PDS +T +
Sbjct:   17 VQLKLHAVT------CPGVLLPSHEDVYLSVRMMGRYHKTKCVPSVFPLLLHEKMVFTKIFSGAVDPGDIADHLENDTTCFELIQLVP--PEGEILATLQENTRDFLYPGPRLTPPAPGSEREILMKKSVSFPGISPRVEFSTTSVIEEC----DLKASQSTFSPSNSSPTKPC-----CVKTSPAGKSRMKPS--TAPLCG-----------YQQPTVAS--QSRSPSPYTHRRMCQLSEDTRQRLSHLQLGPYNFKKETAPQPPFVVPCSPDSSLTES 264          
BLAST of SPATA6 domain-containing protein vs. Ensembl Cavefish
Match: spata6l (spermatogenesis associated 6-like protein [Source:NCBI gene;Acc:103039467])

HSP 1 Score: 65.0846 bits (157), Expect = 5.617e-11
Identity = 41/141 (29.08%), Postives = 72/141 (51.06%), Query Frame = 2
Query:   86 VELNLHLLSSIGNHDCPGQLVYLSVEMFGTVHKTKPQHSYYPLLFNEVINFQKTFYSPSNENEVLDMLEDSSVVIELRRLDPCFYSGLLLSYFDGNAKEFLFSRFSRIPCSMNG-QEIYLDRTVDFSGTAPRLRYSIFADI 505
            VEL++  ++  G H      +YLS  +     K+    + +PLLF   + F+K F    +   + ++L+  +V IEL +L     +G +L+ ++ NA+ FLF     +P    G +E+ + R  +FSG +PRL +S    I
Sbjct:   10 VELHIRAITCPGVHLTAKDDIYLSACLLNQYRKSDCLPAVFPLLFRTKMRFEKIFKYAIDPAAIAEILQCETVKIELIQL--IRPAGEILATYEENARSFLFPEPKLVPSFSGGDREVLMTRDPNFSGISPRLEFSTRTTI 148          
BLAST of SPATA6 domain-containing protein vs. Ensembl Nematostella
Match: EDO34010 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQL7])

HSP 1 Score: 62.3882 bits (150), Expect = 1.962e-10
Identity = 45/163 (27.61%), Postives = 76/163 (46.63%), Query Frame = 2
Query:   59 MTGKGFVCEVELNLHLLSSIGNHDCPGQL------VYLSVEMFGTVHKTKPQHSYYPLLFNEVINFQKTFYSPSNENEVLDMLEDSSVVIELRRLDPCFYSGLLLSYFDGNAKEFLFSRFSRIPCSMNGQEIYLDRT-----VDFSGTAPRLRYSIFADIKKV 514
            M  K     VEL++H ++      CPG        VYL V   G    TK     +P+ F+E + F++ F S  +   V   L+   V++ELR+ D     G ++ ++  NA++FL+      P +  G+E+ L +T     +  +G   RL ++    IK+V
Sbjct:  188 MPRKAMKVIVELDVHTIT------CPGTFLRDYGYVYLKVNCMGLEVNTKSVPPTFPVFFHERLRFERVFKSCQDPAYVSIHLKGEDVLVELRQHDDYISDGYVIGHYANNARDFLYPAVPTYPGT--GRELTLFKTSLFNPIRITGQPLRLEFTTKTTIKEV 342          
BLAST of SPATA6 domain-containing protein vs. Planmine SMEST
Match: SMESG000013811.1 (SMESG000013811.1)

HSP 1 Score: 759.599 bits (1960), Expect = 0.000e+0
Identity = 394/396 (99.49%), Postives = 395/396 (99.75%), Query Frame = 2
Query:   59 MTGKGFVCEVELNLHLLSSIGNHDCPGQLVYLSVEMFGTVHKTKPQHSYYPLLFNEVINFQKTFYSPSNENEVLDMLEDSSVVIELRRLDPCFYSGLLLSYFDGNAKEFLFSRFSRIPCSMNGQEIYLDRTVDFSGTAPRLRYSIFADIKKVASSIETFNSESKYGVNNRSSDDGYYSPSQSVDKSYRGQSRRSRSKKMAYDSGSIENLSNSKPYYTRQTVASALRSRSPSPVINKLSDYRDDSGIKDSEMSDVAYDDYQKPPFVVRKVPDSLITRAPKLHDXXXXXXXXXXXXXXXXXXXXXXNLSSTSSVERRFRSASPSRKTDFETNFESYKPSTVLSSLRNAYEIPHYCCRYSTLGRCHSPLAEYYASKISRLSCLSPGRHHYCYSHCNHWL 1246
