Glutathione s-transferase

Overview
NameGlutathione s-transferase
Smed IDSMED30022232
Length (bp)844
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glutathione s-transferase (SMED30022232) t-SNE clustered cells

Violin plots show distribution of expression levels for Glutathione s-transferase (SMED30022232) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glutathione s-transferase (SMED30022232) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glutathione s-transferase (SMED30022232) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022232

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 23

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30022232SMESG000016846.1 dd_Smed_v4_1206_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30022232SMESG000016846.1 dd_Smed_v4_1206_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30022232SMESG000016846.1 dd_Smed_v4_1206_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30022232SMESG000016846.1 dd_Smed_v4_1206_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30022232SMESG000016846.1 dd_Smed_v4_1206_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30022232SMESG000016846.1 dd_Smed_v4_1206_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30022232SMESG000016846.1 dd_Smed_v4_1206_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30022232SMESG000016846.1 dd_Smed_v4_1206_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30022232SMESG000016846.1 dd_Smed_v4_1206_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30022232SMESG000016846.1 dd_Smed_v4_1206_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30022232SMESG000016846.1 dd_Smed_v4_1206_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022232SMESG000016846.1 Contig8931newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022232SMESG000016846.1 Contig8931uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022232SMESG000016846.1 Contig55581newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022232SMESG000016846.1 Contig55581uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pigment cellSMED30022232SMESG000016846.1 SMED30022232smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
progenitor cellSMED30022232SMESG000016846.1 dd_Smed_v6_1206_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30022232SMESG000016846.1 dd_Smed_v6_1206_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30022232SMESG000016846.1 dd_Smed_v6_1206_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neural progenitor cellSMED30022232SMESG000016846.1 dd_Smed_v6_1206_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle progenitor cellSMED30022232SMESG000016846.1 dd_Smed_v6_1206_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30022232SMESG000016846.1 dd_Smed_v6_1206_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30022232SMESG000016846.1 dd_Smed_v4_1206_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glutathione s-transferase vs. Ensembl Human
Match: HPGDS (hematopoietic prostaglandin D synthase [Source:HGNC Symbol;Acc:HGNC:17890])

HSP 1 Score: 95.9005 bits (237), Expect = 1.975e-23
Identity = 63/201 (31.34%), Postives = 107/201 (53.23%), Query Frame = 1
Query:  130 KITYFNAKAKAELIRLILVASNVDFEDKRIEFEDWPQLKPSIPSGQLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFNKIVDIFHEKDVEKSKLLRTEL--NETHLAIFLNRVSGYFTVHDGDFFLGSKPSYADLQL---VNIMDHFEESQYQNYPKIVKCYQQVLEHFPKIKEYKATRVAT 717
            K+TYFN + +AE+IR I    ++ +ED RIE  DWP++K ++P G++P++++  G  L++SLAIARY  K   LAG+ E+E+   D  V TLDD  +       ++DV K ++    L  N  HL   L+   G       ++ +G+  ++AD         +  F+     N+P++V   ++V +  P +  +   R  T
Sbjct:    5 KLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVD-GLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDV-KEQMFNELLTYNAPHLMQDLDTYLG-----GREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKV-QAIPAVANWIKRRPQT 197          
BLAST of Glutathione s-transferase vs. Ensembl Human
Match: GSTA3 (glutathione S-transferase alpha 3 [Source:HGNC Symbol;Acc:HGNC:4628])

HSP 1 Score: 70.0922 bits (170), Expect = 9.712e-14
Identity = 63/208 (30.29%), Postives = 105/208 (50.48%), Query Frame = 1
Query:  115 MAEKIKITYFNAKAKAELIRLILVASNVDFEDKRI-EFEDWPQLK--PSIPSGQLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFNKIVDIFHEKDVEKSKLLRTELNETHLAIFLNRV-SGYFTV-------HDGDFFLGSKPSYADLQLVNIMDHFEE---SQYQNYPKIVKCYQQVLEHFPKIKEY 696
            MA K K+ YFN + + E IR +L A+ V+FE+K I   ED  +L+   S+   Q+P+V++  G  L ++ AI  Y A KY+L G    E    D     + DL N+++ +          L R E  +  +A+   +  S YF         H  D+ +G+K S AD+ LV ++ + EE   S   N+P ++K  +  + + P +K++
Sbjct:    1 MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAEDLGKLRNDGSLMFQQVPMVEID-GMKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMADL-NEMILLL--------PLCRPEEKDAKIALIKEKTKSRYFPAFEKVLQSHGQDYLVGNKLSRADISLVELLYYVEELDSSLISNFP-LLKALKTRISNLPTVKKF 197          
BLAST of Glutathione s-transferase vs. Ensembl Human
Match: GSTA5 (glutathione S-transferase alpha 5 [Source:HGNC Symbol;Acc:HGNC:19662])

HSP 1 Score: 68.9366 bits (167), Expect = 2.748e-13
Identity = 60/204 (29.41%), Postives = 104/204 (50.98%), Query Frame = 1
Query:  115 MAEKIKITYFNAKAKAELIRLILVASNVDFEDKRIE-FEDWPQLK--PSIPSGQLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFNKIVDIF----HEKDVEKSKLLRTELNETHLAIFLNRVSGYFTVHDGDFFLGSKPSYADLQLVNIMDHFEE---SQYQNYPKIVKCYQQVLEHFPKIKEY 696
            MAEK K+ Y NA+   E IR +L A+ V+ E+K +E  ED  +L+   S+   Q+P+V++  G  L ++ AI  Y A KY+L G    E    D     + DL   I+ +      E+D  K+ L++ ++   +   F          H  D+ +G+K S+AD+ LV +  + EE   S   ++P ++K  +  + + P +K++
Sbjct:    1 MAEKPKLHYSNARGSMESIRWLLAAAGVELEEKFLESAEDLDKLRNDGSLLFQQVPMVEID-GMKLVQTRAILNYIASKYNLYGKDMKERALIDMYTEGIVDLTEMILLLLICQPEERDA-KTALVKEKIKNRYFPAF----EKVLKSHRQDYLVGNKLSWADIHLVELFYYVEELDSSLISSFP-LLKALKTRISNLPTVKKF 197          
BLAST of Glutathione s-transferase vs. Ensembl Human
Match: GSTA5 (glutathione S-transferase alpha 5 [Source:HGNC Symbol;Acc:HGNC:19662])

HSP 1 Score: 68.9366 bits (167), Expect = 2.748e-13
Identity = 60/204 (29.41%), Postives = 104/204 (50.98%), Query Frame = 1
Query:  115 MAEKIKITYFNAKAKAELIRLILVASNVDFEDKRIE-FEDWPQLK--PSIPSGQLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFNKIVDIF----HEKDVEKSKLLRTELNETHLAIFLNRVSGYFTVHDGDFFLGSKPSYADLQLVNIMDHFEE---SQYQNYPKIVKCYQQVLEHFPKIKEY 696
            MAEK K+ Y NA+   E IR +L A+ V+ E+K +E  ED  +L+   S+   Q+P+V++  G  L ++ AI  Y A KY+L G    E    D     + DL   I+ +      E+D  K+ L++ ++   +   F          H  D+ +G+K S+AD+ LV +  + EE   S   ++P ++K  +  + + P +K++
Sbjct:    1 MAEKPKLHYSNARGSMESIRWLLAAAGVELEEKFLESAEDLDKLRNDGSLLFQQVPMVEID-GMKLVQTRAILNYIASKYNLYGKDMKERALIDMYTEGIVDLTEMILLLLICQPEERDA-KTALVKEKIKNRYFPAF----EKVLKSHRQDYLVGNKLSWADIHLVELFYYVEELDSSLISSFP-LLKALKTRISNLPTVKKF 197          
BLAST of Glutathione s-transferase vs. Ensembl Human
Match: GSTA1 (glutathione S-transferase alpha 1 [Source:HGNC Symbol;Acc:HGNC:4626])

HSP 1 Score: 68.5514 bits (166), Expect = 3.961e-13
Identity = 61/204 (29.90%), Postives = 105/204 (51.47%), Query Frame = 1
Query:  115 MAEKIKITYFNAKAKAELIRLILVASNVDFEDKRIE-FEDWPQLKPS--IPSGQLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFNKIVDI----FHEKDVEKSKLLRTELNETHLAIFLNRVSGYFTVHDGDFFLGSKPSYADLQLVNIMDHFEE---SQYQNYPKIVKCYQQVLEHFPKIKEY 696
            MAEK K+ YFNA+ + E  R +L A+ V+FE+K I+  ED  +L+    +   Q+P+V++  G  L ++ AI  Y A KY+L G    E    D  +  + DL   I+ +      EKD  K  L++ ++   +   F          H  D+ +G+K S AD+ LV ++ + EE   S   ++P ++K  +  + + P +K++
Sbjct:    1 MAEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEID-GMKLVQTRAILNYIASKYNLYGKDIKERALIDMYIEGIADLGEMILLLPVCPPEEKDA-KLALIKEKIKNRYFPAF----EKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFP-LLKALKTRISNLPTVKKF 197          
BLAST of Glutathione s-transferase vs. Ensembl Celegans
Match: gst-4 (Glutathione S-transferase 4 [Source:UniProtKB/Swiss-Prot;Acc:Q21355])

HSP 1 Score: 100.908 bits (250), Expect = 1.421e-25
Identity = 63/204 (30.88%), Postives = 107/204 (52.45%), Query Frame = 1
Query:  130 KITYFNAKAKAELIRLILVASNVDFEDKRIEFEDWPQLKPSIPSGQLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDD---LFNKIV-DIFHEKDVEKSKLLRTELNETHLAIFLNRVSGYFTVHDGDFFLGSKPSYADLQLVNIMDHFEESQYQNYPKIVKC--YQQVLEHFPKIKEYKATRVATII 723
            K+ YF+A+A AE IR++    NV +ED R+  E+W +LKP+ P GQLP++Q+  G    +S++I RY A+K+ LAG    EE  AD  V    D    F +    +F+  D +    +R E+ E     FL  ++ +       F +G   ++AD+ + + +    ++ + ++ K  K   +   +   P+IK Y ATR  +I+
Sbjct:    5 KLLYFDARALAEPIRIMFAMLNVPYEDYRVSVEEWSKLKPTTPFGQLPILQVD-GEQFGQSMSITRYLARKFGLAGKTAEEEAYADSIVDQYRDFIFFFRQFTSSVFYGSDADHINKVRFEVVEPARDDFLAIINKFLAKSKSGFLVGDSLTWADIVIADNLTSLLKNGFLDFNKEKKLEEFYNKIHSIPEIKNYVATRKDSIV 207          
BLAST of Glutathione s-transferase vs. Ensembl Celegans
Match: gst-11 (Glutathione S-Transferase [Source:UniProtKB/TrEMBL;Acc:Q21945])

