ATPase family AAA domain containing protein

Overview
NameATPase family AAA domain containing protein
Smed IDSMED30022209
Length (bp)1901
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ATPase family AAA domain containing protein (SMED30022209) t-SNE clustered cells

Violin plots show distribution of expression levels for ATPase family AAA domain containing protein (SMED30022209) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ATPase family AAA domain containing protein (SMED30022209) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ATPase family AAA domain containing protein (SMED30022209) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022209

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30022209SMESG000003318.1 SmedASXL_008659SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30022209SMESG000003318.1 SmedASXL_008659SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
gutSMED30022209SMESG000003318.1 dd_Smed_v4_1807_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30022209SMESG000003318.1 dd_Smed_v4_1807_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30022209SMESG000003318.1 dd_Smed_v4_1807_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30022209SMESG000003318.1 dd_Smed_v4_1807_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30022209SMESG000003318.1 dd_Smed_v6_1807_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30022209SMESG000003318.1 dd_Smed_v6_1807_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ATPase family AAA domain containing protein vs. Ensembl Human
Match: ATAD3B (ATPase family AAA domain containing 3B [Source:HGNC Symbol;Acc:HGNC:24007])

HSP 1 Score: 511.146 bits (1315), Expect = 6.290e-174
Identity = 266/508 (52.36%), Postives = 365/508 (71.85%), Query Frame = 3
Query:  255 KYAQEAFNLSKENERTKQIEYQKEIKAYELQLEHWKTDQFRVXXXXXXXXXXXXXXXXXMRADYQDHLARQRSNDQLTQQRKFQEEQLRKQEDSVEKQENLKRGTIEYQAELAHQNALKEIQAKMVGKAKAERENHDIRMERMRAEAIEHRETVLTSIKNVGEIVGTGLNDFFHDKTKVATLIVAVTLTAGGISGMR----TTFRFIESRIGKPSLIRETSRINAIDFLRHPIKTFKSRMDKPTDPLANIVLKPTLEERLRRLAIATRHTKANNGFYRNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTPLGERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRSTLNAFLQRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKNQRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVDWQASAYSSDDGVLTESMMDKIVEEAIEGYNKKEEWRK 1766
            +YA+EA NL++  E+T Q+E Q ++K YE  +E  K++Q R Q EE+R+ + EET+Q + RA YQD LARQR  DQL QQ+   EE LRKQE+SV+KQE ++R T+E + EL H+N +  ++ +   +AKAEREN DI  E++R +A EHR+TVL SI+  G + G G   F  D+ KV   +  +TL A G+   +     T RFIE+R+GKPSL+RETSRI  ++ LRHPI+  +  + +P D L  +VL P+LE R+R +AIATR+TK N G YR+ LL+GPPGTGKT +AK LA+ S MDYAIM+GGDV P+G  GV+ MHK+F+WA TSRRGL+LF+DEADAFL KR   +IS++LR+TLNAFL   G+ S KFM+V A+N PEQFD A+NSRID +V F LP   ER RLVR +F   VL PA++ +R RL+    + ++  KC+++A +TEG+SGR+I+++AV WQA+AY+S DGVLTE+MMD  V++A++ Y +K  W K
Sbjct:   69 RYAKEALNLAQMQEQTLQLEQQSKLKEYEAAVEQLKSEQIRAQAEERRKTLSEETRQHQARAQYQDKLARQRYEDQLKQQQLLNEENLRKQEESVQKQEAMRRATVEREMELRHKNEMLRVETEARARAKAERENADIIREQIRLKASEHRQTVLESIRTAGTLFGEGFRAFVTDRDKVTATVAGLTLLAVGVYSAKNATAVTGRFIEARLGKPSLVRETSRITVLEALRHPIQVSRRLLSRPQDVLEGVVLSPSLEARVRDIAIATRNTKKNRGLYRHILLYGPPGTGKTLFAKKLALHSGMDYAIMTGGDVAPMGREGVTAMHKLFDWANTSRRGLLLFMDEADAFLRKRATEEISKDLRATLNAFLYHMGQHSNKFMLVLASNLPEQFDCAINSRIDVMVHFDLPQQEERERLVRLHFDNCVLKPATEGKR-RLKLA--QFDYGRKCSEVARLTEGMSGREIAQLAVSWQATAYASKDGVLTEAMMDACVQDAVQQYRQKMRWLK 573          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Human
Match: ATAD3A (ATPase family AAA domain containing 3A [Source:HGNC Symbol;Acc:HGNC:25567])

HSP 1 Score: 504.597 bits (1298), Expect = 2.280e-172
Identity = 269/509 (52.85%), Postives = 370/509 (72.69%), Query Frame = 3
Query:  255 KYAQEAFNLSKENERTKQIEYQKEIKAYELQLEHWKTDQFRVXXXXXXXXXXXXXXXXXMRADYQDHLARQRSNDQLTQQRKFQEEQLRKQEDSVEKQENLKRGTIEYQAELAHQNALKEIQAKMVGKAKAERENHDIRMERMRAEAIEHRETVLTSIKNVGEIVGTGLNDFFHDKTKVATLIVAVTLTAGGI-SGMRTTF---RFIESRIGKPSLIRETSRINAIDFLRHPIKTFKSRMDKPTDPLANIVLKPTLEERLRRLAIATRHTKANNGFYRNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTPLGERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRSTLNAFLQRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKN-QRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVDWQASAYSSDDGVLTESMMDKIVEEAIEGYNKKEEWRK 1766
            +YA++A NL++  E+T Q+E Q ++K YE  +E  K++Q R Q EE+R+ + EET+Q + RA YQD LARQR  DQL QQ+   EE LRKQE+SV+KQE ++R T+E + EL H+N +  ++A+   +AKAEREN DI  E++R +A EHR+TVL SI+  G + G G   F  D  KV   +  +TL A G+ S    T    RFIE+R+GKPSL+RETSRI  ++ LRHPI+  +  + +P D L  +VL P+LE R+R +AIATR+TK N   YRN L++GPPGTGKT +AK LA+ S MDYAIM+GGDV P+G  GV+ MHK+F+WA TSRRGL+LF+DEADAFL KR   +ISE+LR+TLNAFL RTG+ S KFM+V A+N PEQFDWA+N RI+E+V F LP   ER RLVR YF ++VL PA++  QR++L     + ++  KC+++A +TEG+SGR+I+++AV WQA+AY+S+DGVLTE+MMD  V++A++ + +K  W K
Sbjct:   69 RYAKDALNLAQMQEQTLQLEQQSKLKEYEAAVEQLKSEQIRAQAEERRKTLSEETRQHQARAQYQDKLARQRYEDQLKQQQLLNEENLRKQEESVQKQEAMRRATVEREMELRHKNEMLRVEAEARARAKAERENADIIREQIRLKAAEHRQTVLESIRTAGTLFGEGFRAFVTDWDKVTATVAGLTLLAVGVYSAKNATLVAGRFIEARLGKPSLVRETSRITVLEALRHPIQVSRRLLSRPQDALEGVVLSPSLEARVRDIAIATRNTKKNRSLYRNILMYGPPGTGKTLFAKKLALHSGMDYAIMTGGDVAPMGREGVTAMHKLFDWANTSRRGLLLFVDEADAFLRKRATEKISEDLRATLNAFLYRTGQHSNKFMLVLASNQPEQFDWAINDRINEMVHFDLPGQEERERLVRMYFDKYVLKPATEGKQRLKL----AQFDYGRKCSEVARLTEGMSGREIAQLAVSWQATAYASEDGVLTEAMMDTRVQDAVQQHQQKMCWLK 573          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Human
Match: ATAD3A (ATPase family AAA domain containing 3A [Source:HGNC Symbol;Acc:HGNC:25567])