            MTGKGFVCEVELNLHLLSSIGNHDCPGQLVYLSVEMFGTVHKTKPQHSYYPLLFNEVINFQKTFYSPSNENEVLDMLEDSSVVIELRRLDPCFYSGLLLSYFDGNAKEFLFSRFSRIPCSMNGQEIYLDRTVDFSGTAPRLRYSIFADIKKVASSIETFNSESKYGVNNRSSDDGYYSPSQSVDKSYRGQSRRSRSKKMAYDSGSIENLSNSKPYYTRQTVASALRSRSPSPVINK SDYRDDSGIKDSEMSDVAYDDYQKPPFVVRKVPDSLITRAPKLHDSIARSNSRKSRSKRRQSPGKSKNLSSTSSVERRFRSASPSRKTDFETNFESYKPSTVLSSLRNAYEIPHYCCR+STLGRCHSPLAEYYASKISRLSCLSPGRHHYCYSHCNHWL
Sbjct:    1 MTGKGFVCEVELNLHLLSSIGNHDCPGQLVYLSVEMFGTVHKTKPQHSYYPLLFNEVINFQKTFYSPSNENEVLDMLEDSSVVIELRRLDPCFYSGLLLSYFDGNAKEFLFSRFSRIPCSMNGQEIYLDRTVDFSGTAPRLRYSIFADIKKVASSIETFNSESKYGVNNRSSDDGYYSPSQSVDKSYRGQSRRSRSKKMAYDSGSIENLSNSKPYYTRQTVASALRSRSPSPVINKSSDYRDDSGIKDSEMSDVAYDDYQKPPFVVRKVPDSLITRAPKLHDSIARSNSRKSRSKRRQSPGKSKNLSSTSSVERRFRSASPSRKTDFETNFESYKPSTVLSSLRNAYEIPHYCCRFSTLGRCHSPLAEYYASKISRLSCLSPGRHHYCYSHCNHWL 396          
BLAST of SPATA6 domain-containing protein vs. Planmine SMEST
Match: SMESG000053714.1 (SMESG000053714.1)

HSP 1 Score: 125.176 bits (313), Expect = 1.120e-31
Identity = 92/283 (32.51%), Postives = 140/283 (49.47%), Query Frame = 2
Query:   83 EVELNLHLLSSIGNHDCPGQLVYLSVEMFGTVHKTKPQHSYYPLLFNEVINFQKTFYSPSNENEVLDMLEDSSVVIELRRLDPCFYSGLLLSYFDGNAKEFLFSRFSRIPCSMNGQEIYLDRTVDFSGTAPRLRYSIFADIKKVASSIETFNSESKYGVNNRSSDDGYYSPSQSVDKSYRGQSRRSRSKKMAYDSGSIENLSNSKPYYTRQTVASALRSRSPSP---------VINKLSDYRDDSGIKDSEMS-DVAYDDYQKPPFVVRKVPDSLITRAPKLH 901
              E+ +H ++S G        +YL+++ F  V +TK     +PL F+E   F+K F+S ++  +V+  +ED  V +ELR++   +  G LLSYFD NA++F +   +  P S++ +E+ + RTVDF G +P++ +S +  + K+           K  VN              V  S   +SRR   K   Y S   E      P Y++ TV SALRSRSPSP         VI  +  +R    +KD ++      DD +  PFVVRKV D +  R PK H
Sbjct:    5 HCEITIHHITSPGTWLPNRDDLYLTIDSFNQVKRTKLSSPNFPLSFHEKFTFEKIFWSCADPKDVVSAMEDIPVTVELRQVADIYLGGTLLSYFDTNARDFFYPCSNLCPRSVSNRELLMIRTVDFPGISPKVEFSSYCVMDKMP----------KCTVNQ----------GDVVKCSKSCRSRRPADK--VYPSIFHE------PSYSKHTVNSALRSRSPSPMDREMAKGHVITDIIQHR----VKDKQLKYQTGIDDRE--PFVVRKVQDDMFVRKPKFH 253          
BLAST of SPATA6 domain-containing protein vs. Planmine SMEST
Match: SMESG000017199.1 (SMESG000017199.1)

HSP 1 Score: 90.1225 bits (222), Expect = 4.202e-19
Identity = 78/287 (27.18%), Postives = 131/287 (45.64%), Query Frame = 2
Query:   89 ELNLHLLSSIGNHDCPGQLVYLSVEMFGTVHKTKPQHSYYPLLFNEVINFQKTFYSPSNENEVLDMLEDSSVVIELRRLDPCFYSG----LLLSYFDGNAKEFLFSRFSRIPCSMN-GQEIYLDRTVDFSGTAPRLRYSIFADIKKVASSIETFNSESKYGVNNRSSDDGYYSPSQSVDKSYRGQSRRSRSKKMAYDSGSIENLSNSKPYYTRQTVASAL----RSRSPSPVINKLSDYRDDSGIKDSEMSDV------AYDDYQKPPFVVRKVPDSLITRAPKLHD 904
            E+ L ++    +  C    +Y++VE+FG   KTK  H Y+P+  N+  +F+K  +SP  + E   +L++S V IELR     F +G    +LL Y D NA EFL +       S+   ++I L++T    G +P+L++ I   IK   S     +   +Y          Y  P +     Y  +   SR  +    +G + +  N + + + +   S      + R+ S   N L   ++ S   + E+SD          +  +PPFVVRKVP  ++ R P  +D