HSP 1 Score: 95.9005 bits (237), Expect = 9.769e-24
Identity = 60/189 (31.75%), Postives = 94/189 (49.74%), Query Frame = 1
Query:  130 KITYFNAKAKAELIRLILVASNVDFEDKRIEFEDWPQLKPSIPSGQLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFNKIVDIFHEKDVEKSKLLRTELNETHLAIFLNRVSGYFTVHDGDFFLGSKPSYADLQLVNIMDHFEESQYQNYPKIVKCYQQVLEHFPKIKEY 696
            K+ YFN   +AE  RLI   + V + D+R+E   WP++K + P G+LPV+ +  G  L +S  I RY  K + LAG  + E  K D  V  ++D   +I   F E+D  K   +  +L E+ +  F++        +   +F+G K SYADL + +I   F  S         K     L  +PK++E+
Sbjct:    4 KLQYFNMMGRAEPARLIFAYAGVQYTDERVEKSAWPEIKATTPHGKLPVLYVD-GAKLAQSRVIERYLGKVFGLAGETDWETAKMDELVACVEDFLIEIQPWFKEQDNAKKVEIFKKLIESTIIPFISAFENILVTNGTGYFVGDKISYADLAIFHIF-WFMNS---------KILPGALRKYPKLQEF 181          
BLAST of Glutathione s-transferase vs. Ensembl Celegans
Match: gst-3 (Glutathione S-transferase 3 [Source:UniProtKB/Swiss-Prot;Acc:O16116])

HSP 1 Score: 95.1301 bits (235), Expect = 1.746e-23
Identity = 61/202 (30.20%), Postives = 109/202 (53.96%), Query Frame = 1
Query:  130 KITYFNAKAKAELIRLILVASNVDFEDKRIEFEDWPQLKPSIPSGQLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDL---FNK-IVDIFHEKDVEKSKLLRTELNETHLAIFLNRVSGYFTVHDGDFFLGSKPSYADLQLVNIMDHFEESQYQNYP--KIVKCYQQVLEHFPKIKEYKATRVAT 717
            K+TYFNA+  AE+ R +   + V+FED+RI  E + QLKP+ PSGQ+P++ +  G   ++S AIARY A+K+   G    EE +AD  V T  D    F K ++ +   +  E  K +R E+ +  +  +   +          + +G++ ++ADL + + +     ++  +    K++K +++ +   PK+KE+ A R  T
Sbjct:    5 KLTYFNARGLAEISRQLFHMAGVEFEDERINEEKFSQLKPTFPSGQVPILCID-GAQFSQSTAIARYLARKFGFVGQTAEEELQADEVVDTFKDFIESFRKFVIAVLSGESEEILKNIREEVIKPAVKTYTAYLKAILEKSSSGYLVGNELTWADLVIADNLTTLINAELLDIENDKLLKEFREKIIETPKLKEWLAKRPET 205          
BLAST of Glutathione s-transferase vs. Ensembl Celegans
Match: gst-20 (Glutathione S-Transferase [Source:UniProtKB/TrEMBL;Acc:G5EC71])

HSP 1 Score: 94.3597 bits (233), Expect = 3.615e-23
Identity = 65/205 (31.71%), Postives = 101/205 (49.27%), Query Frame = 1
Query:  115 MAEKIKITYFNAKAKAELIRLILVASNVDFEDKRIEFEDWPQLKPSIPSGQLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFNKIVDIFHEK--------DVEKSKLLRTELNETHLAIFLNRVSGYFTVHDGDFFLGSKPSYADLQLVNIMDHF--EESQYQN-YPKIVKCYQQVLEHFPKIKEY 696
            MAE  K  YFN +   ++ R +   S   +ED RIE  DWP  KP +P GQ+PV++L+ G  + +S+AIARY AKK+  AG  + E   AD  +    D + +I   ++ K        + EK K L    ++     FL  +  +  +    F      +YADL + + M        +Y N YP I   YQ+V +  P+I+++
Sbjct:    1 MAE-YKFYYFNGRGLGDVSRQLFALSGTKYEDIRIEHADWPAQKPKMPFGQMPVLELSSGLQIPQSMAIARYLAKKFGYAGKTDEEAALADALIDQFKDFYAEIKPYYYAKIGVLQNDTEEEKKKTLIPARDK-----FLTIIGKFLKLSISGFLFSGGLTYADLMICDNMRTLIAWWPEYLNEYPDIKAWYQKV-DGIPEIRKH 198          
BLAST of Glutathione s-transferase vs. Ensembl Celegans
Match: gst-12 (Glutathione S-Transferase [Source:UniProtKB/TrEMBL;Acc:Q93695])

HSP 1 Score: 91.2781 bits (225), Expect = 6.281e-22
Identity = 66/207 (31.88%), Postives = 100/207 (48.31%), Query Frame = 1
Query:  130 KITYFNAKAKAELIRLILVASNVDFEDKRIEFED--WPQLKPSIPSGQLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFNK----IVDIFHEKDVEKSKLLRTELNETHLAIFLNRVSGYFTVHDGDFFLGSKPSYADLQLVNIMDHFEESQYQN---YPKIVKCYQQVLEHFPKIKEYKATRVATII 723
            K+TYF  +  AE  RL+   + V FED+R+ F D  W +LK   P GQ+PV+ +  G  + +S AI RY A+K+  AG    EE   D  V    D F +    I+     K VE+ + L  E+    ++ F   ++G        + +G   ++ADL +   M   +   + N    PKI    ++V  H PK+K Y A+R  T I
Sbjct:    5 KLTYFAVRGLAEPARLLFHLAGVPFEDERLTFGDGSWEKLKDKTPMGQMPVLNVD-GFEIPQSAAITRYLARKFGFAGKTPEEEAWVDAVVDQFKDFFGEFRKLIIAQRAGKSVEEIEKLTKEVINPAVSSFFKILNGLLEKSKSGYLIGDSITFADLFIAEDMQSLKNFGFLNATEQPKIAAHLEKVYSH-PKLKSYIASRPVTEI 209          
BLAST of Glutathione s-transferase vs. Ensembl Fly
Match: GstS1 (gene:FBgn0010226 transcript:FBtr0087005)

HSP 1 Score: 93.5893 bits (231), Expect = 2.152e-22
Identity = 63/185 (34.05%), Postives = 105/185 (56.76%), Query Frame = 1
Query:  139 YFNAKAKAELIRLILVASNVDFEDKRIEFEDWPQLKPSIPSGQLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFNKIVDIFHEKDVE-KSKLLRTELNETHLAIFLNRVSGYFTVHDGDFFLGSKPSYADLQLVNIMDHFEESQYQNYPKIVKCYQQVLEHFPKIK 690
            YFN KA AE +R +    N ++ED R+  ++WP LKP++P GQ+PV+++  G  +++S+++AR+ AK   L G+   E+ + D  V T++D   KI  + +E + E K K L T LN   +  +L ++      +DG   LG K ++AD+    I D      Y NY  +VK  + +LE +P ++
Sbjct:   54 YFNVKALAEPLRYLFAYGNQEYEDVRVTRDEWPALKPTMPMGQMPVLEVD-GKRVHQSISMARFLAKTVGLCGATPWEDLQIDIVVDTINDFRLKIAVVSYEPEDEIKEKKLVT-LNAEVIPFYLEKLEQTVKDNDGHLALG-KLTWADVYFAGITD------YMNY--MVK--RDLLEPYPALR 225          
BLAST of Glutathione s-transferase vs. Ensembl Fly
Match: GstS1 (gene:FBgn0010226 transcript:FBtr0100258)

HSP 1 Score: 93.5893 bits (231), Expect = 2.152e-22
Identity = 63/185 (34.05%), Postives = 105/185 (56.76%), Query Frame = 1
Query:  139 YFNAKAKAELIRLILVASNVDFEDKRIEFEDWPQLKPSIPSGQLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFNKIVDIFHEKDVE-KSKLLRTELNETHLAIFLNRVSGYFTVHDGDFFLGSKPSYADLQLVNIMDHFEESQYQNYPKIVKCYQQVLEHFPKIK 690
            YFN KA AE +R +    N ++ED R+  ++WP LKP++P GQ+PV+++  G  +++S+++AR+ AK   L G+   E+ + D  V T++D   KI  + +E + E K K L T LN   +  +L ++      +DG   LG K ++AD+    I D      Y NY  +VK  + +LE +P ++
Sbjct:   54 YFNVKALAEPLRYLFAYGNQEYEDVRVTRDEWPALKPTMPMGQMPVLEVD-GKRVHQSISMARFLAKTVGLCGATPWEDLQIDIVVDTINDFRLKIAVVSYEPEDEIKEKKLVT-LNAEVIPFYLEKLEQTVKDNDGHLALG-KLTWADVYFAGITD------YMNY--MVK--RDLLEPYPALR 225          
BLAST of Glutathione s-transferase vs. Ensembl Fly
Match: GstS1 (gene:FBgn0010226 transcript:FBtr0087006)

HSP 1 Score: 93.5893 bits (231), Expect = 2.152e-22
Identity = 63/185 (34.05%), Postives = 105/185 (56.76%), Query Frame = 1
Query:  139 YFNAKAKAELIRLILVASNVDFEDKRIEFEDWPQLKPSIPSGQLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFNKIVDIFHEKDVE-KSKLLRTELNETHLAIFLNRVSGYFTVHDGDFFLGSKPSYADLQLVNIMDHFEESQYQNYPKIVKCYQQVLEHFPKIK 690
            YFN KA AE +R +    N ++ED R+  ++WP LKP++P GQ+PV+++  G  +++S+++AR+ AK   L G+   E+ + D  V T++D   KI  + +E + E K K L T LN   +  +L ++      +DG   LG K ++AD+    I D      Y NY  +VK  + +LE +P ++
Sbjct:   54 YFNVKALAEPLRYLFAYGNQEYEDVRVTRDEWPALKPTMPMGQMPVLEVD-GKRVHQSISMARFLAKTVGLCGATPWEDLQIDIVVDTINDFRLKIAVVSYEPEDEIKEKKLVT-LNAEVIPFYLEKLEQTVKDNDGHLALG-KLTWADVYFAGITD------YMNY--MVK--RDLLEPYPALR 225          
BLAST of Glutathione s-transferase vs. Ensembl Fly
Match: GstS1 (gene:FBgn0010226 transcript:FBtr0333551)

HSP 1 Score: 89.3521 bits (220), Expect = 9.521e-21
Identity = 59/187 (31.55%), Postives = 104/187 (55.61%), Query Frame = 1
Query:  139 YFNAKAKAELIRLILVASNVDFEDKRIEFEDWPQLKPSIPSGQLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDL---FNKIVDIFHEKDVEKSKLLRTELNETHLAIFLNRVSGYFTVHDGDFFLGSKPSYADLQLVNIMDHFEESQYQNYPKIVKCYQQVLEHFPKIK 690
            YFN KA AE +R +    N ++ED R+  ++WP LKP++P GQ+PV+++  G  +++S+++AR+ AK   L G+   E+ + D  V T++D      + V    E ++++ KL+   LN   +  +L ++      +DG   LG K ++AD+    I D      Y NY  +VK  + +LE +P ++
Sbjct:   54 YFNVKALAEPLRYLFAYGNQEYEDVRVTRDEWPALKPTMPMGQMPVLEVD-GKRVHQSISMARFLAKTVGLCGATPWEDLQIDIVVDTINDFRLSSEQFVSYEPEDEIKEKKLVT--LNAEVIPFYLEKLEQTVKDNDGHLALG-KLTWADVYFAGITD------YMNY--MVK--RDLLEPYPALR 226          
BLAST of Glutathione s-transferase vs. Ensembl Zebrafish
Match: gsta.1 (glutathione S-transferase, alpha tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2720])