HSP 1 Score: 497.664 bits (1280), Expect = 9.406e-171
Identity = 259/486 (53.29%), Postives = 353/486 (72.63%), Query Frame = 3
Query:  324 EIKAYELQLEHWKTDQFRVXXXXXXXXXXXXXXXXXMRADYQDHLARQRSNDQLTQQRKFQEEQLRKQEDSVEKQENLKRGTIEYQAELAHQNALKEIQAKMVGKAKAERENHDIRMERMRAEAIEHRETVLTSIKNVGEIVGTGLNDFFHDKTKVATLIVAVTLTAGGI-SGMRTTF---RFIESRIGKPSLIRETSRINAIDFLRHPIKTFKSRMDKPTDPLANIVLKPTLEERLRRLAIATRHTKANNGFYRNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTPLGERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRSTLNAFLQRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKN-QRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVDWQASAYSSDDGVLTESMMDKIVEEAIEGYNKKEEWRK 1766
            ++K YE  +E  K++Q R Q EE+R+ + EET+Q + RA YQD LARQR  DQL QQ+   EE LRKQE+SV+KQE ++R T+E + EL H+N +  ++A+   +AKAEREN DI  E++R +A EHR+TVL SI+  G + G G   F  D  KV   +  +TL A G+ S    T    RFIE+R+GKPSL+RETSRI  ++ LRHPI+  +  + +P D L  +VL P+LE R+R +AIATR+TK N   YRN L++GPPGTGKT +AK LA+ S MDYAIM+GGDV P+G  GV+ MHK+F+WA TSRRGL+LF+DEADAFL KR   +ISE+LR+TLNAFL RTG+ S KFM+V A+N PEQFDWA+N RI+E+V F LP   ER RLVR YF ++VL PA++  QR++L     + ++  KC+++A +TEG+SGR+I+++AV WQA+AY+S+DGVLTE+MMD  V++A++ + +K  W K
Sbjct:   13 KLKEYEAAVEQLKSEQIRAQAEERRKTLSEETRQHQARAQYQDKLARQRYEDQLKQQQLLNEENLRKQEESVQKQEAMRRATVEREMELRHKNEMLRVEAEARARAKAERENADIIREQIRLKAAEHRQTVLESIRTAGTLFGEGFRAFVTDWDKVTATVAGLTLLAVGVYSAKNATLVAGRFIEARLGKPSLVRETSRITVLEALRHPIQVSRRLLSRPQDALEGVVLSPSLEARVRDIAIATRNTKKNRSLYRNILMYGPPGTGKTLFAKKLALHSGMDYAIMTGGDVAPMGREGVTAMHKLFDWANTSRRGLLLFVDEADAFLRKRATEKISEDLRATLNAFLYRTGQHSNKFMLVLASNQPEQFDWAINDRINEMVHFDLPGQEERERLVRMYFDKYVLKPATEGKQRLKL----AQFDYGRKCSEVARLTEGMSGREIAQLAVSWQATAYASEDGVLTEAMMDTRVQDAVQQHQQKMCWLK 494          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Human
Match: ATAD3A (ATPase family AAA domain containing 3A [Source:HGNC Symbol;Acc:HGNC:25567])

HSP 1 Score: 495.738 bits (1275), Expect = 4.177e-168
Identity = 258/485 (53.20%), Postives = 352/485 (72.58%), Query Frame = 3
Query:  327 IKAYELQLEHWKTDQFRVXXXXXXXXXXXXXXXXXMRADYQDHLARQRSNDQLTQQRKFQEEQLRKQEDSVEKQENLKRGTIEYQAELAHQNALKEIQAKMVGKAKAERENHDIRMERMRAEAIEHRETVLTSIKNVGEIVGTGLNDFFHDKTKVATLIVAVTLTAGGI-SGMRTTF---RFIESRIGKPSLIRETSRINAIDFLRHPIKTFKSRMDKPTDPLANIVLKPTLEERLRRLAIATRHTKANNGFYRNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTPLGERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRSTLNAFLQRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKN-QRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVDWQASAYSSDDGVLTESMMDKIVEEAIEGYNKKEEWRK 1766
            ++ YE  +E  K++Q R Q EE+R+ + EET+Q + RA YQD LARQR  DQL QQ+   EE LRKQE+SV+KQE ++R T+E + EL H+N +  ++A+   +AKAEREN DI  E++R +A EHR+TVL SI+  G + G G   F  D  KV   +  +TL A G+ S    T    RFIE+R+GKPSL+RETSRI  ++ LRHPI+  +  + +P D L  +VL P+LE R+R +AIATR+TK N   YRN L++GPPGTGKT +AK LA+ S MDYAIM+GGDV P+G  GV+ MHK+F+WA TSRRGL+LF+DEADAFL KR   +ISE+LR+TLNAFL RTG+ S KFM+V A+N PEQFDWA+N RI+E+V F LP   ER RLVR YF ++VL PA++  QR++L     + ++  KC+++A +TEG+SGR+I+++AV WQA+AY+S+DGVLTE+MMD  V++A++ + +K  W K
Sbjct:  141 LQEYEAAVEQLKSEQIRAQAEERRKTLSEETRQHQARAQYQDKLARQRYEDQLKQQQLLNEENLRKQEESVQKQEAMRRATVEREMELRHKNEMLRVEAEARARAKAERENADIIREQIRLKAAEHRQTVLESIRTAGTLFGEGFRAFVTDWDKVTATVAGLTLLAVGVYSAKNATLVAGRFIEARLGKPSLVRETSRITVLEALRHPIQVSRRLLSRPQDALEGVVLSPSLEARVRDIAIATRNTKKNRSLYRNILMYGPPGTGKTLFAKKLALHSGMDYAIMTGGDVAPMGREGVTAMHKLFDWANTSRRGLLLFVDEADAFLRKRATEKISEDLRATLNAFLYRTGQHSNKFMLVLASNQPEQFDWAINDRINEMVHFDLPGQEERERLVRMYFDKYVLKPATEGKQRLKL----AQFDYGRKCSEVARLTEGMSGREIAQLAVSWQATAYASEDGVLTEAMMDTRVQDAVQQHQQKMCWLK 621          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Human
Match: ATAD3C (ATPase family AAA domain containing 3C [Source:HGNC Symbol;Acc:HGNC:32151])

HSP 1 Score: 392.889 bits (1008), Expect = 3.629e-131
Identity = 191/376 (50.80%), Postives = 262/376 (69.68%), Query Frame = 3
Query:  657 NHDIRMERMRAEAIE-HRETVLTSIKNVGEIVGTGLNDFFHDKTKVATLIVAVTLTAGGISGMR----TTFRFIESRIGKPSLIRETSRINAIDFLRHPIKTFKSRM-DKPTDPLANIVLKPTLEERLRRLAIATRHTKANNGFYRNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTPLGERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRSTLNAFLQRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKNQRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVDWQASAYSSDDGVLTESMMDKIVEEAIEGYNKKEEWRK 1766
            N D+R +    E+++ H +T L SI+  G + G G   F  D+ KV   +  +TL A G+   +     T R+IE+R+GKPSL+RETSRI  ++ LRHPI+    R+  +P D L  +VL P+LE R+R +AI TR+ K N G YR+ LL+GPPGTGKT +AK LA+ S MDYAIM+GGDV P+G  GV+ MHK+F+WA TSRRGL+LF+DEADAFL KR   +ISE+LR+TLNAFL RTG+ S KFM++ A+  PEQFDWA+N+ ID +V F LP   ER RLVR Y  E+VL PA++ +R RL+    + ++  KC +IA +TEG+S R I+++AV WQA+AY+S DGVLTE+MMD  V++ ++ + +   W K
Sbjct:   29 NEDLRKQE---ESVQKHHQTFLESIRAAGTLFGEGFRAFVTDRDKVTATVAGLTLLAVGVYSAKNATAVTGRYIEARLGKPSLVRETSRITVLEALRHPIQQVSRRLLSRPQDVLEGVVLSPSLEARVRDIAIMTRNIKKNRGLYRHILLYGPPGTGKTLFAKKLALHSGMDYAIMTGGDVAPMGREGVTAMHKLFDWANTSRRGLLLFVDEADAFLRKRATEKISEDLRATLNAFLYRTGQHSNKFMLILASCHPEQFDWAINACIDVMVHFDLPGQEERARLVRMYLNEYVLKPATEGKR-RLKLA--QFDYGRKCLEIARLTEGMSCRKIAQLAVSWQATAYASKDGVLTEAMMDACVQDFVQQHQQMMRWLK 398          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Celegans
Match: atad-3 (ATPase family AAA domain-containing protein 3 [Source:UniProtKB/Swiss-Prot;Acc:Q20748])