Sbjct:   11 EMQLKMICVPHSKLCKFDHIYINVELFGETQKTKLMHPYFPIKSNDSFHFEKILWSPHTKKEAFKLLKESPVSIELRH----FMNGSSDSVLLGYADSNAYEFLIAGGEHEKDSVCVEKQIELNQTEYHCGPSPKLQFIIRTAIK--CSEAPVIDELLQY----------YSGPCRCCQAVY-NRCHSSRGGQYLVANGDLYS-CNCELHRSERDGTSHCNVCHQDRTLSVCENCLYKLKNKSKEYEDEISDFEEAKPNVNAEKMRPPFVVRKVPQDIVARIPDAYD 279          
BLAST of SPATA6 domain-containing protein vs. Planmine SMEST
Match: SMESG000073102.1 (SMESG000073102.1)

HSP 1 Score: 62.003 bits (149), Expect = 1.937e-10
Identity = 41/145 (28.28%), Postives = 68/145 (46.90%), Query Frame = 2
Query:   89 ELNLHLLSSIGNHDCPGQLVYLSVEMFGTVHKTKPQHSYYPLLFNEVINFQKTFYSPSNENEVLDMLEDSSVVIELRRLDPCFYSGLLLSYFDGNAKEFLFSRFSRIPCSMNGQEIYLDRTVDFSGTAPRLRYSIFADIKKVASS 523
            E+ L  +SS G       +V++ +++ G    +      +P+   E+  F KT    S+    L  LE     IELR+ +P F  G LL+YFD N  +      +R    +  +E+ + R+  F G +P+L   IF+   +V SS
Sbjct:    9 EIKLKCISSPGTRLRCRNMVFICIDLLGRYRSSYCHSPNFPICIGEIFKFHKTLPPCSDFCACLRYLEKLPFSIELRQDNPLFPKGDLLAYFDSNLTDITGLTSNRRSFKLQNRELLMIRSFSFQGISPKL---IFSSCVEVISS 150          
The following BLAST results are available for this feature:
BLAST of SPATA6 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SPATA64.716e-1328.10spermatogenesis associated 6 [Source:HGNC Symbol;A... [more]
SPATA64.762e-1328.10spermatogenesis associated 6 [Source:HGNC Symbol;A... [more]
SPATA61.792e-926.28spermatogenesis associated 6 [Source:HGNC Symbol;A... [more]
SPATA6L9.097e-926.38spermatogenesis associated 6 like [Source:HGNC Sym... [more]
SPATA6L9.097e-926.38spermatogenesis associated 6 like [Source:HGNC Sym... [more]
back to top
BLAST of SPATA6 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SPATA6 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SPATA6 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
spata61.244e-1326.41spermatogenesis associated 6 [Source:ZFIN;Acc:ZDB-... [more]
spata6l2.085e-1230.13spermatogenesis associated 6-like [Source:ZFIN;Acc... [more]
spata6l1.879e-1030.43spermatogenesis associated 6-like [Source:ZFIN;Acc... [more]
back to top
BLAST of SPATA6 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
spata6l1.472e-828.19spermatogenesis associated 6-like [Source:NCBI gen... [more]
back to top
BLAST of SPATA6 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Spata63.865e-1327.74spermatogenesis associated 6 [Source:MGI Symbol;Ac... [more]
Spata64.042e-1327.74spermatogenesis associated 6 [Source:MGI Symbol;Ac... [more]
Spata66.914e-1130.56spermatogenesis associated 6 [Source:MGI Symbol;Ac... [more]