HSP 1 Score: 50.8322 bits (120), Expect = 3.935e-7
Identity = 56/200 (28.00%), Postives = 93/200 (46.50%), Query Frame = 1
Query:  115 MAEKIKITYFNAKAKAELIRLILVASNVDFEDKRI-EFEDWPQL--KPSIPSGQLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFNKIVDIFHEKDVEKSKLLRTELNETHLAIFLNRVSGYFTVHDGDFFLGSKPSYADLQLVNIMDHFEE---SQYQNYPKIVKCYQQVLEHFPKIKEY 696
            M+ K+ + YFN + K E IR +L A+ V FE+  + E E + +L    ++   Q+P+V++  G  L +S AI  Y A KY+L G    E    D     L DL   I+         K K+  + + E     FL        + +  F +G + S AD+ L+      +E   S    +PKI + +Q+ ++  P I ++
Sbjct:    1 MSGKVVLHYFNGRGKMESIRWLLAAAGVQFEEVFLTEKEQFDKLLSDGALTFQQVPLVEID-GMKLVQSKAILNYIAGKYNLYGKDLKERAMIDIYSEGLIDLMEMIMVSPFTPAENKEKVF-SNIEEKAKVRFLPVFEK--ALANSSFLVGKQLSRADVHLLEATLMLQELFPSILATFPKI-QAFQEQMKALPAISKF 195          
BLAST of Glutathione s-transferase vs. Ensembl Zebrafish
Match: gsta.1 (glutathione S-transferase, alpha tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2720])

HSP 1 Score: 50.8322 bits (120), Expect = 3.935e-7
Identity = 56/200 (28.00%), Postives = 93/200 (46.50%), Query Frame = 1
Query:  115 MAEKIKITYFNAKAKAELIRLILVASNVDFEDKRI-EFEDWPQL--KPSIPSGQLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFNKIVDIFHEKDVEKSKLLRTELNETHLAIFLNRVSGYFTVHDGDFFLGSKPSYADLQLVNIMDHFEE---SQYQNYPKIVKCYQQVLEHFPKIKEY 696
            M+ K+ + YFN + K E IR +L A+ V FE+  + E E + +L    ++   Q+P+V++  G  L +S AI  Y A KY+L G    E    D     L DL   I+         K K+  + + E     FL        + +  F +G + S AD+ L+      +E   S    +PKI + +Q+ ++  P I ++
Sbjct:    1 MSGKVVLHYFNGRGKMESIRWLLAAAGVQFEEVFLTEKEQFDKLLSDGALTFQQVPLVEID-GMKLVQSKAILNYIAGKYNLYGKDLKERAMIDIYSEGLIDLMEMIMVSPFTPAENKEKVF-SNIEEKAKVRFLPVFEK--ALANSSFLVGKQLSRADVHLLEATLMLQELFPSILATFPKI-QAFQEQMKALPAISKF 195          
BLAST of Glutathione s-transferase vs. Ensembl Zebrafish
Match: AL929536.3 (pep chromosome:GRCz11:13:835390:840787:1 gene:ENSDARG00000113274.1 transcript:ENSDART00000171329.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL929536.3)

HSP 1 Score: 50.0618 bits (118), Expect = 7.812e-7
Identity = 54/202 (26.73%), Postives = 88/202 (43.56%), Query Frame = 1
Query:  115 MAEKIKITYFNAKAKAELIRLILVASNVDFEDKRIEFEDWPQLKPSIPSG-----QLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFNKIVDIFHEKDVEKSKLLRTELNETHLAIFLNRVSGYFTVHDGDFFLGSKPSYADLQLVNIMDHFEE---SQYQNYPKIVKCYQQVLEHFPKIKEY 696
            M+ K+ + YFN + + E IR +L A+ V FE+  +   +  Q    +  G     Q+P+V++  G  L +S AI  Y A KY+L G    E    D     L DL   I+         K +  R  + E     FL        + +  F +G + S AD+ L+      +E   S    +PKI + +Q  ++  P I ++
Sbjct:    1 MSGKVVLHYFNGRGRMESIRWLLAAAGVQFEE--VFLTEKEQFDKLLSDGVLTFQQVPLVEID-GMKLVQSKAILNYIAGKYNLYGKDLKERAMIDIYSEGLIDLMGMIIMAPFTPAENKEETFRN-IEEKAKVRFLPVFEK--ALANSSFLVGKQLSRADVHLLEATLMLQELFPSILATFPKI-QAFQDQMKALPAISKF 195          
BLAST of Glutathione s-transferase vs. Ensembl Zebrafish
Match: AL929536.1 (pep chromosome:GRCz11:CHR_ALT_CTG13_1_1:843683:849080:1 gene:ENSDARG00000110578.1 transcript:ENSDART00000182617.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL929536.1)

HSP 1 Score: 50.0618 bits (118), Expect = 7.812e-7
Identity = 54/202 (26.73%), Postives = 88/202 (43.56%), Query Frame = 1
Query:  115 MAEKIKITYFNAKAKAELIRLILVASNVDFEDKRIEFEDWPQLKPSIPSG-----QLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFNKIVDIFHEKDVEKSKLLRTELNETHLAIFLNRVSGYFTVHDGDFFLGSKPSYADLQLVNIMDHFEE---SQYQNYPKIVKCYQQVLEHFPKIKEY 696
            M+ K+ + YFN + + E IR +L A+ V FE+  +   +  Q    +  G     Q+P+V++  G  L +S AI  Y A KY+L G    E    D     L DL   I+         K +  R  + E     FL        + +  F +G + S AD+ L+      +E   S    +PKI + +Q  ++  P I ++
Sbjct:    1 MSGKVVLHYFNGRGRMESIRWLLAAAGVQFEE--VFLTEKEQFDKLLSDGVLTFQQVPLVEID-GMKLVQSKAILNYIAGKYNLYGKDLKERAMIDIYSEGLIDLMGMIIMAPFTPAENKEETFRN-IEEKAKVRFLPVFEK--ALANSSFLVGKQLSRADVHLLEATLMLQELFPSILATFPKI-QAFQDQMKALPAISKF 195          
BLAST of Glutathione s-transferase vs. Ensembl Zebrafish
Match: gsta.2 (glutathione S-transferase, alpha tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-070822-30])

HSP 1 Score: 48.521 bits (114), Expect = 2.316e-6
Identity = 53/204 (25.98%), Postives = 92/204 (45.10%), Query Frame = 1
Query:  115 MAEKIKITYFNAKAKAELIRLILVASNVDFEDKRIEFEDWPQLKPSIPSG-----QLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFNKIV--DIFHEKDVEKSKLLRTELNETHLAIFLNRVSGYFTVHDGDFFLGSKPSYADLQLVNIMDHFEE---SQYQNYPKIVKCYQQVLEHFPKIKEY 696
            M+ K+ + YFN + + E IR +L  + V FE+  + F    Q    +  G     Q+P+V++  G  L +S AI  Y A KY+L G    E    D     L DL   I+   +    +++K+    + + E     FL        + +  F +G + S AD+ L+      +E   S    +PKI + +Q+ ++  P I ++
Sbjct:    1 MSGKVVLHYFNGRGRMESIRWLLAVAGVQFEE--VFFTKKEQFDKLLNDGALTFQQVPLVEID-GMKLVQSKAILNYIAGKYNLYGKDLKERAMIDIYSEGLIDLMEMIIMAPLGPADNIQKT---YSSIEEKAKVRFLPVFEK--ALANSSFLVGKQLSRADVHLLEATLMLQELFPSILATFPKI-QAFQEQMKALPAISKF 195          
BLAST of Glutathione s-transferase vs. Ensembl Xenopus
Match: hpgds (hematopoietic prostaglandin D synthase [Source:NCBI gene;Acc:448666])

HSP 1 Score: 119.783 bits (299), Expect = 1.601e-32
Identity = 70/195 (35.90%), Postives = 107/195 (54.87%), Query Frame = 1
Query:  133 ITYFNAKAKAELIRLILVASNVDFEDKRIEFEDWPQLKPSIPSGQLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFNKIVDIFHEKDVEKSKLLRTELNETHLAIFLNRVSGYFTVHDGDFFLGSKPSYADLQLVNIMDHFEE---SQYQNYPKIVKCYQQVLEHFPKIKEYKATR 708
            + YFN + + E++R +   S++ FED+RIEF DWP LKP IP GQLPVV++  G I N+SLA+ RY AKK  L G  +++E + D  + T+DD F+K    F   D EK+K    E +   L  +L +     T+ +  +F+G   ++AD       D FE       ++YPK++    +V +  P I  +   R
Sbjct:    6 LKYFNLEGRGEILRYLFSYSDIPFEDQRIEFADWPALKPKIPYGQLPVVEID-GVIYNQSLAVGRYLAKKGGLIGKNDLDEIRVDALIDTIDDFFSK----FPWMDTEKAKKEFMEKSGPQLLSYLEK-----TLGNNSWFVGDSVTWADFYWDTCSDSFENYVPGFAKDYPKLLALKDRV-KAIPAIAAWIKKR 189          
BLAST of Glutathione s-transferase vs. Ensembl Xenopus
Match: gsta4 (glutathione S-transferase alpha 4 [Source:NCBI gene;Acc:549430])

HSP 1 Score: 73.559 bits (179), Expect = 7.710e-15
Identity = 59/201 (29.35%), Postives = 102/201 (50.75%), Query Frame = 1
Query:  115 MAEKIKITYFNAKAKAELIRLILVASNVDFEDKRIE----FEDWPQLKPSIPSGQLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFNKIVDIFHEKDVEKSKLLRTELNETHLAIFLNRVSGYFTVHDGDFFLGSKPSYADLQLVNIMDHFEESQ---YQNYPKIVKCYQQVLEHFPKIKEY 696
            M+EK K+ YFN + K E IR +L A+ V+FE++ IE    FE   Q   ++P  Q+PVV++  G  L ++ AI +Y A KY+L G   +E    D  V    +    I+     ++VE    +   + +  +  +L         H  DF +G++ S+AD+QL+  +   EE       N+P +++ +++ +   P IK +
Sbjct:    1 MSEKPKLHYFNGRGKMESIRWLLAAAGVEFEEEMIETREQFEALFQ-DGNLPFKQVPVVEMD-GMKLVQTKAILQYIAAKYNLYGKDIVERVLIDMYVEGTTEFMEVIMSQPFLQNVEPGMQIDVLVQKAKMC-YLPVYEKVLRDHGQDFLVGNQFSWADIQLLEAILMIEEKSANVLSNFP-LLQDFKERISEIPTIKAF 197          
BLAST of Glutathione s-transferase vs. Ensembl Xenopus
Match: ENSXETT00000044727.1 (glutathione S-transferase 3-like [Source:NCBI gene;Acc:100496158])

HSP 1 Score: 69.3218 bits (168), Expect = 2.808e-13
Identity = 57/204 (27.94%), Postives = 98/204 (48.04%), Query Frame = 1
Query:  106 SNKMAEKIKITYFNAKAKAELIRLILVASNVDFEDKRIE-FEDWPQL--KPSIPSGQLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFNKIVDIFHEKDVEKSK---LLRTELNETHLAIFLNRVSGYFTVHDGDFFLGSKPSYADLQLVNIMDHFEESQYQNYPKIVKCYQQVLEHFPKIKEYK 699
            +N MAEK  + YFN + + E IR +L A+ ++FE+  +E  E + QL  +  +  GQ+P+V++  G  L ++  I  Y A KY+L G    E Y+ DR      DL    +      D  K K   L++      +  ++         + D D+ +G+K S+AD+QL+  +   EE            +  +L  FP+++ +K
Sbjct:   25 TNTMAEKPVLYYFNGRGRMESIRWLLGAAGIEFEEVYLEKREQYEQLIKEGRLMFGQVPLVEMD-GMNLTQTHPILSYIAAKYNLYGKDPKERYEIDRYADGTIDLMGLGLAYPFLDDAGKEKQKGLIKERATNKYFPVYET------ALKDKDYLVGNKFSWADIQLMEAILMVEE-----------FHSDILSCFPQLQAFK 210          
BLAST of Glutathione s-transferase vs. Ensembl Xenopus
Match: ENSXETT00000044740.1 (glutathione S-transferase 3-like [Source:NCBI gene;Acc:100496158])