HSP 1 Score: 508.834 bits (1309), Expect = 2.514e-174
Identity = 283/574 (49.30%), Postives = 397/574 (69.16%), Query Frame = 3
Query:   72 MSWIFGSGKSXXXXXXXXXXXXXXXSKDKEKESTKVKAG----AYSFXXXXXXXXXXXXXXXXXXKYAQEAFNLSKENERTKQIEYQKEIKAYELQLEHWKTDQFRVXXXXXXXXXXXXXXXXXMRADYQDHLARQRSNDQLTQQRKFQEEQLRKQEDSVEKQENLKRGTIEYQAELAHQNALKEIQAKMVGKAKAERENHDIRMERMRAEAIEHRETVLTSIKNVGEIVGTGLNDFFHDKTKVATLIVAVTLTAGGI----SGMRTTFRFIESRIGKPSLIRETSRINAIDFLRHPIKTFKSRMDKPTDPLANIVLKPTLEERLRRLAIATRHTKANNGFYRNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTPLGERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRSTLNAFLQRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPA---SKNQRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVDWQASAYSSDDGVLTESMMDKIVEEAIEGYNKKEEW 1760
            MSW+FG  K+     P   Q    P   ++    + + G    AYSFDS ALERAAKAA+DLE    A+EA  LS+  E T+Q E + E K  E QL + K++  RV EEE+R+ + EETK    RA+YQD LAR+R+ ++L  + + QEE LRKQE+SV+KQE L++ TIE++  L H+  L++I A+   +AKA R+N D+ +E+M+    E+R+TV+  IK  GE++G+GLN F +DKTK+A  +  +T  A G      G   T R+IESR+GKPSL+RETSRI  ++ L+HPIK+ +    +  DPL  +VL P LE RLR +AI T +TK NNG +RN + +GPPGTGKT +AKSLA  S +DYA+++GGD+ PLG  GVS +HK+F+WA  SR+GL++FIDEADAFL KR++  +SE+ R+ LNAFL RTGEQS+KFM+V A+N PEQFDWAVN R D++VEF LP + ER R++ QYF E ++ PA   S++QR++L+  D    W +KCN++A  T G+SGR++SK+ + WQASAY+S+ GVLTE+++D+   +A+  +  K EW
Sbjct:    1 MSWLFGVQKNATPQIPDDFQAGAAPGGPQQPGQGQRQEGNSKMAYSFDSTALERAAKAARDLEKFPNAKEALELSRMQEVTRQKEVENETKKIEAQLANMKSEHIRVAEEERRKTLGEETKHAHSRAEYQDQLARKRAEEELAMKARMQEESLRKQEESVKKQEQLRKQTIEHELALKHKYELEKIDAETRARAKAARDNRDVNLEQMKLHEEENRKTVIEKIKTSGELIGSGLNQFLNDKTKIAAAVGGLTALAVGWYTAKRGTGVTARYIESRLGKPSLVRETSRITPLEVLKHPIKSVQMMTRQKKDPLNGVVLPPALERRLRDIAITTSNTKRNNGLFRNVMFYGPPGTGKTLFAKSLAQHSGLDYAVLTGGDIAPLGRDGVSAIHKVFDWASKSRKGLIVFIDEADAFLQKRSKNGMSEDTRAALNAFLFRTGEQSRKFMLVVASNQPEQFDWAVNDRFDQLVEFTLPGMEERERILLQYFNEHIVTPATSGSRSQRLKLDNFD----WVAKCNEVAKKTSGMSGRELSKLVIGWQASAYASETGVLTEAIVDRNTADAMVQHEHKMEW 570          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Celegans
Match: atad-3 (ATPase family AAA domain-containing protein 3 [Source:UniProtKB/Swiss-Prot;Acc:Q20748])

HSP 1 Score: 508.834 bits (1309), Expect = 2.514e-174
Identity = 283/574 (49.30%), Postives = 397/574 (69.16%), Query Frame = 3
Query:   72 MSWIFGSGKSXXXXXXXXXXXXXXXSKDKEKESTKVKAG----AYSFXXXXXXXXXXXXXXXXXXKYAQEAFNLSKENERTKQIEYQKEIKAYELQLEHWKTDQFRVXXXXXXXXXXXXXXXXXMRADYQDHLARQRSNDQLTQQRKFQEEQLRKQEDSVEKQENLKRGTIEYQAELAHQNALKEIQAKMVGKAKAERENHDIRMERMRAEAIEHRETVLTSIKNVGEIVGTGLNDFFHDKTKVATLIVAVTLTAGGI----SGMRTTFRFIESRIGKPSLIRETSRINAIDFLRHPIKTFKSRMDKPTDPLANIVLKPTLEERLRRLAIATRHTKANNGFYRNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTPLGERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRSTLNAFLQRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPA---SKNQRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVDWQASAYSSDDGVLTESMMDKIVEEAIEGYNKKEEW 1760
            MSW+FG  K+     P   Q    P   ++    + + G    AYSFDS ALERAAKAA+DLE    A+EA  LS+  E T+Q E + E K  E QL + K++  RV EEE+R+ + EETK    RA+YQD LAR+R+ ++L  + + QEE LRKQE+SV+KQE L++ TIE++  L H+  L++I A+   +AKA R+N D+ +E+M+    E+R+TV+  IK  GE++G+GLN F +DKTK+A  +  +T  A G      G   T R+IESR+GKPSL+RETSRI  ++ L+HPIK+ +    +  DPL  +VL P LE RLR +AI T +TK NNG +RN + +GPPGTGKT +AKSLA  S +DYA+++GGD+ PLG  GVS +HK+F+WA  SR+GL++FIDEADAFL KR++  +SE+ R+ LNAFL RTGEQS+KFM+V A+N PEQFDWAVN R D++VEF LP + ER R++ QYF E ++ PA   S++QR++L+  D    W +KCN++A  T G+SGR++SK+ + WQASAY+S+ GVLTE+++D+   +A+  +  K EW
Sbjct:    1 MSWLFGVQKNATPQIPDDFQAGAAPGGPQQPGQGQRQEGNSKMAYSFDSTALERAAKAARDLEKFPNAKEALELSRMQEVTRQKEVENETKKIEAQLANMKSEHIRVAEEERRKTLGEETKHAHSRAEYQDQLARKRAEEELAMKARMQEESLRKQEESVKKQEQLRKQTIEHELALKHKYELEKIDAETRARAKAARDNRDVNLEQMKLHEEENRKTVIEKIKTSGELIGSGLNQFLNDKTKIAAAVGGLTALAVGWYTAKRGTGVTARYIESRLGKPSLVRETSRITPLEVLKHPIKSVQMMTRQKKDPLNGVVLPPALERRLRDIAITTSNTKRNNGLFRNVMFYGPPGTGKTLFAKSLAQHSGLDYAVLTGGDIAPLGRDGVSAIHKVFDWASKSRKGLIVFIDEADAFLQKRSKNGMSEDTRAALNAFLFRTGEQSRKFMLVVASNQPEQFDWAVNDRFDQLVEFTLPGMEERERILLQYFNEHIVTPATSGSRSQRLKLDNFD----WVAKCNEVAKKTSGMSGRELSKLVIGWQASAYASETGVLTEAIVDRNTADAMVQHEHKMEW 570          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Celegans
Match: ppgn-1 (ParaPleGiN AAA protease family; Paraplegin [Source:UniProtKB/TrEMBL;Acc:G5EDB6])

HSP 1 Score: 75.485 bits (184), Expect = 6.530e-14
Identity = 71/249 (28.51%), Postives = 113/249 (45.38%), Query Frame = 3
Query: 1044 RHTKANNGFYRNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGD-VTPLGERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRS--------TLNAFL-QRTGEQSKKFMVVFA-TNAPEQFDWAV--NSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKNQRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVDWQASAYSSDDGVLTESMMDKIVEEAIEGYNKK 1751
            R TK      R ALL GPPG GKT  AK+LA  S + +  M+G + V  +G  G S +  +F  A+ SR   +++IDE DA   KR++   +             TLN  L +  G  S   +VV A TN  +  D A+    R D  +   LP + ER  +   Y            ++I+L+   ++ +      ++A +T G +G DI  +  +    A S+   V+T   M+  ++  + G  K+
Sbjct:  309 RFTKLGAKLPRGALLTGPPGCGKTLLAKALAAESTVPFISMNGSEFVEVIGGLGASRIRGLFKEAR-SRAPCIIYIDEIDAIGRKRSEGAGAGGGFGGGSGEEEQTLNQLLVEMDGMGSGNGVVVLASTNRADVLDKALLRPGRFDRHISIDLPTVLERKDMFELYM-----------RKIKLDHAPQEYS-----QRLAALTPGFTGADIMNVCNESAIRAASNKCHVVTHKDMEYALDRVLAGSEKR 540          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Celegans
Match: ppgn-1 (ParaPleGiN AAA protease family; Paraplegin [Source:UniProtKB/TrEMBL;Acc:G5EDB6])