4430402I18Rik3.168e-623.99RIKEN cDNA 4430402I18 gene [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of SPATA6 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q9NWH7|SPAT6_HUMAN2.287e-1228.10Spermatogenesis-associated protein 6 OS=Homo sapie... [more]
sp|Q3U6K5|SPAT6_MOUSE2.827e-1227.74Spermatogenesis-associated protein 6 OS=Mus muscul... [more]
sp|Q99MU5|SPAT6_RAT5.296e-1227.41Spermatogenesis-associated protein 6 OS=Rattus nor... [more]
sp|Q2KJG1|SPAT6_BOVIN4.865e-1023.10Spermatogenesis-associated protein 6 OS=Bos taurus... [more]
back to top
BLAST of SPATA6 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8FZE31.534e-2629.27SPATA6 domain-containing protein OS=Macrostomum li... [more]
A0A267GAS02.781e-2629.27SPATA6 domain-containing protein OS=Macrostomum li... [more]
A0A267F1562.891e-2629.27SPATA6 domain-containing protein OS=Macrostomum li... [more]
A0A267DQI11.039e-2528.92SPATA6 domain-containing protein OS=Macrostomum li... [more]
A0A1I8IJV11.851e-2429.23SPATA6 domain-containing protein OS=Macrostomum li... [more]
back to top
BLAST of SPATA6 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
spata62.577e-1830.00spermatogenesis associated 6 [Source:NCBI gene;Acc... [more]
spata6l5.617e-1129.08spermatogenesis associated 6-like protein [Source:... [more]
back to top
BLAST of SPATA6 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SPATA6 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SPATA6 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO340101.962e-1027.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SPATA6 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SPATA6 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000013811.10.000e+099.49SMESG000013811.1[more]
SMESG000053714.11.120e-3132.51SMESG000053714.1[more]
SMESG000017199.14.202e-1927.18SMESG000017199.1[more]
SMESG000073102.11.937e-1028.28SMESG000073102.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022233 ID=SMED30022233|Name=SPATA6 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1523bp
ATATATTGTTATGGCTACATAAATAGAAAAGTTTAAATTTTATTTGATAG
TTTCAATTATGACTGGTAAAGGATTTGTTTGTGAAGTTGAGTTGAATTTA
CATTTGTTATCTTCTATTGGTAATCATGATTGTCCGGGGCAATTGGTTTA
TTTATCAGTTGAGATGTTCGGAACCGTACATAAAACTAAGCCGCAACATT
CGTATTATCCATTGTTGTTTAATGAAGTTATAAATTTTCAAAAGACATTT
TACAGTCCTTCGAATGAAAATGAAGTGTTAGATATGTTAGAAGATTCATC
AGTCGTGATTGAATTAAGGCGTCTAGATCCTTGCTTTTATAGTGGCTTAT
TGTTATCGTACTTCGACGGAAATGCAAAAGAATTTTTATTTTCTAGATTC
TCCAGAATTCCATGTTCCATGAATGGTCAAGAAATTTATTTGGATAGAAC
TGTCGATTTTAGTGGAACTGCTCCACGTTTGAGATATAGTATATTTGCGG
ACATAAAAAAAGTTGCTTCATCTATTGAAACATTCAACTCTGAGTCTAAA