HSP 1 Score: 66.6254 bits (161), Expect = 1.592e-12
Identity = 55/190 (28.95%), Postives = 93/190 (48.95%), Query Frame = 1
Query:  115 MAEKIKITYFNAKAKAELIRLILVASNVDFEDKRIE-FEDWPQL--KPSIPSGQLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFNKIVDIFHEKDVEKSK---LLRTELNETHLAIFLNRVSGYFTVHDGDFFLGSKPSYADLQLVNIMDHFEESQYQNYPKIVKCYQQV 666
            MAEK  + YFN + + E IR +L A+ ++FE+  +E  E + QL  +  +  GQ+P+V++  G  L ++  I  Y A KY+L G    E Y+ DR      DL    +      D  K K   L++      +  ++         + D D+ +G+K S+AD+QL+  +   EE     +  I+ C+ Q+
Sbjct:    1 MAEKPVLYYFNGRGRMESIRWLLGAAGIEFEEVYLEKREQYEQLIKEGRLMFGQVPLVEMD-GMNLTQTHPILSYIAAKYNLYGKDPKERYEIDRYADGTIDLMGLGLAYPFLDDAGKEKQKGLIKERATNKYFPVYET------ALKDKDYLVGNKFSWADIQLMEAILMVEEF----HSDILSCFPQL 179          
BLAST of Glutathione s-transferase vs. Ensembl Xenopus
Match: nemp1 (nuclear envelope integral membrane protein 1 [Source:Xenbase;Acc:XB-GENE-974573])

HSP 1 Score: 61.2326 bits (147), Expect = 1.169e-10
Identity = 57/196 (29.08%), Postives = 90/196 (45.92%), Query Frame = 1
Query:  133 ITYFNAKAKAELIRLILVASNVDFEDKRIEFEDWPQLKPSIPS----GQLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFNKIVD-IFHEKDVEKSKLLRTELNETHLAIFLNRVSGYFTVHDGDFFLGSKPSYADLQLVNIMD-HFEESQ--YQNYPKIVKCYQQVLEHFPKIKEY 696
            + YF  + +AE IRL+L    +D+E+  ++  DW   K         GQLP  +     +L +S +I RY   K+ L GS   E    D     ++DL  K    ++ E +  K K L T      L +F   +S     +   F +G+K SYAD  L++ +  H + S     NYP ++  Y + L   PK+ +Y
Sbjct:    6 LIYFPVRGRAEAIRLLLADQGIDWEEDEVQIADWVSGKDGRKKDAVFGQLPGFR-DGDFVLYQSNSILRYLGNKHGLDGSDAHERAVVDMVNSGVEDLRQKYGRFLYFEYETGKDKYLETL--PAQLDLFERILSK--NANGSAFIVGNKISYADYNLLDTLHCHIDLSPTCLSNYP-LLSAYVERLVSRPKLAKY 195          
BLAST of Glutathione s-transferase vs. Ensembl Mouse
Match: Hpgds (hematopoietic prostaglandin D synthase [Source:MGI Symbol;Acc:MGI:1859384])

HSP 1 Score: 100.523 bits (249), Expect = 2.525e-25
Identity = 64/199 (32.16%), Postives = 105/199 (52.76%), Query Frame = 1
Query:  130 KITYFNAKAKAELIRLILVASNVDFEDKRIEFEDWPQLKPSIPSGQLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFNKIVDIFHEKDVEKSKLLRTELNETHLAIFLNRVSGYFTVHDGDFFLGSKPSYADLQL---VNIMDHFEESQYQNYPKIVKCYQQVLEHFPKIKEYKATRVAT 717
            K+ YFN + +AE+IR I    ++ +ED RIE  DWP++KP++P G++PV+++  G  +++SLAIARY  K   LAG   +E+ +AD  V TLDD  +     + EKD +  + +  EL        L  +  Y  + D ++F+G+  ++AD         +   +      YPK+V    +V +  P I  +   R  T
Sbjct:    5 KLLYFNMRGRAEIIRYIFAYLDIKYEDHRIEQADWPKIKPTLPFGKIPVLEVE-GLTIHQSLAIARYLTKNTDLAGKTALEQCQADAVVDTLDDFMSLFP--WAEKDQDLKERMFNELLTHQAPRLLKDLDTY--LGDKEWFIGNYVTWADFYWDICSTTLLVLKPGLLDIYPKLVSLRNKV-QAIPAISAWILKRPQT 197          
BLAST of Glutathione s-transferase vs. Ensembl Mouse
Match: Gsta4 (glutathione S-transferase, alpha 4 [Source:MGI Symbol;Acc:MGI:1309515])

HSP 1 Score: 67.0106 bits (162), Expect = 9.237e-13
Identity = 61/212 (28.77%), Postives = 100/212 (47.17%), Query Frame = 1
Query:  115 MAEKIKITYFNAKAKAELIRLILVASNVDFEDKRIEF-EDWPQLKPS--IPSGQLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFNKIVDIFHEKDVEKSKLLRTELNETHLAIFLNRVSGYFTV-------HDGDFFLGSKPSYADLQLVNIMDHFEESQYQNYPKIVKCYQQVLEHFPKIKEYKATRVATI 720
            MA K K+ YFN + + E IR +L A+ V+FE++ +E  E + +++    +  GQ+P+V++  G +L ++ AI  Y A KY+L G    E  + D       DL   I     +   EK         E++  I     + YF V       H   F +G++ S+AD+QL+  +   EE               VL  FP ++ +K TR++ I
Sbjct:    1 MAAKPKLYYFNGRGRMESIRWLLAAAGVEFEEEFLETREQYEKMQKDGHLLFGQVPLVEID-GMMLTQTRAILSYLAAKYNLYGKDLKERVRIDMYADGTQDLMMMIAVAPFKTPKEK--------EESYDLILSRAKTRYFPVFEKILKDHGEAFLVGNQLSWADIQLLEAILMVEE-----------LSAPVLSDFPLLQAFK-TRISNI 191          
BLAST of Glutathione s-transferase vs. Ensembl Mouse
Match: Gsta1 (glutathione S-transferase, alpha 1 (Ya) [Source:MGI Symbol;Acc:MGI:1095417])

HSP 1 Score: 65.4698 bits (158), Expect = 3.166e-12
Identity = 53/203 (26.11%), Postives = 100/203 (49.26%), Query Frame = 1
Query:  115 MAEKIKITYFNAKAKAELIRLILVASNVDFEDKRIEF-EDWPQLKP--SIPSGQLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKAD---RAVCTLDDLFNKIVDIFHEKDVEKSKLLRTELNETHLAIFLNRVSGYFTVHDGDFFLGSKPSYADLQLVNIM---DHFEESQYQNYPKIVKCYQQVLEHFPKIKEY 696
            MA K  + YFNA+ + E IR +L A+ V+FE+K I+  ED  +LK   ++   Q+P+V++  G  L ++ AI  Y A KY L G    E    D     +  L ++  ++V    ++   K+ L +      +L  F          H  D+ +G++ +  D+ L+ ++   + F+ S    +P ++K ++  +   P +K++
Sbjct:    1 MAGKPVLHYFNARGRMECIRWLLAAAGVEFEEKFIQSPEDLEKLKKDGNLMFDQVPMVEID-GMKLAQTRAILNYIATKYDLYGKDMKERALIDMYSEGILDLTEMIGQLVLCPPDQREAKTALAKDRTKNRYLPAF----EKVLKSHGQDYLVGNRLTRVDIHLLEVLLYVEEFDASLLTPFP-LLKAFKSRISSLPNVKKF 197          
BLAST of Glutathione s-transferase vs. Ensembl Mouse
Match: Gm3776 (predicted gene 3776 [Source:MGI Symbol;Acc:MGI:3826440])

HSP 1 Score: 63.5438 bits (153), Expect = 1.512e-11
Identity = 52/203 (25.62%), Postives = 100/203 (49.26%), Query Frame = 1
Query:  115 MAEKIKITYFNAKAKAELIRLILVASNVDFEDKRIEF-EDWPQLKP--SIPSGQLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKAD---RAVCTLDDLFNKIVDIFHEKDVEKSKLLRTELNETHLAIFLNRVSGYFTVHDGDFFLGSKPSYADLQLVNIM---DHFEESQYQNYPKIVKCYQQVLEHFPKIKEY 696
            MA K  + +FNA+ + E IR +L A+ V+FE+K I+  ED  +LK   ++   Q+P+V++  G  L ++ AI  Y A KY L G    E    D     +  L ++  ++V    ++   K+ L +      +L  F          H  D+ +G++ +  D+ L+ ++   + F+ S    +P ++K ++  +   P +K++
Sbjct:    1 MAGKPVLHHFNARGRMECIRWLLAAAGVEFEEKFIQSPEDLEKLKKDGNLMFDQVPMVEID-GMKLAQTRAILNYIATKYDLYGKDMKERALIDMYSEGILDLTEMIGQLVLCPPDQREAKTALAKDRTKNRYLPAF----EKVLKSHGQDYLVGNRLTRVDIHLLEVLLYVEEFDASLLTPFP-LLKAFKSRISSLPNVKKF 197          
BLAST of Glutathione s-transferase vs. Ensembl Mouse
Match: Gsta3 (glutathione S-transferase, alpha 3 [Source:MGI Symbol;Acc:MGI:95856])

HSP 1 Score: 63.1586 bits (152), Expect = 2.153e-11
Identity = 56/200 (28.00%), Postives = 98/200 (49.00%), Query Frame = 1
Query:  115 MAEKIKITYFNAKAKAELIRLILVASNVDFEDKRIEF-EDWPQLKP--SIPSGQLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFNKIVDIFHEKDVEKSKLLRTELNETHLAIFLNRVSGYFTVHDGDFFLGSKPSYADLQLVNIMDHFEE---SQYQNYPKIVKCYQQVLEHFPKIKEY 696
            MA K  + YF+ + + E IR +L A+ V+FE+K ++  +D  +L+   S+   Q+P+V++  G  L ++ AI  Y A KY+L G    E    D     + DL   I+   H    EK   L  ++ E     +          H  D+ +G++ S AD+ LV ++ H EE       N+P ++K  +  + + P +K++
Sbjct:    1 MAGKPVLHYFDGRGRMEPIRWLLAAAGVEFEEKFLKTRDDLARLRSDGSLMFQQVPMVEID-GMKLVQTKAILNYIASKYNLYGKDMKERAIIDMYTEGVADLEIMILYYPHMPPEEKEASL-AKIKEQTRNRYFPAFEKVLKSHGQDYLVGNRLSRADIALVELLYHVEELDPGVVDNFP-LLKALRSRVSNLPTVKKF 197          
BLAST of Glutathione s-transferase vs. UniProt/SwissProt
Match: sp|P30113|GST28_SCHBO (Glutathione S-transferase class-mu 28 kDa isozyme OS=Schistosoma bovis OX=6184 PE=1 SV=2)