HSP 1 Score: 75.485 bits (184), Expect = 6.530e-14
Identity = 71/249 (28.51%), Postives = 113/249 (45.38%), Query Frame = 3
Query: 1044 RHTKANNGFYRNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGD-VTPLGERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRS--------TLNAFL-QRTGEQSKKFMVVFA-TNAPEQFDWAV--NSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKNQRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVDWQASAYSSDDGVLTESMMDKIVEEAIEGYNKK 1751
            R TK      R ALL GPPG GKT  AK+LA  S + +  M+G + V  +G  G S +  +F  A+ SR   +++IDE DA   KR++   +             TLN  L +  G  S   +VV A TN  +  D A+    R D  +   LP + ER  +   Y            ++I+L+   ++ +      ++A +T G +G DI  +  +    A S+   V+T   M+  ++  + G  K+
Sbjct:  309 RFTKLGAKLPRGALLTGPPGCGKTLLAKALAAESTVPFISMNGSEFVEVIGGLGASRIRGLFKEAR-SRAPCIIYIDEIDAIGRKRSEGAGAGGGFGGGSGEEEQTLNQLLVEMDGMGSGNGVVVLASTNRADVLDKALLRPGRFDRHISIDLPTVLERKDMFELYM-----------RKIKLDHAPQEYS-----QRLAALTPGFTGADIMNVCNESAIRAASNKCHVVTHKDMEYALDRVLAGSEKR 540          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Celegans
Match: rpt-1 (26S proteasome regulatory subunit 7 [Source:UniProtKB/Swiss-Prot;Acc:Q18787])

HSP 1 Score: 68.5514 bits (166), Expect = 5.194e-12
Identity = 60/241 (24.90%), Postives = 110/241 (45.64%), Query Frame = 3
Query: 1074 RNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTP--LGERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKR---NQVQISENLRSTLNAFLQRTG-EQSKKFMVVFATNAPEQFDWAV--NSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKNQRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVDWQASAYSSDDGVLTESMMDKIVEEAIEGYNKKEEWRKYL 1772
            +  LL+GPPGTGKT  A+++A  ++  +  + G ++    +GE G   + ++F  A+T ++  ++F DE DA    R    Q   +E  R+ L    Q  G +      V+ ATN P+  D A+    R+D  VEF LPDL+ R  +++ +  +                    +  + + + +A +    +G +I  +  +    A  +   V TE    + + + ++GY K     +YL
Sbjct:  212 KGVLLYGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGE-GARMVRELFEMART-KKACLIFFDEIDAVGGARFDDGQGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKVEFALPDLAGRAHILKIHAKQM------------------SVERDIRYDLLARLCPNSTGAEIRSVCTEAGMFAIRARRKVATEKDFLEAINKVVKGYAKFSATPRYL 432          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Fly
Match: bor (gene:FBgn0040237 transcript:FBtr0083276)

HSP 1 Score: 469.544 bits (1207), Expect = 9.519e-159
Identity = 288/607 (47.45%), Postives = 400/607 (65.90%), Query Frame = 3
Query:   72 MSWIFGSGKSXXXXXXXXXXXXXXXSKDKEKESTKVKAG-------------AYSFXXXXXXXXXXXXXXXXXXKYAQEAFNLSKENERTKQIEYQKEIKAYELQLEHWKTDQFRVXXXXXXXXXXXXXXXXXMRADYQDHLARQRSNDQLTQQRKFQEEQLRKQEDSVEKQENLKRGTIEYQAELAHQNALKEIQAKMVGKAKAERENHDIRMERMRAEAIEHRETVLTSIKNVGEIVGTGLNDFFHDKTKVATLIVAVTL------TAGGISGMRTTFRFIESRIGKPSLIRETSRINAIDFLRHPIKTFKSRMDKPTDPLANIVLKPTLEERLRRLAIATRHTKANNGFYRNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTPLGERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRSTLNAFLQRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKN-QRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVDWQASAYSSDDGVLTESMMDKIVEEAIEGYNKKEEWRKYLLPTAVKADSQQ---TILPPL 1823
            MSW+ G  +  PQ    A       + D E  +   K+G             AY FDS+ALERAA AAK LE SK+A+EA  LSK  E T+Q EY  ++K YE  +E  K +Q R+  EE+R+ + EETKQQ+ RA YQD L+R+R  DQL QQ++ QEE LRKQE+SV++QE ++R TIE++ E+  +N LK ++ ++  KA+ +REN DI +E++R +A EHR TVL  IK  G ++G G      D  KV T    ++L      TA G +G+ +  R++E+RIGKP+L+ ETSR   +D L++P+   K    KPTD L  +VL P LEERLR +AIAT++T+ N G YRN L+ GPPGTGKT +AK LA  S MD+AIM+GGDV P+G+ GV+ +HK+F+W+ TSRRGL+LF+DEADAFL KR+  +ISE+LR+ LNAFL RT EQ+ KFM+V A+N PEQFD+A+N R+DE+VEF LP L ER RL+R YF ++VL PA+   +R +L+      ++   C+++A + EG+SGR+ISK+ V WQA+ Y+S+DG+LTE M+      A + + +K  W    L    +AD +    T  PPL
Sbjct:    1 MSWLLGRNRQQPQPDQTAGFSEGGGAADPEGRTAGEKSGDSQLSRAERKAMEAYRFDSSALERAADAAKTLERSKHAREALELSKMQEATRQTEYNTKVKEYEAHIEQAKVEQKRIDHEERRKTLIEETKQQQQRAQYQDQLSRKRYEDQLLQQQRVQEENLRKQEESVQRQEAMRRQTIEHEIEMKEKNRLKLLEHELRAKARVDRENRDINLEKIRLKAQEHRTTVLEGIKTAGTVIGAGAEAMLTDWDKVLTAAGGLSLLALGVYTAKGATGVVS--RYVEARIGKPTLVGETSRFAFLDALKNPLHYLKRLRAKPTDALQGVVLNPKLEERLRDIAIATKNTRINKGMYRNVLMHGPPGTGKTMFAKKLAEHSGMDFAIMTGGDVAPMGKEGVTAIHKVFDWSHTSRRGLLLFVDEADAFLRKRSSEKISEDLRAALNAFLYRTSEQNPKFMLVLASNTPEQFDYAINDRLDEMVEFTLPGLEERERLLRLYFDKYVLQPAAAGAKRFKLD----TFDYGKTCSKMAALCEGMSGREISKLGVSWQAAVYASEDGLLTEKMVLDRCYSAAQQHKQKMAW----LSDQERADHKSITGTAAPPL 597          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Fly
Match: bor (gene:FBgn0040237 transcript:FBtr0305998)