TATGGAGTTAATAATCGATCTAGTGACGATGGTTATTACTCTCCTTCACA
ATCTGTTGATAAATCTTATCGTGGTCAATCCAGAAGATCGAGATCAAAGA
AAATGGCTTATGATTCTGGTTCTATTGAGAATTTATCTAATTCAAAACCT
TATTATACCAGACAAACTGTAGCGAGTGCTTTAAGATCCAGATCGCCTTC
ACCAGTCATAAATAAATTAAGTGATTATCGTGATGATTCTGGAATCAAAG
ATTCTGAAATGAGCGATGTTGCCTATGATGATTATCAGAAGCCGCCGTTT
GTTGTAAGAAAAGTGCCGGATAGTTTAATAACCAGAGCTCCAAAGTTACA
CGACAGCATAGCTAGAAGTAATTCTAGGAAAAGTAGGTCAAAACGAAGAC
AATCACCTGGTAAAAGTAAAAATTTAAGTTCTACTTCAAGTGTAGAGAGA
AGATTTAGATCTGCTTCGCCTTCTCGCAAAACTGATTTCGAAACAAATTT
CGAAAGTTATAAACCTAGCACCGTTTTGTCAAGTTTAAGAAACGCCTACG
AAATACCTCATTATTGTTGCAGATATTCTACACTTGGCAGGTGCCACTCT
CCATTAGCTGAATATTATGCTAGTAAAATATCACGGCTCTCTTGCTTATC
ACCTGGTCGTCATCATTACTGCTACTCACACTGTAATCATTGGTTATAGT
CATTCATTTCCAATGATTTGCAATTAAGTTCAGATGAAATTACGTTATTA
ATTATATATTGTTTCATTATTAATATCTCTTGTCATTTTATTATTATCTG
CTGGGGTGATATAAAGGAATCAAATATTTAGATAATATCAATGCCCTAGA
TGACTGCTATAGACAGCTTGCACTATTATATTCACAGATTTATGATTTTT
TTAATGTGTTATTTAATTGTTATCTTCATTTGGTTTGTTGATCATTTTTT
AAATAAAATGCCTTGGATATAAA
back to top

protein sequence of SMED30022233-orf-1

>SMED30022233-orf-1 ID=SMED30022233-orf-1|Name=SMED30022233-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=397bp
MTGKGFVCEVELNLHLLSSIGNHDCPGQLVYLSVEMFGTVHKTKPQHSYY
PLLFNEVINFQKTFYSPSNENEVLDMLEDSSVVIELRRLDPCFYSGLLLS
YFDGNAKEFLFSRFSRIPCSMNGQEIYLDRTVDFSGTAPRLRYSIFADIK
KVASSIETFNSESKYGVNNRSSDDGYYSPSQSVDKSYRGQSRRSRSKKMA
YDSGSIENLSNSKPYYTRQTVASALRSRSPSPVINKLSDYRDDSGIKDSE
MSDVAYDDYQKPPFVVRKVPDSLITRAPKLHDSIARSNSRKSRSKRRQSP
GKSKNLSSTSSVERRFRSASPSRKTDFETNFESYKPSTVLSSLRNAYEIP
HYCCRYSTLGRCHSPLAEYYASKISRLSCLSPGRHHYCYSHCNHWL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007283spermatogenesis
Vocabulary: molecular function
TermDefinition
GO:0032027myosin light chain binding
GO:0005179hormone activity
Vocabulary: cellular component
TermDefinition
GO:0097224sperm connecting piece
GO:0005576extracellular region
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR042769SPATA6_fam
IPR032732SPATA6_N
IPR018116Somatotropin_CS
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR032732Spermatogenesis-associated protein 6, N-terminalPFAMPF14909SPATA6coord: 10..145
e-value: 6.6E-24
score: 84.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 170..204
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 222..238
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 170..187
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 301..316
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 277..324
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 222..247
IPR042769SPATA6 familyPANTHERPTHR16435SPERMATOGENESIS-ASSOCIATED PROTEIN 6 SPATA6coord: 1..342