HSP 1 Score: 138.658 bits (348), Expect = 7.177e-39
Identity = 75/208 (36.06%), Postives = 123/208 (59.13%), Query Frame = 1
Query:  118 AEKIKITYFNAKAKAELIRLILVASNVDFEDKRIEFEDWPQLKPSIPSGQLPVVQLT--CGTI--LNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFNKIVDIFHEKDVEKSKLLRTELNETHLAIFLNRVSGYFTVHDGDFFLGSKPSYADLQLVNIMDHF----EESQYQNYPKIVKCYQQVLEHFPKIKEYKATRVAT 717
             + IK+ YFN + +AE IR+ LVA+ V++ED+RI F+DWP++KP+IP G+LP V++T   G +  + ESLAIARY AKK+H+ G  E E Y  ++ +   +DL ++      + + EK K+++  LN   + + L+ +        G   +G K + ADL L+ ++DH     +E     YP+I K  + +L   P++ +Y + R AT
Sbjct:    3 GDHIKVIYFNGRGRAESIRMTLVAAGVNYEDERISFQDWPKIKPTIPGGRLPAVKITDNHGHVKWMVESLAIARYMAKKHHMMGGTEEEYYNVEKLIGQAEDLEHEYYKTLMKPEEEKQKIIKEILN-GKVPVLLDIICESLKASTGKLAVGDKVTLADLVLIAVIDHVTDLDKEFLTGKYPEIHKHRENLLASSPRLAKYLSDRAAT 209          
BLAST of Glutathione s-transferase vs. UniProt/SwissProt
Match: sp|P30114|GST28_SCHHA (Glutathione S-transferase class-mu 28 kDa isozyme OS=Schistosoma haematobium OX=6185 PE=1 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 9.572e-38
Identity = 74/208 (35.58%), Postives = 123/208 (59.13%), Query Frame = 1
Query:  118 AEKIKITYFNAKAKAELIRLILVASNVDFEDKRIEFEDWPQLKPSIPSGQLPVVQLT--CGTI--LNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFNKIVDIFHEKDVEKSKLLRTELNETHLAIFLNRVSGYFTVHDGDFFLGSKPSYADLQLVNIMDHF----EESQYQNYPKIVKCYQQVLEHFPKIKEYKATRVAT 717
             + IK+ YFN + +AE IR+ LVA+ V++ED+RI F+DWP++KP+IP G+LP V++T   G +  + ESLAIARY AKK+H+ G  + E Y  ++ +  ++DL ++      + + EK K+ +  LN   + + L+ +        G   +G K + ADL L+ ++DH     +E     YP+I K  + +L   P++ +Y + R AT
Sbjct:    3 GDHIKVIYFNGRGRAESIRMTLVAAGVNYEDERISFQDWPKIKPTIPGGRLPAVKITDNHGHVKWMLESLAIARYMAKKHHMMGETDEEYYNVEKLIGQVEDLEHEYHKTLMKPEEEKQKITKEILN-GKVPVLLDIICESLKASTGKLAVGDKVTLADLVLIAVIDHVTDLDKEFLTGKYPEIHKHRENLLASSPRLAKYLSDRAAT 209          
BLAST of Glutathione s-transferase vs. UniProt/SwissProt
Match: sp|P09792|GST28_SCHMA (Glutathione S-transferase class-mu 28 kDa isozyme OS=Schistosoma mansoni OX=6183 GN=GST28 PE=1 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 2.943e-37
Identity = 74/208 (35.58%), Postives = 120/208 (57.69%), Query Frame = 1
Query:  118 AEKIKITYFNAKAKAELIRLILVASNVDFEDKRIEFEDWPQLKPSIPSGQLPVVQLT--CGTI--LNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFNKIVDIFHEKDVEKSKLLRTELNETHLAIFLNRVSGYFTVHDGDFFLGSKPSYADLQLVNIMDHFEESQ----YQNYPKIVKCYQQVLEHFPKIKEYKATRVAT 717
             E IK+ YF+ + +AE IR+ LVA+ VD+ED+RI F+DWP++KP+IP G+LP V++T   G +  + ESLAIARY AKK+H+ G  + E Y  ++ +   +D+ ++      +   EK K+ +  LN   + + LN +        G   +G K + ADL L+ ++DH  +         YP+I K  + +L   P++ +Y + R AT
Sbjct:    3 GEHIKVIYFDGRGRAESIRMTLVAAGVDYEDERISFQDWPKIKPTIPGGRLPAVKVTDDHGHVKWMLESLAIARYMAKKHHMMGETDEEYYSVEKLIGQAEDVEHEYHKTLMKPQEEKEKITKEILN-GKVPVLLNMICESLKGSTGKLAVGDKVTLADLVLIAVIDHVTDLDKGFLTGKYPEIHKHRENLLASSPRLAKYLSNRPAT 209          
BLAST of Glutathione s-transferase vs. UniProt/SwissProt
Match: sp|P26624|GST28_SCHJA (Glutathione S-transferase class-mu 28 kDa isozyme (Fragment) OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 2.648e-35
Identity = 73/205 (35.61%), Postives = 124/205 (60.49%), Query Frame = 1
Query:  127 IKITYFNAKAKAELIRLILVASNVDFEDKRIEFEDWPQLKPSIPSGQLPVVQLT--CGTI--LNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFNKIVDIFHEKDVEKSKLLRTELNETHLAIFLNRVSGYFTVHDGDFFLGSKPSYADLQLVNIMDHF----EESQYQNYPKIVKCYQQVLEHFPKIKEYKATRVAT 717
            +K+ YFN + +AE IR+ILVA+ V+FED+RIEF+DWP++KP+IP G+LP+V++T   G +  ++ESLAIAR+ A+K+++ G  + E Y  ++ +  ++D+ ++      +   EK K+ +  LN   + I L  +        G+  +G K + AD+ L+  +DH     +E     YP+I K  + +L   PK+ +Y + R AT
Sbjct:    1 VKLIYFNGRGRAEPIRMILVAAGVEFEDERIEFQDWPKIKPTIPGGRLPIVKITDKRGDVKTMSESLAIARFIARKHNMMGDTDDEYYIIEKMIGQVEDVESEYHKTLIKPPEEKEKISKEILN-GKVPILLQAICETLKESTGNLTVGDKVTLADVVLIASIDHITDLDKEFLTGKYPEIHKHRKHLLATSPKLAKYLSERHAT 204          
BLAST of Glutathione s-transferase vs. UniProt/SwissProt
Match: sp|P46428|GST_ANOGA (Glutathione S-transferase OS=Anopheles gambiae OX=7165 GN=GstS1 PE=2 SV=4)