HSP 1 Score: 469.544 bits (1207), Expect = 9.519e-159
Identity = 288/607 (47.45%), Postives = 400/607 (65.90%), Query Frame = 3
Query:   72 MSWIFGSGKSXXXXXXXXXXXXXXXSKDKEKESTKVKAG-------------AYSFXXXXXXXXXXXXXXXXXXKYAQEAFNLSKENERTKQIEYQKEIKAYELQLEHWKTDQFRVXXXXXXXXXXXXXXXXXMRADYQDHLARQRSNDQLTQQRKFQEEQLRKQEDSVEKQENLKRGTIEYQAELAHQNALKEIQAKMVGKAKAERENHDIRMERMRAEAIEHRETVLTSIKNVGEIVGTGLNDFFHDKTKVATLIVAVTL------TAGGISGMRTTFRFIESRIGKPSLIRETSRINAIDFLRHPIKTFKSRMDKPTDPLANIVLKPTLEERLRRLAIATRHTKANNGFYRNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTPLGERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRSTLNAFLQRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKN-QRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVDWQASAYSSDDGVLTESMMDKIVEEAIEGYNKKEEWRKYLLPTAVKADSQQ---TILPPL 1823
            MSW+ G  +  PQ    A       + D E  +   K+G             AY FDS+ALERAA AAK LE SK+A+EA  LSK  E T+Q EY  ++K YE  +E  K +Q R+  EE+R+ + EETKQQ+ RA YQD L+R+R  DQL QQ++ QEE LRKQE+SV++QE ++R TIE++ E+  +N LK ++ ++  KA+ +REN DI +E++R +A EHR TVL  IK  G ++G G      D  KV T    ++L      TA G +G+ +  R++E+RIGKP+L+ ETSR   +D L++P+   K    KPTD L  +VL P LEERLR +AIAT++T+ N G YRN L+ GPPGTGKT +AK LA  S MD+AIM+GGDV P+G+ GV+ +HK+F+W+ TSRRGL+LF+DEADAFL KR+  +ISE+LR+ LNAFL RT EQ+ KFM+V A+N PEQFD+A+N R+DE+VEF LP L ER RL+R YF ++VL PA+   +R +L+      ++   C+++A + EG+SGR+ISK+ V WQA+ Y+S+DG+LTE M+      A + + +K  W    L    +AD +    T  PPL
Sbjct:    1 MSWLLGRNRQQPQPDQTAGFSEGGGAADPEGRTAGEKSGDSQLSRAERKAMEAYRFDSSALERAADAAKTLERSKHAREALELSKMQEATRQTEYNTKVKEYEAHIEQAKVEQKRIDHEERRKTLIEETKQQQQRAQYQDQLSRKRYEDQLLQQQRVQEENLRKQEESVQRQEAMRRQTIEHEIEMKEKNRLKLLEHELRAKARVDRENRDINLEKIRLKAQEHRTTVLEGIKTAGTVIGAGAEAMLTDWDKVLTAAGGLSLLALGVYTAKGATGVVS--RYVEARIGKPTLVGETSRFAFLDALKNPLHYLKRLRAKPTDALQGVVLNPKLEERLRDIAIATKNTRINKGMYRNVLMHGPPGTGKTMFAKKLAEHSGMDFAIMTGGDVAPMGKEGVTAIHKVFDWSHTSRRGLLLFVDEADAFLRKRSSEKISEDLRAALNAFLYRTSEQNPKFMLVLASNTPEQFDYAINDRLDEMVEFTLPGLEERERLLRLYFDKYVLQPAAAGAKRFKLD----TFDYGKTCSKMAALCEGMSGREISKLGVSWQAAVYASEDGLLTEKMVLDRCYSAAQQHKQKMAW----LSDQERADHKSITGTAAPPL 597          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Fly
Match: Fign (gene:FBgn0031519 transcript:FBtr0077603)

HSP 1 Score: 72.4034 bits (176), Expect = 4.786e-13
Identity = 54/195 (27.69%), Postives = 86/195 (44.10%), Query Frame = 3
Query: 1074 RNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTPLGERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRSTLNAFLQRTGEQSK---KFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKNQRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIA 1649
            R  LLFGPPGTGKT  AKS+A  +   +  ++   +T        ++ K       + +  ++FIDE D+ L KR+  +    LR      +   G  S    + +V+ ATN P++ D AV  R    +  PLP      R  RQ   E ++     N  +R            +  ++A +T+G SG D+  + 
Sbjct:  284 RGVLLFGPPGTGKTLIAKSIASQAKAKFFSINPSSLTSKWVGDAEKLVKTLFAVAAAHQPAIIFIDEVDSLLSKRSANENESTLRLKNEFLIHLDGAASNEEIRVLVIGATNRPQELDEAVRRRFVRRLYVPLP-----TREARQKIIEKLIHQVKHNLDVR------------QVIELAELTDGYSGADVDTLC 461          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Fly
Match: Fign (gene:FBgn0031519 transcript:FBtr0331372)

HSP 1 Score: 72.4034 bits (176), Expect = 4.786e-13
Identity = 54/195 (27.69%), Postives = 86/195 (44.10%), Query Frame = 3
Query: 1074 RNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTPLGERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRSTLNAFLQRTGEQSK---KFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKNQRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIA 1649
            R  LLFGPPGTGKT  AKS+A  +   +  ++   +T        ++ K       + +  ++FIDE D+ L KR+  +    LR      +   G  S    + +V+ ATN P++ D AV  R    +  PLP      R  RQ   E ++     N  +R            +  ++A +T+G SG D+  + 
Sbjct:  284 RGVLLFGPPGTGKTLIAKSIASQAKAKFFSINPSSLTSKWVGDAEKLVKTLFAVAAAHQPAIIFIDEVDSLLSKRSANENESTLRLKNEFLIHLDGAASNEEIRVLVIGATNRPQELDEAVRRRFVRRLYVPLP-----TREARQKIIEKLIHQVKHNLDVR------------QVIELAELTDGYSGADVDTLC 461          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Fly
Match: Vps4 (gene:FBgn0283469 transcript:FBtr0074504)

HSP 1 Score: 70.0922 bits (170), Expect = 2.224e-12
Identity = 58/203 (28.57%), Postives = 97/203 (47.78%), Query Frame = 3
Query: 1071 YRNALLFGPPGTGKTFYAKSLAMASNMD-YAIMSGGDVTP--LGERGVSE--MHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRSTLNAFL---QRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKNQRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVD 1655
            ++  LLFGPPGTGK++ AK++A  +N   +  +S  D+    LGE   SE  +  +F  A+  +  + +FIDE D+    R+  + ++++R     FL   Q  G  +   +V+ ATN P   D A+  R ++ +  PLP+   R+ + + +                  G    +  E    ++A  TEG SG DIS +  D
Sbjct:  165 WKGILLFGPPGTGKSYLAKAVATEANRSTFFSVSSSDLMSKWLGE---SEKLVKNLFELARQHKPSI-IFIDEIDSMCSARSDNE-NDSVRRIKTEFLVQMQGVGNDTDGILVLGATNIPWVLDSAIRRRFEKRIYIPLPEAHARLVMFKIHL-----------------GNTTHVLTEQDLKELAGKTEGYSGADISIVVRD 345          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Zebrafish
Match: atad3 (ATPase family AAA domain containing 3 [Source:ZFIN;Acc:ZDB-GENE-040426-1826])

HSP 1 Score: 124.79 bits (312), Expect = 4.839e-32
Identity = 77/159 (48.43%), Postives = 116/159 (72.96%), Query Frame = 3
Query:  255 KYAQEAFNLSKENERTKQIEYQKEIKAYELQLEHWKTDQFRVXXXXXXXXXXXXXXXXXMRADYQDHLARQRSNDQLTQQRKFQEEQLRKQEDSVEKQENLKRGTIEYQAELAHQNALKEIQAKMVGKAKAERENHDIRMERMRAEAIEHRETVLTSIK 731
            ++A+EA +L++  E+T Q+E+Q +IK YE  +E  K +Q R+Q +E+R+ + EET+Q + RA YQD LARQR +DQL QQ    EE LRKQE+SV+KQE ++R TIE++ +L H+N +  ++A+   +A+ EREN DI  E++R +A EHR+TVL SI+
Sbjct:   63 RHAKEALDLARMQEQTVQMEHQGKIKEYEAAVEQLKGEQIRIQADERRKTLNEETRQHQARAQYQDKLARQRYDDQLRQQTLLNEENLRKQEESVQKQEAMRRATIEHEMDLRHKNEMLRVEAESKARARVERENADIIREQIRLKAAEHRQTVLESIR 221          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Zebrafish
Match: vps4a (vacuolar protein sorting 4 homolog A [Source:ZFIN;Acc:ZDB-GENE-060929-388])