HSP 1 Score: 110.923 bits (276), Expect = 2.412e-28
Identity = 67/202 (33.17%), Postives = 118/202 (58.42%), Query Frame = 1
Query:  130 KITYFNAKAKAELIRLILVASNVDFEDKRIEFEDWPQLKPSIPSGQLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFNKIVDIFHEKD--VEKSKLLRTELNETHLAIFLNRVSGYFTVHDGDFFLGSKPSYADLQLVNIMDHF----EESQYQNYPKIVKCYQQVLEHFPKIKEYKATRVAT 717
            K+ YFN KA  E +R +L   N+ F+D RI  E+WP LKP++P GQ+PV+++  G  +++S+A++RY A +  LAG+ + E    D  V T++D   KI  + +E D  V++ K++   LN   +  +L +++     ++G   LG KP++AD+    I+D+     + +  +N+P + +  Q+VL++   +K Y A R  T
Sbjct:    5 KVYYFNVKALGEPLRFLLSYGNLPFDDVRITREEWPALKPTMPMGQMPVLEVD-GKKVHQSVAMSRYLANQVGLAGADDWENLMIDTVVDTVNDFRLKIAIVAYEPDDMVKEKKMVT--LNNEVIPFYLTKLNVIAKENNGHLVLG-KPTWADVYFAGILDYLNYLTKTNLLENFPNLQEVVQKVLDN-ENVKAYIAKRPIT 201          
BLAST of Glutathione s-transferase vs. TrEMBL
Match: A0A194AP16 (Putative sigma class glutathione-s-transferase 2 OS=Pinctada fucata OX=50426 PE=4 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 7.048e-37
Identity = 79/201 (39.30%), Postives = 117/201 (58.21%), Query Frame = 1
Query:  124 KIKITYFNAKAKAELIRLILVASNVDFEDKRIEFEDWPQLKPSIPSGQLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFNKIVDI-FHEKDVEKSKLLRTELNETHLAIFLNRVSGYF--TVHDGDFFLGSKPSYADLQLVNIMDHF---EESQYQNYPKIVKCYQQVLEHFPKIKEYKATR 708
            K K+ YF  + + E+IRL+L  +  DFED+RI  E+WP++K  IPSGQ+P++++  G  +NESLAIARY A++Y L G    E+Y  DR V  +DD F K V I F EKD +K   L+  L++ H   FL   + Y   +  DGDFF+G+  + ADL + +    F    +     YPK+ +  ++  E  P + +Y A R
Sbjct:    3 KYKLHYFGVRGRGEIIRLVLTVAGQDFEDRRITQEEWPKVKSEIPSGQVPLLEVD-GKHMNESLAIARYLAREYDLGGKTNHEQYLVDRVVGAVDDYFTKAVQILFLEKDEKKKAELQKALDDEHTPRFLKMFTKYLEESGGDGDFFVGNSGTLADLAVHDCFTTFLKQNDKLLDKYPKL-QANRKATEALPHMADYLAKR 201          
BLAST of Glutathione s-transferase vs. TrEMBL
Match: A0A194APU9 (Putative sigma class glutathione-s-transferase 2 OS=Pinctada fucata OX=50426 PE=4 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 1.130e-36
Identity = 79/201 (39.30%), Postives = 117/201 (58.21%), Query Frame = 1
Query:  124 KIKITYFNAKAKAELIRLILVASNVDFEDKRIEFEDWPQLKPSIPSGQLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFNKIVDI-FHEKDVEKSKLLRTELNETHLAIFLNRVSGYF--TVHDGDFFLGSKPSYADLQLVNIMDHF---EESQYQNYPKIVKCYQQVLEHFPKIKEYKATR 708
            K K+ YF  + + E+IRL+L  +  DFED+RI  E+WP++K  IPSGQ+P++++  G  +NESLAIARY A++Y L G    E+Y  DR V  +DD F K V I F EKD +K   L+  L++ H   FL   + Y   +  DGDFF+G+  + ADL + +    F    +     YPK+ +  ++  E  P + +Y A R
Sbjct:    3 KYKLHYFGVRGRGEIIRLVLTVAGQDFEDRRITQEEWPKVKSEIPSGQVPLLEVD-GKHMNESLAIARYLAREYDLGGKTNHEQYLVDRVVGAVDDYFTKAVQILFLEKDEKKKAELQKALDDEHTPRFLKLFTKYLEESGGDGDFFVGNSGTLADLAVHDCFTTFLKQNDKLLDKYPKL-QANRKATEALPHMADYLAKR 201          
BLAST of Glutathione s-transferase vs. TrEMBL
Match: A0A095AUD7 (Glutathione S-transferase class-mu 28 kDa isozyme OS=Schistosoma haematobium OX=6185 GN=MS3_06482 PE=3 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 2.127e-36
Identity = 75/208 (36.06%), Postives = 123/208 (59.13%), Query Frame = 1
Query:  118 AEKIKITYFNAKAKAELIRLILVASNVDFEDKRIEFEDWPQLKPSIPSGQLPVVQLT--CGTI--LNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFNKIVDIFHEKDVEKSKLLRTELNETHLAIFLNRVSGYFTVHDGDFFLGSKPSYADLQLVNIMDHF----EESQYQNYPKIVKCYQQVLEHFPKIKEYKATRVAT 717
             + IK+ YFN + +AE IR+ LVA+ V++ED+RI F+DWP++KP+IP G+LP V++T   G +  + ESLAIARY AKK+H+ G  E E Y  ++ +   +DL ++      + + EK K+++  LN   + + L+ +        G   +G K + ADL L+ ++DH     +E     YP+I K  + +L   P++ +Y + R AT
Sbjct:    3 GDHIKVIYFNGRGRAESIRMTLVAAGVNYEDERISFQDWPKIKPTIPGGRLPAVKITDNHGHVKWMVESLAIARYMAKKHHMMGGTEEEYYNVEKLIGQAEDLEHEYYKTLMKPEEEKQKIIKEILN-GKVPVLLDIICESLKASTGKLAVGDKVTLADLVLIAVIDHVTDLDKEFLTGKYPEIHKHRENLLASSPRLAKYLSDRAAT 209          
BLAST of Glutathione s-transferase vs. TrEMBL
Match: A0A4S2LX34 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005708 PE=3 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 7.624e-35
Identity = 75/206 (36.41%), Postives = 113/206 (54.85%), Query Frame = 1
Query:  130 KITYFNAKAKAELIRLILVASNVDFEDKRIEFEDWPQLKPSIPSGQLPVVQLT--CG--TILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFNKIVDIFHEKDVEKSKLLRTELNETHLAIFLNRVSGYFTVHDGDFFLGSKPSYADLQLVNIMDHFEESQ----YQNYPKIVKCYQQVLEHFPKIKEYKATRVATII 723
            K+TYFN + +AE IR+ L+ S   FED RIE  DWP  K +IP G+LP++++T  CG  T++ ES+AIARY AK+++L G+ + + YK ++ +    DL + +  I    D EK KL+       +    LN +S     +   F  G K S  D+ L+  +D FE        +NYP  V   + V+   PK+ E+  TR  TI+
Sbjct:    5 KLTYFNLRGRAEPIRMALIVSGTPFEDCRIEVSDWPPKKSTIPGGKLPILEVTSPCGKKTVMTESMAIARYLAKQHNLMGATDEDYYKIEKTIGQCGDLHDLVYKIARSPDAEKPKLIEELKKPENAPRLLNLISETLKSNPSGFVTGEKVSLGDITLLCTLDQFEAVYPGFLKENYPIFVTHREHVVALQPKLAEHLKTRPTTIV 210          
BLAST of Glutathione s-transferase vs. TrEMBL
Match: K1RA71 (Glutathione-requiring prostaglandin D synthase OS=Crassostrea gigas OX=29159 GN=CGI_10022749 PE=4 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 1.627e-34
Identity = 69/201 (34.33%), Postives = 119/201 (59.20%), Query Frame = 1
Query:  124 KIKITYFNAKAKAELIRLILVASNVDFEDKRIEFEDWPQLKPSIPSGQLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFNKIVDIFHEKDVEKSKLLRTELNETHLAIFLNRVSGYFTVHDGDFFLGSKPSYADLQLVNIMDHFEESQ---YQNYPKIVKCYQQVLEHFPKIKEYKATRVAT 717
            K  + YFN K + E++RL+L A+ VDFED R++ E+WP+LK S+P+GQ+PV+++  G   ++SLAIARY A++Y +AG    ++   D+ V T++DL N+++    EKD  +   +  +L E  +      ++ +   + GD+F+G+K S AD+  ++I+    E      + +PK+    ++  +  PKI  Y A R  T
Sbjct:    3 KYTVYYFNIKGRGEIVRLMLTAAGVDFEDHRVQGEEWPKLKSSMPTGQMPVLEID-GKKYSQSLAIARYLAREYGMAGKTNTDQLLMDQIVDTVNDLINEMIKPVFEKDEARKAEMEKKLKEETMPRIFGTLNNFLEGNGGDYFVGTKLSLADVFFMDIVSRVVEKDPKALEKFPKLAANLKKT-QSEPKIAAYLAKRPKT 201          
BLAST of Glutathione s-transferase vs. Ensembl Cavefish
Match: GSTP1 (glutathione S-transferase pi 1 [Source:NCBI gene;Acc:103038276])

HSP 1 Score: 48.521 bits (114), Expect = 1.672e-6
Identity = 48/194 (24.74%), Postives = 84/194 (43.30%), Query Frame = 1
Query:  133 ITYFNAKAKAELIRLILVASNVDFEDKRIEFEDWPQ--LKPSIPSGQLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFNKIVD-IFHEKDVEKSKLLRTELNETHLAIFLNRVSGYFTVHDGDFFLGSKPSYADLQLVNI-MDH--FEESQYQNYPKIVKCYQQVLEHFPKIKEY 696
            ITYF  + +    R++L     ++++  + FEDW +  LK +   GQLP  +   G  L +S    R+  +K+   G  + E  + D     ++DL  K +  I+ E +  K   ++   N  HL  F          +   F +G   S+AD  L  + ++H     +   + P + K +   L   PKIK +
Sbjct:    6 ITYFAVRGRCGATRIMLADQGQEWKEIVVSFEDWMKGDLKKTCVFGQLPKFE-DGGLTLFQSNTFLRHLGRKHGAYGKNDCEAAQIDMFNDGVEDLRTKYLKMIYQEYETGKDAYIKDLPN--HLCKF----EAVLAKNKSGFLVGDSISFADYSLFEVLLNHLVLSPTCLDSLPAL-KSFVDTLSARPKIKAF 191          
BLAST of Glutathione s-transferase vs. Ensembl Cavefish
Match: GSTP1 (glutathione S-transferase pi 1 [Source:NCBI gene;Acc:103038276])

HSP 1 Score: 48.521 bits (114), Expect = 2.119e-6
Identity = 48/194 (24.74%), Postives = 84/194 (43.30%), Query Frame = 1
Query:  133 ITYFNAKAKAELIRLILVASNVDFEDKRIEFEDWPQ--LKPSIPSGQLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFNKIVD-IFHEKDVEKSKLLRTELNETHLAIFLNRVSGYFTVHDGDFFLGSKPSYADLQLVNI-MDH--FEESQYQNYPKIVKCYQQVLEHFPKIKEY 696
            ITYF  + +    R++L     ++++  + FEDW +  LK +   GQLP  +   G  L +S    R+  +K+   G  + E  + D     ++DL  K +  I+ E +  K   ++   N  HL  F          +   F +G   S+AD  L  + ++H     +   + P + K +   L   PKIK +
Sbjct:   26 ITYFAVRGRCGATRIMLADQGQEWKEIVVSFEDWMKGDLKKTCVFGQLPKFE-DGGLTLFQSNTFLRHLGRKHGAYGKNDCEAAQIDMFNDGVEDLRTKYLKMIYQEYETGKDAYIKDLPN--HLCKF----EAVLAKNKSGFLVGDSISFADYSLFEVLLNHLVLSPTCLDSLPAL-KSFVDTLSARPKIKAF 211          
BLAST of Glutathione s-transferase vs. Ensembl Cavefish
Match: gsta.1 (glutathione S-transferase A4-like [Source:NCBI gene;Acc:103033890])

HSP 1 Score: 48.1358 bits (113), Expect = 2.410e-6
Identity = 50/205 (24.39%), Postives = 95/205 (46.34%), Query Frame = 1
Query:  115 MAEKIKITYFNAKAKAELIRLILVASNVDFEDKRIEFEDWPQLKPSIPSG-----QLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFNKIVDI-FHEKDVEKSKL--LRTELNETHLAIFLNRVSGYFTVHDGDFFLGSKPSYADLQLVNIMDHFEE---SQYQNYPKIVKCYQQVLEHFPKIKEY 696
            M+ K+ + YF  + K E IR +L  + V+FE+K   F    + +  + SG     Q+P++++  G  + ++ AI  Y A KY+L G    E    D       D+ + I+ + F   + ++S L  L T+     L  +   +S         + +G++ S AD+ L  +    EE   +    +P I + +Q+ ++  P I ++
Sbjct:    1 MSGKVVLHYFIGRGKMESIRWLLTVAGVEFEEKF--FSTKEEFQKLVESGDLLFHQVPLIEMD-GMKMVQTKAILNYIAGKYNLYGKDLKERLMIDTYAEGARDIMDLIMGVPFTPPEKKQSTLNNLETKAKVRSLPAYEKALS------SSQYLVGNQLSCADVSLFEVALMLEELFPTILSTFPNI-QAFQKRMKAIPAINKF 195          
BLAST of Glutathione s-transferase vs. Ensembl Nematostella
Match: EDO45159 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTW9])

HSP 1 Score: 103.219 bits (256), Expect = 9.000e-27
Identity = 59/198 (29.80%), Postives = 102/198 (51.52%), Query Frame = 1
Query:  130 KITYFNAKAKAELIRLILVASNVDFEDKRIEFEDWPQLKPSI--PSGQLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFNKIVDIFHEKDVEKSKLLRTELNETHLAIFLNRVSGYFTVHDGDFFLGSKPSYADLQLVNIMDHFEESQYQNYPKIVKCYQQVLEHFPKIKEYKATRVAT 717
            K+ YFNA+ +AE  RL+  A+ ++FED R+   +WP++K  +  P GQ+P++ +     L +SLAI  + A++  LA S  ++  K D  V   +D   K +    EKD  K K L   +  THL  F+  ++     +   F +  K +YAD+ + N  ++ +      +PK+ + + ++  + P IK Y   R  T
Sbjct:    5 KLYYFNARGRAEPARLVFAAAGIEFEDNRMAMGEWPKVKKELHAPFGQVPLLVIDDKIKLAQSLAIMTFIAREGGLAPSNSLDIAKCDMIVGAEEDFLTKKIQCHFEKDEAKKKELDEAIQNTHLPAFMGALTKILEENGTGFLVTDKMTYADIIVFNACNNLDSGALDKFPKLKQHHDRIASN-PGIKAYLEKRPKT 201          
BLAST of Glutathione s-transferase vs. Ensembl Nematostella
Match: EDO38608 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCI4])

HSP 1 Score: 102.834 bits (255), Expect = 1.241e-26
Identity = 66/200 (33.00%), Postives = 109/200 (54.50%), Query Frame = 1
Query:  130 KITYFNAKAKAELIRLILVASNVDFEDKRIEF-EDWPQLKPSI--PSGQLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFNKIVDIFHEKDVEKSKL-LRTELNETHLAIFLNRVSGYFTVHDGDFFLGSKPSYADLQLVNIMDHFEESQYQNYPKIVKCYQQVLEHFPKIKEYKATRVAT 717
            K+ YFNA+ +AE  RL   A+ +++EDKR E  E+W ++KP +  P GQ+P++ +     L +S+AI  Y A++  LA +  ++    D  V    DL +K +  F EKD +K  L LR EL+ TH+  FL  +S +   +   F +  K +YAD+ + N+ D+      +  PK+ K + +++   P IK +   R  T
Sbjct:    5 KLHYFNARGRAEPARLAFAAAGIEYEDKRFEGREEWLRVKPELDPPFGQVPLLVIDDKIKLAQSMAILAYVAREGGLAPTNSLDIAMCDMIVGVEGDLNSKGMKWFMEKDEKKKVLKLREELDTTHIPAFLEAMSKFLEKNGTGFLVTDKLTYADILVFNVCDNAPAEVLKKCPKM-KEFHELIAAIPGIKAWLEKRPKT 203          
BLAST of Glutathione s-transferase vs. Ensembl Nematostella
Match: EDO45327 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT47])

HSP 1 Score: 97.8265 bits (242), Expect = 1.023e-24
Identity = 68/203 (33.50%), Postives = 104/203 (51.23%), Query Frame = 1
Query:  130 KITYFNAKAKAELIRLILVASNVDFEDKRIEFEDWPQLKPSIPS--GQLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFNKIVDIFHEKDVEKSKLLRTELNETHLAIFLNRVSGYFTVH---DGD--FFLGSKPSYADLQLVNIMDHFEE---SQYQNYPKIVKCYQQVLEHFPKIKEYKATR 708
            K+ YFN + +AE  RL   A  + +ED R+  E+W ++K    +  G LPV+++  G    ES+AI R  AK   L  +   E+ + D  V    DLF K +  F EKD E+ K L+ E  E HL  F + +    T     DG   +F+G+K +YAD+ L +  D FE       +N+P +   +++V E+ P IK +   R
Sbjct:    5 KLIYFNTRGRAEPTRLCFAAGGIPYEDVRLTGEEWTKMKAENKTIMGYLPVLEVD-GIQYCESMAIFRLAAKLAGLCPTCPYEQARCDMVVDCSSDLFAKAMKFFFEKDQEQKKKLQEEFKEQHLNKFWDIMERLLTAKCNLDGSAQYFVGNKLTYADIILFSTSDTFESMFPGMLENFPGLRDLFKRVGEN-PGIKAWIEKR 205          
BLAST of Glutathione s-transferase vs. Ensembl Nematostella
Match: EDO33767 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR87])

HSP 1 Score: 94.3597 bits (233), Expect = 2.581e-23
Identity = 65/209 (31.10%), Postives = 106/209 (50.72%), Query Frame = 1
Query:  115 MAEKIKITYFNAKAKAELIRLILVASNVDFEDKRIEFEDWPQLKPS--IPSGQLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFNKIVDIFHEKDVEKSKLLRTELNETHLAIFLNRVSGYFTVHDG--DFFLGSKPSYADLQLVNIMDHFEES-------QYQNYPKIVKCYQQVLEHFPKIKEYKATR 708
            MA   ++ YF+A+A+AE IR++L  ++V F D+R+   DW  +K S   P G+LP+++++ G  L +S AI R+ AK++ LA S    + + D  +    D+  K+   F EKD +  +    E +E  L   L  ++  F  + G   + +G K +YAD+      + F  S       Q   YP +V  Y +V+    KI EY   R
Sbjct:    1 MAPTYRVVYFDARARAECIRVLLHLADVPFTDERVAPPDWAAMKTSGRCPFGELPLLEISDGRKLAQSHAIFRFLAKEHGLAPSDSYSQARCDMFLDNTKDMIEKVGTAFWEKDEKLKEQKSKEFHEETLPKRLEFINKLFQENKGGKGYLVGDKITYADIDFFCFFNGFINSGKLDVPEQLSKYPLLVDLYNRVMNE-KKILEYLKQR 208          
BLAST of Glutathione s-transferase vs. Ensembl Nematostella
Match: EDO47468 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMA1])

HSP 1 Score: 88.1965 bits (217), Expect = 4.239e-21
Identity = 59/203 (29.06%), Postives = 101/203 (49.75%), Query Frame = 1
Query:  130 KITYFNAKAKAELIRLILVASNVDFEDKRIEFEDWPQLKPSI--PSGQLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFNKIVDIFHEKDVEKSKLLRTELNETHLAIFLNRVSGYFTVHDG--DFFLGSKPSYADLQLVNIMDHFEES---QYQNYPKIVKCYQQVLEHFPKIKEYKATRVAT 717
            K+ YF+ + +AE  RL   A+ +++EDKR++FE+WP++K  I  P GQ+P++ +     L +SLAI  Y A++  LA    ++    D  V   +D   K      EKD  K   L   L +THL  F+  ++     +D    F +  K +YAD+ + N+ ++   +       +P+I K +  ++     IK +   R  T
Sbjct:    5 KLYYFDGRGRAEPARLAFAAAGIEYEDKRMQFEEWPKIKKEIDAPFGQVPLLVIDDKIKLAQSLAIMTYIAREGGLAPVNSLDIAMCDMIVGAEEDFVQKQYKWHFEKDEAKKTELGEALEKTHLPAFVEALTRILKKNDNKTGFLVTDKMTYADIVVFNVFNNLSSTDGFSLDKFPEI-KAHHDLVAANEGIKAWLEKRPKT 206          
BLAST of Glutathione s-transferase vs. Planmine SMEST
Match: SMESG000016846.1 (SMESG000016846.1)

HSP 1 Score: 414.846 bits (1065), Expect = 8.889e-149
Identity = 200/203 (98.52%), Postives = 201/203 (99.01%), Query Frame = 1
Query:  115 MAEKIKITYFNAKAKAELIRLILVASNVDFEDKRIEFEDWPQLKPSIPSGQLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFNKIVDIFHEKDVEKSKLLRTELNETHLAIFLNRVSGYFTVHDGDFFLGSKPSYADLQLVNIMDHFEESQYQNYPKIVKCYQQVLEHFPKIKEYKATRVATII 723
            MAEKIKITYFNAKAKAELIRLILVASNVDFEDKRIEFEDWPQLKPSIPSGQLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLF KIVDIFHEKDVEKSKLLRTELNETHLAIFLNRVSGYFT HDGDFFLGSKPSYADLQLVNIMDHFEESQYQNYPKIVKCYQQVLEHFPK+KEYKATRVATII
Sbjct:    1 MAEKIKITYFNAKAKAELIRLILVASNVDFEDKRIEFEDWPQLKPSIPSGQLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFTKIVDIFHEKDVEKSKLLRTELNETHLAIFLNRVSGYFTEHDGDFFLGSKPSYADLQLVNIMDHFEESQYQNYPKIVKCYQQVLEHFPKVKEYKATRVATII 203          
BLAST of Glutathione s-transferase vs. Planmine SMEST
Match: SMESG000016836.1 (SMESG000016836.1)

HSP 1 Score: 152.91 bits (385), Expect = 1.084e-45
Identity = 79/196 (40.31%), Postives = 117/196 (59.69%), Query Frame = 1
Query:  130 KITYFNAKAKAELIRLILVASNVDFEDKRIEFEDWPQLKPSIPSGQLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFNKIVDIFHEKDVEKSKLLRTELNETHLAIFLNRVSGYFTVHDGDFFLGSKPSYADLQLVNIMDHFEESQYQNYPKIVKCYQQVLEHFPKIKEYKATRVAT 717
            K+TYF+ + + ELIR IL + N  F+D+R+ FE W   KPS+  GQLPV+ L CGT LNES+AI+R+ A+K  L G  E+E Y+ DRA+ T++DL+ K V    EKD +K   ++ +L E  +  +   +  Y     G F  G+  S ADL L  I+D   E++   +PK+   Y +V+  +P IK++  TR  T
Sbjct:    5 KLTYFDGRGRGELIRFILHSQNEKFDDERLTFEQWGARKPSVTYGQLPVLTLECGTQLNESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIFEKDEKKKAEMQKDLKEKFVPQYFGNLVKYIDEGKGAFLAGANASLADLFLCVILDSLPEAK-PAFPKLENIYNKVMTSYPGIKKHVETRPQT 199          
BLAST of Glutathione s-transferase vs. Planmine SMEST
Match: SMESG000003087.1 (SMESG000003087.1)

HSP 1 Score: 118.242 bits (295), Expect = 3.163e-32
Identity = 68/199 (34.17%), Postives = 117/199 (58.79%), Query Frame = 1
Query:  127 IKITYFNAKAKAELIRLILVASNVDFEDKRIEFEDWPQLKPSIPSGQLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFNKIVDIFHEKDVEKSKLLRTELNETHLAIFLNRVSGYFTVHDGDFFLGSKPSYADLQLVNIMDHFEE--SQYQNYPKIVKCYQQVLEHFPKIKEYKATRVAT 717
            +K+TYF+A+ +AELIRL+L AS ++FED RI  + WP++KP+ P+G+LPVV+   G  L +S+AIAR  A+K+   G  + E Y  +RA+  + D+   +  I+   + EK + LR E   T     L  + G+  + +  FF G K + A+L  + + D+  +    Y ++PK+ +  +++L+    ++E+  TR  T
Sbjct:    4 VKVTYFDARGRAELIRLVLKASKIEFEDVRITKDKWPEVKPTTPTGKLPVVEYE-GKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPE-EKKEELRAEYVATSGRDNLKALEGF--IKETGFFAGEKITLAELFFLVVSDYLVKLPQLYDDFPKLKELRERILKANTDVEEWVNTRPVT 198          
BLAST of Glutathione s-transferase vs. Planmine SMEST
Match: SMESG000032177.1 (SMESG000032177.1)

HSP 1 Score: 80.4925 bits (197), Expect = 5.677e-18
Identity = 59/210 (28.10%), Postives = 106/210 (50.48%), Query Frame = 1
Query:  115 MAEKIKITYFNAKAKAELIRLILVASNVDFEDKRIEFEDWPQLKPSIPSGQLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEY-------KADRAVCTLDDLF--NKIVDIFHEKDVEKSKLLRTELNETHLAIFLNRVSGYFTVHDGDFFLGSKPSYADLQLVNIMDHFE----ESQYQNYPKIVKCYQQVLEHFPKIKEYKAT 705
            M + +++ Y++ + +AE++RL+  A+N+ FEDKR   E+W   K +    +LP+V+   G +L E  AI R+++    L GS + E Y        AD +   L+D+   N  +D  HE  +  S  L+T          LN+V+    V+   F +G   S AD+ L+ ++D  E    +  +  + K+ +  +++L  FP+I  +  T
Sbjct:    1 MNKFVRLHYYDCRGEAEVLRLLFKAANIKFEDKRYTEEEWETAKSAFKIKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADESCHILNDVVFKNITLDDHHEHALSSS--LKT----------LNKVA---EVNKNGFLVGKTASLADIYLLVLLDFAEMRAAKEHFTRFKKLHEVKKKLLNTFPEINTWITT 195          
BLAST of Glutathione s-transferase vs. Planmine SMEST
Match: SMESG000066038.1 (SMESG000066038.1)