HSP 1 Score: 77.411 bits (189), Expect = 1.477e-14
Identity = 65/203 (32.02%), Postives = 97/203 (47.78%), Query Frame = 3
Query: 1071 YRNALLFGPPGTGKTFYAKSLAM-ASNMDYAIMSGGDVTP--LGERGVSE--MHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRSTLNAFL---QRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKNQRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVD 1655
            +R  LLFGPPGTGK++ AK++A  A+N  +  +S  D+    LGE   SE  +  +F+ A+  +  + +FIDE D+    RN+ + SE  R     FL   Q  G  +   +V+ ATN P   D A+  R ++ +  PLP+   R  + R +                  G       E+   Q+A  T+G SG DIS I  D
Sbjct:  159 WRGILLFGPPGTGKSYLAKAVATEANNSTFFSVSSSDLMSKWLGE---SEKLVKNLFDLARQHKPSI-IFIDEVDSLCGSRNENE-SEAARRIKTEFLVQMQGVGNNNDGILVLGATNIPWVLDAAIRRRFEKRIYIPLPEEPARSAMFRLHL-----------------GNTPHSLTEADLRQLARKTDGYSGADISIIVRD 339          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Zebrafish
Match: vps4b (vacuolar protein sorting 4 homolog B [Source:ZFIN;Acc:ZDB-GENE-040426-1235])

HSP 1 Score: 70.4774 bits (171), Expect = 3.059e-12
Identity = 59/202 (29.21%), Postives = 96/202 (47.52%), Query Frame = 3
Query: 1071 YRNALLFGPPGTGKTFYAKSLAM-ASNMDYAIMSGGDVTP--LGERGVSE--MHKIFNWAQTSRRGLMLFIDEADAFLYKR--NQVQISENLRSTLNAFLQRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKNQRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVD 1655
            +R  LLFGPPGTGK++ AK++A  A+N  +  +S  D+    LGE   SE  +  +F  A+  +  + +FIDE D+    R  N+ + +  +++     +Q  G  ++  +V+ ATN P   D A+  R ++ +  PLP+        R + ++  L            G       ES    +   T+G SG DIS I  D
Sbjct:  230 WRGILLFGPPGTGKSYLAKAVATEANNSTFFSISSSDLVSKWLGE---SEKLVKSLFTLAREHKPSI-IFIDEIDSLCGSRSENESEAARRIKTEFLVQMQGVGNDNEGILVLGATNIPWTLDSAIRRRFEKRIYIPLPE-----EHARSFMFKLNL------------GTTPNSLTESDFMTLGKKTDGYSGADISIIVRD 410          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Zebrafish
Match: vps4b (vacuolar protein sorting 4 homolog B [Source:ZFIN;Acc:ZDB-GENE-040426-1235])

HSP 1 Score: 70.0922 bits (170), Expect = 3.308e-12
Identity = 59/202 (29.21%), Postives = 96/202 (47.52%), Query Frame = 3
Query: 1071 YRNALLFGPPGTGKTFYAKSLAM-ASNMDYAIMSGGDVTP--LGERGVSE--MHKIFNWAQTSRRGLMLFIDEADAFLYKR--NQVQISENLRSTLNAFLQRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKNQRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVD 1655
            +R  LLFGPPGTGK++ AK++A  A+N  +  +S  D+    LGE   SE  +  +F  A+  +  + +FIDE D+    R  N+ + +  +++     +Q  G  ++  +V+ ATN P   D A+  R ++ +  PLP+        R + ++  L            G       ES    +   T+G SG DIS I  D
Sbjct:  160 WRGILLFGPPGTGKSYLAKAVATEANNSTFFSISSSDLVSKWLGE---SEKLVKSLFTLAREHKPSI-IFIDEIDSLCGSRSENESEAARRIKTEFLVQMQGVGNDNEGILVLGATNIPWTLDSAIRRRFEKRIYIPLPE-----EHARSFMFKLNL------------GTTPNSLTESDFMTLGKKTDGYSGADISIIVRD 340          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Zebrafish
Match: vps4b (vacuolar protein sorting 4 homolog B [Source:ZFIN;Acc:ZDB-GENE-040426-1235])

HSP 1 Score: 70.0922 bits (170), Expect = 3.308e-12
Identity = 59/202 (29.21%), Postives = 96/202 (47.52%), Query Frame = 3
Query: 1071 YRNALLFGPPGTGKTFYAKSLAM-ASNMDYAIMSGGDVTP--LGERGVSE--MHKIFNWAQTSRRGLMLFIDEADAFLYKR--NQVQISENLRSTLNAFLQRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKNQRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVD 1655
            +R  LLFGPPGTGK++ AK++A  A+N  +  +S  D+    LGE   SE  +  +F  A+  +  + +FIDE D+    R  N+ + +  +++     +Q  G  ++  +V+ ATN P   D A+  R ++ +  PLP+        R + ++  L            G       ES    +   T+G SG DIS I  D
Sbjct:  160 WRGILLFGPPGTGKSYLAKAVATEANNSTFFSISSSDLVSKWLGE---SEKLVKSLFTLAREHKPSI-IFIDEIDSLCGSRSENESEAARRIKTEFLVQMQGVGNDNEGILVLGATNIPWTLDSAIRRRFEKRIYIPLPE-----EHARSFMFKLNL------------GTTPNSLTESDFMTLGKKTDGYSGADISIIVRD 340          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Xenopus
Match: nkx3-1 (NK3 homeobox 1 [Source:Xenbase;Acc:XB-GENE-479027])

HSP 1 Score: 534.643 bits (1376), Expect = 0.000e+0
Identity = 276/528 (52.27%), Postives = 371/528 (70.27%), Query Frame = 3
Query:  255 KYAQEAFNLSKENERTKQIEYQKEIKAYELQLEHWKTDQFRVXXXXXXXXXXXXXXXXXMRADYQDHLARQRSNDQLTQQRKFQEEQLRKQEDSVEKQENLKRGTIEYQAELAHQNALKEIQAKMVGKAKAERENHDIRMERMRAEAIEHRETVLTSIKNVGEIVGTGLNDFFHDKTKVATLIVAVTLTAGGI----SGMRTTFRFIESRIGKPSLIRETSRINAIDFLRHPIKTFKSRMDKPTDPLANIVLKPTLEERLRRLAIATRHTKANNGFYRNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTPLGERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRSTLNAFLQRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKN-QRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVDWQASAYSSDDGVLTESMMDKIVEEAIEGYNKKEEWRKYLLPTAVKADSQQTILPPL 1823
            ++A+EA NL+K  E T Q+E Q +IK YE  +E  K +Q RVQ EE+R+ + EETKQ + RA YQD LARQR  DQL QQ+   EE LR+QE+SV+KQE +++ T+E++ EL H+N +  I+A+   +AK EREN DI  E +R +A EHR+TVL SIK  G + G G   F  D  KV   +  ++L A GI    +      R+IE+R+GKPSL+R+TSR    + ++HP+K  K  + K  D L  ++L P LEER+R +AIATR+TKAN G YRN L++GPPGTGKT +AK LAM S MDYAIM+GGDV P+G  GV+ MHK+F+WA TS+RGL+LF+DEADAFL KR+  +ISE+LR+TLNAFL RTGEQS KFM+V A+N PEQFDWA+N RIDE+V F LP L ER RLVR YF ++VL PAS+  QR+++     + ++  KC+ +A +TEG+SGR+ISK+ V WQA+AY+S+DG+L E+M+D  V +AI  + +K EW K         +S +  L PL
Sbjct:   65 RHAKEALNLAKVQEETLQLEQQSKIKEYEAAVEQLKNEQIRVQAEERRKTLNEETKQHQARAQYQDKLARQRYEDQLRQQQLQNEENLRRQEESVQKQEAMRKATVEHEMELRHKNEMLRIEAEARARAKVERENADIIRENIRLKAAEHRQTVLESIKTAGTVFGEGFRAFISDWDKVTATVAGLSLLAVGIYTAKNATGVAGRYIEARLGKPSLVRDTSRFTVAEAVKHPVKISKRLLSKIQDALEGVILSPKLEERVRDIAIATRNTKANKGLYRNILMYGPPGTGKTLFAKKLAMHSGMDYAIMTGGDVAPMGREGVTAMHKVFDWAGTSKRGLLLFVDEADAFLRKRSTEKISEDLRATLNAFLYRTGEQSNKFMLVLASNQPEQFDWAINDRIDEIVHFDLPGLEERERLVRLYFDKYVLQPASEGKQRLKV----AQFDYGKKCSDLAQLTEGMSGREISKLGVAWQAAAYASEDGILNEAMIDARVADAIRQHQQKMEWLKAEGKENAAKESGKNPLQPL 588          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Xenopus
Match: nkx3-1 (NK3 homeobox 1 [Source:Xenbase;Acc:XB-GENE-479027])