HSP 1 Score: 56.9954 bits (136), Expect = 1.299e-9
Identity = 42/191 (21.99%), Postives = 95/191 (49.74%), Query Frame = 1
Query:  139 YFNAKAKA-ELIRLILVASNVDFEDKRIEFEDWPQLKPSIPSGQLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFNKIVDIFHEKDVEKSKLLRTELNETHLAIFLNRVSGYFTVHDGDFFLGSKPSYADLQLVNIMDHFEESQY----QNYPKIVKCYQQVLEHFPKIKEY 696
            Y+N K    +LI + L+A+ V +ED R+  ++    K        P ++   G +L+++LAIA+++AK+ +  G  + + Y  ++ +     L +KIV +       K ++   + N+    ++L  +    T +   F +    +  DL  + +M++ + + +    +N+P  +  ++++L   P++KEY
Sbjct:    6 YWNPKNPTHQLIPITLIATGVVYEDIRLSDDNTHHGK------HPPYIENAEGKVLDKTLAIAKFYAKRKNCMGKDDWDLYCIEKGI----SLISKIVRLLSSILNRKCEISEWDKNK---EMYLRHIEKLITENGHGFLVTKGITLTDLYFLVMMNYLKFTTFSKTLENHPNFITVHEKILATLPQVKEY 183          
The following BLAST results are available for this feature:
BLAST of Glutathione s-transferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HPGDS1.975e-2331.34hematopoietic prostaglandin D synthase [Source:HGN... [more]
GSTA39.712e-1430.29glutathione S-transferase alpha 3 [Source:HGNC Sym... [more]
GSTA52.748e-1329.41glutathione S-transferase alpha 5 [Source:HGNC Sym... [more]
GSTA52.748e-1329.41glutathione S-transferase alpha 5 [Source:HGNC Sym... [more]
GSTA13.961e-1329.90glutathione S-transferase alpha 1 [Source:HGNC Sym... [more]
back to top
BLAST of Glutathione s-transferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gst-41.421e-2530.88Glutathione S-transferase 4 [Source:UniProtKB/Swi... [more]
gst-119.769e-2431.75Glutathione S-Transferase [Source:UniProtKB/TrEMB... [more]
gst-31.746e-2330.20Glutathione S-transferase 3 [Source:UniProtKB/Swi... [more]
gst-203.615e-2331.71Glutathione S-Transferase [Source:UniProtKB/TrEMB... [more]
gst-126.281e-2231.88Glutathione S-Transferase [Source:UniProtKB/TrEMB... [more]
back to top
BLAST of Glutathione s-transferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
GstS12.152e-2234.05gene:FBgn0010226 transcript:FBtr0087005[more]
GstS12.152e-2234.05gene:FBgn0010226 transcript:FBtr0100258[more]
GstS12.152e-2234.05gene:FBgn0010226 transcript:FBtr0087006[more]
GstS19.521e-2131.55gene:FBgn0010226 transcript:FBtr0333551[more]
back to top
BLAST of Glutathione s-transferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gsta.13.935e-728.00glutathione S-transferase, alpha tandem duplicate ... [more]
gsta.13.935e-728.00glutathione S-transferase, alpha tandem duplicate ... [more]
AL929536.37.812e-726.73pep chromosome:GRCz11:13:835390:840787:1 gene:ENSD... [more]
AL929536.17.812e-726.73pep chromosome:GRCz11:CHR_ALT_CTG13_1_1:843683:849... [more]
gsta.22.316e-625.98glutathione S-transferase, alpha tandem duplicate ... [more]
back to top
BLAST of Glutathione s-transferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hpgds1.601e-3235.90hematopoietic prostaglandin D synthase [Source:NCB... [more]
gsta47.710e-1529.35glutathione S-transferase alpha 4 [Source:NCBI gen... [more]
ENSXETT00000044727.12.808e-1327.94glutathione S-transferase 3-like [Source:NCBI gene... [more]
ENSXETT00000044740.11.592e-1228.95glutathione S-transferase 3-like [Source:NCBI gene... [more]
nemp11.169e-1029.08nuclear envelope integral membrane protein 1 [Sour... [more]
back to top
BLAST of Glutathione s-transferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hpgds2.525e-2532.16hematopoietic prostaglandin D synthase [Source:MGI... [more]
Gsta49.237e-1328.77glutathione S-transferase, alpha 4 [Source:MGI Sym... [more]
Gsta13.166e-1226.11glutathione S-transferase, alpha 1 (Ya) [Source:MG... [more]
Gm37761.512e-1125.62predicted gene 3776 [Source:MGI Symbol;Acc:MGI:382... [more]
Gsta32.153e-1128.00glutathione S-transferase, alpha 3 [Source:MGI Sym... [more]
back to top
BLAST of Glutathione s-transferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P30113|GST28_SCHBO7.177e-3936.06Glutathione S-transferase class-mu 28 kDa isozyme ... [more]
sp|P30114|GST28_SCHHA9.572e-3835.58Glutathione S-transferase class-mu 28 kDa isozyme ... [more]
sp|P09792|GST28_SCHMA2.943e-3735.58Glutathione S-transferase class-mu 28 kDa isozyme ... [more]
sp|P26624|GST28_SCHJA2.648e-3535.61Glutathione S-transferase class-mu 28 kDa isozyme ... [more]
sp|P46428|GST_ANOGA2.412e-2833.17Glutathione S-transferase OS=Anopheles gambiae OX=... [more]
back to top
BLAST of Glutathione s-transferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A194AP167.048e-3739.30Putative sigma class glutathione-s-transferase 2 O... [more]
A0A194APU91.130e-3639.30Putative sigma class glutathione-s-transferase 2 O... [more]
A0A095AUD72.127e-3636.06Glutathione S-transferase class-mu 28 kDa isozyme ... [more]
A0A4S2LX347.624e-3536.41Uncharacterized protein OS=Opisthorchis felineus O... [more]
K1RA711.627e-3434.33Glutathione-requiring prostaglandin D synthase OS=... [more]
back to top
BLAST of Glutathione s-transferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
GSTP11.672e-624.74glutathione S-transferase pi 1 [Source:NCBI gene;A... [more]
GSTP12.119e-624.74glutathione S-transferase pi 1 [Source:NCBI gene;A... [more]
gsta.12.410e-624.39glutathione S-transferase A4-like [Source:NCBI gen... [more]
back to top
BLAST of Glutathione s-transferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutathione s-transferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutathione s-transferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO451599.000e-2729.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO386081.241e-2633.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453271.023e-2433.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337672.581e-2331.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474684.239e-2129.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glutathione s-transferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutathione s-transferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016846.18.889e-14998.52SMESG000016846.1[more]
SMESG000016836.11.084e-4540.31SMESG000016836.1[more]
SMESG000003087.13.163e-3234.17SMESG000003087.1[more]
SMESG000032177.15.677e-1828.10SMESG000032177.1[more]
SMESG000066038.11.299e-921.99SMESG000066038.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022232 ID=SMED30022232|Name=Glutathione s-transferase|organism=Schmidtea mediterranea sexual|type=transcript|length=844bp
TTTCGTTTTCGAAGGCCTCTCGTATTGCATGTAATTTAATCAATGCGAAT
GTGTGTGTGGTTCATTCATTTGTTTGTATAAATACAGGATTTTTTCTAAA
GATTTTCAAACAAAATGGCTGAAAAAATTAAAATTACTTATTTCAATGCT
AAAGCCAAAGCTGAATTGATTCGTTTGATTTTAGTTGCTAGCAATGTTGA
TTTCGAAGATAAGAGAATAGAATTCGAAGATTGGCCTCAATTGAAACCGT
CGATTCCATCTGGTCAGTTGCCAGTGGTTCAGCTTACGTGTGGAACAATT
TTGAATGAAAGTTTGGCAATTGCTAGATATTTTGCCAAAAAATATCATTT
GGCCGGGTCTGGAGAAATAGAAGAATATAAAGCCGATAGAGCAGTTTGCA
CGCTTGATGATTTATTTAATAAAATTGTTGATATATTTCACGAGAAAGAC
GTGGAGAAAAGCAAACTTTTAAGAACTGAATTGAATGAAACGCATTTGGC
AATTTTTTTAAATAGAGTCAGCGGTTACTTTACCGTGCATGATGGCGATT
TTTTTCTTGGTTCGAAGCCATCTTACGCAGACTTGCAATTGGTGAATATA
ATGGATCACTTTGAAGAGTCACAATATCAAAATTATCCTAAAATCGTCAA
ATGCTATCAACAAGTCTTGGAACATTTCCCAAAGATCAAAGAATACAAAG
CTACCCGAGTTGCTACAATTATTTAGAACTTTTATTTGAATCAGTATTTT
CACTATTGATCAAATAATGATGAAAATTTATTTAATTAAGAATTTTGTTG
ATTTGTGCATTTTTTGATTGGTTGATTAATCAATACTATTTGAG
back to top

protein sequence of SMED30022232-orf-1

>SMED30022232-orf-1 ID=SMED30022232-orf-1|Name=SMED30022232-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=204bp
MAEKIKITYFNAKAKAELIRLILVASNVDFEDKRIEFEDWPQLKPSIPSG
QLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDL
FNKIVDIFHEKDVEKSKLLRTELNETHLAIFLNRVSGYFTVHDGDFFLGS
KPSYADLQLVNIMDHFEESQYQNYPKIVKCYQQVLEHFPKIKEYKATRVA
TII*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000012neural progenitor cell
PLANA:0000014zeta neoblast
PLANA:0000019muscle progenitor cell
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000120progenitor cell
PLANA:0000484secretory system
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR036249Thioredoxin-like_sf
IPR040079Glutathione_S-Trfase
IPR036282Glutathione-S-Trfase_C_sf
IPR004046GST_C
IPR004045Glutathione_S-Trfase_N
IPR012336Thioredoxin-like_fold
IPR010987Glutathione-S-Trfase_C-like
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0016740transferase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004046Glutathione S-transferase, C-terminalPFAMPF14497GST_C_3coord: 98..197
e-value: 1.9E-14
score: 53.6
IPR004045Glutathione S-transferase, N-terminalPFAMPF02798GST_Ncoord: 7..74
e-value: 3.1E-9
score: 37.0
IPR004045Glutathione S-transferase, N-terminalPROSITEPS50404GST_NTERcoord: 3..81
score: 24.441
IPR036249Thioredoxin-like superfamilyGENE3DG3DSA:3.40.30.10coord: 6..198
e-value: 8.4E-55
score: 187.9
IPR036249Thioredoxin-like superfamilySUPERFAMILYSSF52833Thioredoxin-likecoord: 4..78
NoneNo IPR availableGENE3DG3DSA:1.20.1050.10coord: 78..186
e-value: 8.4E-55
score: 187.9
NoneNo IPR availableSFLDSFLDG01205AMPS.1coord: 3..199
e-value: 0.0
score: 171.7
NoneNo IPR availablePANTHERPTHR11571:SF206HEMATOPOIETIC PROSTAGLANDIN D SYNTHASEcoord: 4..198
NoneNo IPR availablePANTHERPTHR11571GLUTATHIONE S-TRANSFERASEcoord: 4..198
NoneNo IPR availableCDDcd03039GST_N_Sigma_likecoord: 5..75
e-value: 2.16566E-24
score: 89.1452
NoneNo IPR availableCDDcd03192GST_C_Sigma_likecoord: 85..184
e-value: 7.10396E-14
score: 63.0254
IPR040079Glutathione Transferase familySFLDSFLDS00019Glutathione_Transferase_(cytocoord: 3..199
e-value: 0.0
score: 171.7
IPR010987Glutathione S-transferase, C-terminal-likePROSITEPS50405GST_CTERcoord: 83..203
score: 12.04
IPR036282Glutathione S-transferase, C-terminal domain superfamilySUPERFAMILYSSF47616GST C-terminal domain-likecoord: 79..198