HSP 1 Score: 527.709 bits (1358), Expect = 0.000e+0
Identity = 272/509 (53.44%), Postives = 364/509 (71.51%), Query Frame = 3
Query:  255 KYAQEAFNLSKENERTKQIEYQKEIKAYELQLEHWKTDQFRVXXXXXXXXXXXXXXXXXMRADYQDHLARQRSNDQLTQQRKFQEEQLRKQEDSVEKQENLKRGTIEYQAELAHQNALKEIQAKMVGKAKAERENHDIRMERMRAEAIEHRETVLTSIKNVGEIVGTGLNDFFHDKTKVATLIVAVTLTAGGI----SGMRTTFRFIESRIGKPSLIRETSRINAIDFLRHPIKTFKSRMDKPTDPLANIVLKPTLEERLRRLAIATRHTKANNGFYRNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTPLGERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRSTLNAFLQRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKN-QRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVDWQASAYSSDDGVLTESMMDKIVEEAIEGYNKKEEWRK 1766
            ++A+EA NL+K  E T Q+E Q +IK YE  +E  K +Q RVQ EE+R+ + EETKQ + RA YQD LARQR  DQL QQ+   EE LR+QE+SV+KQE +++ T+E++ EL H+N +  I+A+   +AK EREN DI  E +R +A EHR+TVL SIK  G + G G   F  D  KV   +  ++L A GI    +      R+IE+R+GKPSL+R+TSR    + ++HPI   K  + K  D L  ++L P LEER+R +AIATR+TKAN G YRN L++GPPGTGKT +AK LAM S MDYAIM+GGDV P+G  GV+ MHK+F+WA TS+RGL+LF+DEADAFL KR+  +ISE+LR+TLNAFL RTGEQS KFM+V A+N PEQFDWA+N RIDE+V F LP L ER RLVR YF ++VL PAS+  QR+++     + ++  KC+ +A +TEG+SGR+ISK+ V WQA+AY+S+DG+L E+M+D  V +AI  + +K EW K
Sbjct:   65 RHAKEALNLAKVQEETLQLEQQSKIKEYEAAVEQLKNEQIRVQAEERRKTLNEETKQHQARAQYQDKLARQRYEDQLRQQQLQNEENLRRQEESVQKQEAMRKATVEHEMELRHKNEMLRIEAEARARAKVERENADIIRENIRLKAAEHRQTVLESIKTAGTVFGEGFRAFISDWDKVTATVAGLSLLAVGIYTAKNATGVAGRYIEARLGKPSLVRDTSRFTVAEAVKHPIS--KRLLSKIQDALEGVILSPKLEERVRDIAIATRNTKANKGLYRNILMYGPPGTGKTLFAKKLAMHSGMDYAIMTGGDVAPMGREGVTAMHKVFDWAGTSKRGLLLFVDEADAFLRKRSTEKISEDLRATLNAFLYRTGEQSNKFMLVLASNQPEQFDWAINDRIDEIVHFDLPGLEERERLVRLYFDKYVLQPASEGKQRLKV----AQFDYGKKCSDLAQLTEGMSGREISKLGVAWQAAAYASEDGILNEAMIDARVADAIRQHQQKMEWLK 567          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Xenopus
Match: nkx3-1 (NK3 homeobox 1 [Source:Xenbase;Acc:XB-GENE-479027])

HSP 1 Score: 526.939 bits (1356), Expect = 0.000e+0
Identity = 272/509 (53.44%), Postives = 364/509 (71.51%), Query Frame = 3
Query:  255 KYAQEAFNLSKENERTKQIEYQKEIKAYELQLEHWKTDQFRVXXXXXXXXXXXXXXXXXMRADYQDHLARQRSNDQLTQQRKFQEEQLRKQEDSVEKQENLKRGTIEYQAELAHQNALKEIQAKMVGKAKAERENHDIRMERMRAEAIEHRETVLTSIKNVGEIVGTGLNDFFHDKTKVATLIVAVTLTAGGI----SGMRTTFRFIESRIGKPSLIRETSRINAIDFLRHPIKTFKSRMDKPTDPLANIVLKPTLEERLRRLAIATRHTKANNGFYRNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTPLGERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRSTLNAFLQRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKN-QRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVDWQASAYSSDDGVLTESMMDKIVEEAIEGYNKKEEWRK 1766
            ++A+EA NL+K  E T Q+E Q +IK YE  +E  K +Q RVQ EE+R+ + EETKQ + RA YQD LARQR  DQL QQ+   EE LR+QE+SV+KQE +++ T+E++ EL H+N +  I+A+   +AK EREN DI  E +R +A EHR+TVL SIK  G + G G   F  D  KV   +  ++L A GI    +      R+IE+R+GKPSL+R+TSR    + ++HPI   K  + K  D L  ++L P LEER+R +AIATR+TKAN G YRN L++GPPGTGKT +AK LAM S MDYAIM+GGDV P+G  GV+ MHK+F+WA TS+RGL+LF+DEADAFL KR+  +ISE+LR+TLNAFL RTGEQS KFM+V A+N PEQFDWA+N RIDE+V F LP L ER RLVR YF ++VL PAS+  QR+++     + ++  KC+ +A +TEG+SGR+ISK+ V WQA+AY+S+DG+L E+M+D  V +AI  + +K EW K
Sbjct:   65 RHAKEALNLAKVQEETLQLEQQSKIKEYEAAVEQLKNEQIRVQAEERRKTLNEETKQHQARAQYQDKLARQRYEDQLRQQQLQNEENLRRQEESVQKQEAMRKATVEHEMELRHKNEMLRIEAEARARAKVERENADIIRENIRLKAAEHRQTVLESIKTAGTVFGEGFRAFISDWDKVTATVAGLSLLAVGIYTAKNATGVAGRYIEARLGKPSLVRDTSRFTVAEAVKHPIS--KRLLSKIQDALEGVILSPKLEERVRDIAIATRNTKANKGLYRNILMYGPPGTGKTLFAKKLAMHSGMDYAIMTGGDVAPMGREGVTAMHKVFDWAGTSKRGLLLFVDEADAFLRKRSTEKISEDLRATLNAFLYRTGEQSNKFMLVLASNQPEQFDWAINDRIDEIVHFDLPGLEERERLVRLYFDKYVLQPASEGKQRLKV----AQFDYGKKCSDLAQLTEGMSGREISKLGVAWQAAAYASEDGILNEAMIDARVADAIRQHQQKMEWLK 567          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Xenopus
Match: nkx3-1 (NK3 homeobox 1 [Source:Xenbase;Acc:XB-GENE-479027])

HSP 1 Score: 510.76 bits (1314), Expect = 1.045e-175
Identity = 263/501 (52.50%), Postives = 352/501 (70.26%), Query Frame = 3
Query:  336 YELQLEHWKTDQFRVXXXXXXXXXXXXXXXXXMRADYQDHLARQRSNDQLTQQRKFQEEQLRKQEDSVEKQENLKRGTIEYQAELAHQNALKEIQAKMVGKAKAERENHDIRMERMRAEAIEHRETVLTSIKNVGEIVGTGLNDFFHDKTKVATLIVAVTLTAGGI----SGMRTTFRFIESRIGKPSLIRETSRINAIDFLRHPIKTFKSRMDKPTDPLANIVLKPTLEERLRRLAIATRHTKANNGFYRNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTPLGERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRSTLNAFLQRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKN-QRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVDWQASAYSSDDGVLTESMMDKIVEEAIEGYNKKEEWRKYLLPTAVKADSQQTILPPL 1823
            YE  +E  K +Q RVQ EE+R+ + EETKQ + RA YQD LARQR  DQL QQ+   EE LR+QE+SV+KQE +++ T+E++ EL H+N +  I+A+   +AK EREN DI  E +R +A EHR+TVL SIK  G + G G   F  D  KV   +  ++L A GI    +      R+IE+R+GKPSL+R+TSR    + ++HP+K  K  + K  D L  ++L P LEER+R +AIATR+TKAN G YRN L++GPPGTGKT +AK LAM S MDYAIM+GGDV P+G  GV+ MHK+F+WA TS+RGL+LF+DEADAFL KR+  +ISE+LR+TLNAFL RTGEQS KFM+V A+N PEQFDWA+N RIDE+V F LP L ER RLVR YF ++VL PAS+  QR+++     + ++  KC+ +A +TEG+SGR+ISK+ V WQA+AY+S+DG+L E+M+D  V +AI  + +K EW K         +S +  L PL
Sbjct:   20 YEAAVEQLKNEQIRVQAEERRKTLNEETKQHQARAQYQDKLARQRYEDQLRQQQLQNEENLRRQEESVQKQEAMRKATVEHEMELRHKNEMLRIEAEARARAKVERENADIIRENIRLKAAEHRQTVLESIKTAGTVFGEGFRAFISDWDKVTATVAGLSLLAVGIYTAKNATGVAGRYIEARLGKPSLVRDTSRFTVAEAVKHPVKISKRLLSKIQDALEGVILSPKLEERVRDIAIATRNTKANKGLYRNILMYGPPGTGKTLFAKKLAMHSGMDYAIMTGGDVAPMGREGVTAMHKVFDWAGTSKRGLLLFVDEADAFLRKRSTEKISEDLRATLNAFLYRTGEQSNKFMLVLASNQPEQFDWAINDRIDEIVHFDLPGLEERERLVRLYFDKYVLQPASEGKQRLKV----AQFDYGKKCSDLAQLTEGMSGREISKLGVAWQAAAYASEDGILNEAMIDARVADAIRQHQQKMEWLKAEGKENAAKESGKNPLQPL 516          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Xenopus
Match: nkx3-1 (NK3 homeobox 1 [Source:Xenbase;Acc:XB-GENE-479027])

HSP 1 Score: 503.056 bits (1294), Expect = 9.745e-172
Identity = 265/528 (50.19%), Postives = 359/528 (67.99%), Query Frame = 3
Query:  255 KYAQEAFNLSKENERTKQIEYQKEIKAYELQLEHWKTDQFRVXXXXXXXXXXXXXXXXXMRADYQDHLARQRSNDQLTQQRKFQEEQLRKQEDSVEKQENLKRGTIEYQAELAHQNALKEIQAKMVGKAKAERENHDIRMERMRAEAIEHRETVLTSIKNVGEIVGTGLNDFFHDKTKVATLIVAVTLTAGGI----SGMRTTFRFIESRIGKPSLIRETSRINAIDFLRHPIKTFKSRMDKPTDPLANIVLKPTLEERLRRLAIATRHTKANNGFYRNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTPLGERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRSTLNAFLQRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKN-QRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVDWQASAYSSDDGVLTESMMDKIVEEAIEGYNKKEEWRKYLLPTAVKADSQQTILPPL 1823
            ++A+EA NL+K  E T Q+E Q +IK YE  +E  K +Q RVQ EE+R+ + EETKQ + RA YQD LARQR  DQL QQ+   EE LR+QE+SV+KQE +++ T+E++ EL H+N +  I+A+   +AK EREN DI  E +R +A EHR+TVL SIK  G + G G   F  D  KV   +  ++L A GI    +      R+IE+R+GKPSL+R+TSR    + ++HP+K  K  + K  D L  ++L P LEER+R +AIATR+TKAN G YRN L++GPPGTGKT +AK LAM S MDYAIM+GGDV P+G  GV+ MHK+F+WA TS+RG  L  +  +         +ISE+LR+TLNAFL RTGEQS KFM+V A+N PEQFDWA+N RIDE+V F LP L ER RLVR YF ++VL PAS+  QR+++     + ++  KC+ +A +TEG+SGR+ISK+ V WQA+AY+S+DG+L E+M+D  V +AI  + +K EW K         +S +  L PL
Sbjct:   65 RHAKEALNLAKVQEETLQLEQQSKIKEYEAAVEQLKNEQIRVQAEERRKTLNEETKQHQARAQYQDKLARQRYEDQLRQQQLQNEENLRRQEESVQKQEAMRKATVEHEMELRHKNEMLRIEAEARARAKVERENADIIRENIRLKAAEHRQTVLESIKTAGTVFGEGFRAFISDWDKVTATVAGLSLLAVGIYTAKNATGVAGRYIEARLGKPSLVRDTSRFTVAEAVKHPVKISKRLLSKIQDALEGVILSPKLEERVRDIAIATRNTKANKGLYRNILMYGPPGTGKTLFAKKLAMHSGMDYAIMTGGDVAPMGREGVTAMHKVFDWAGTSKRGHFLMYNSTE---------KISEDLRATLNAFLYRTGEQSNKFMLVLASNQPEQFDWAINDRIDEIVHFDLPGLEERERLVRLYFDKYVLQPASEGKQRLKV----AQFDYGKKCSDLAQLTEGMSGREISKLGVAWQAAAYASEDGILNEAMIDARVADAIRQHQQKMEWLKAEGKENAAKESGKNPLQPL 579          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Mouse
Match: Atad3a (ATPase family, AAA domain containing 3A [Source:MGI Symbol;Acc:MGI:1919214])

HSP 1 Score: 508.834 bits (1309), Expect = 4.232e-174
Identity = 272/530 (51.32%), Postives = 380/530 (71.70%), Query Frame = 3
Query:  255 KYAQEAFNLSKENERTKQIEYQKEIKAYELQLEHWKTDQFRVXXXXXXXXXXXXXXXXXMRADYQDHLARQRSNDQLTQQRKFQEEQLRKQEDSVEKQENLKRGTIEYQAELAHQNALKEIQAKMVGKAKAERENHDIRMERMRAEAIEHRETVLTSIKNVGEIVGTGLNDFFHDKTKVATLIVAVTLTAGGI----SGMRTTFRFIESRIGKPSLIRETSRINAIDFLRHPIKTFKSRMDKPTDPLANIVLKPTLEERLRRLAIATRHTKANNGFYRNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTPLGERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRSTLNAFLQRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKN-QRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVDWQASAYSSDDGVLTESMMDKIVEEAIEGYNKKEEWRKYLLPTAVKADSQQTILPPLDS 1829
            ++A+EA +L++  E+T Q+E Q ++K YE  +E  K++Q RVQ EE+R+ + EET+Q + RA YQD LARQR  DQL QQ+   EE LRKQE+SV+KQE ++R T+E + EL H+N +  ++A+   +AKA+REN DI  E++R +A EHR+T+L SI+  G ++G G   F  D  KV   +  +TL A G+    +      R+IE+R+GKPSL+RETSRI+ ++ LRHPI+  +  + +P D L  ++L P+LE R+R +AIATR+TK N   YRN L++GPPGTGKT +AK LA+ S MDYAIM+GGDV P+G  GV+ MHK+F+WA TSRRGL+LF+DEADAFL KR   +ISE+LR+TLNAFL RTG+ S KFM+V A+N PEQFDWA+N RIDE+V F LP   ER RLVR YF ++VL PA++  QR+++     + ++  KC+++A +TEG+SGR+I+++AV WQA AYSS+DGVLTE+MMD  V++A++ + +K +W K   P     DS QT  PP  S
Sbjct:   68 RHAKEALSLAQMQEQTLQLEQQSKLKEYEAAVEQLKSEQIRVQAEERRKTLTEETRQHQARAQYQDKLARQRYEDQLKQQQLLNEENLRKQEESVQKQEAIRRATVEREMELRHKNEMLRVEAEARARAKADRENADIIREQIRLKAAEHRQTILESIRTAGTLLGEGFRAFVTDWDKVTATVAGLTLLAVGVYSAKNATSVAGRYIEARLGKPSLVRETSRISVLEALRHPIQVSRRLVSRPQDALEGVILSPSLEARVRDIAIATRNTKKNKSLYRNVLMYGPPGTGKTLFAKKLALHSGMDYAIMTGGDVAPMGREGVTAMHKVFDWASTSRRGLLLFVDEADAFLRKRATEKISEDLRATLNAFLHRTGQHSSKFMLVLASNQPEQFDWAINDRIDEMVCFALPQREERERLVRMYFDKYVLKPATEGKQRLKV----AQFDYGKKCSEVAQLTEGMSGREIAQLAVAWQAMAYSSEDGVLTEAMMDARVQDAVQQHQQKMQWLKVERP-----DS-QTNKPPHPS 587          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Mouse
Match: Atad3a (ATPase family, AAA domain containing 3A [Source:MGI Symbol;Acc:MGI:1919214])

HSP 1 Score: 164.466 bits (415), Expect = 2.153e-46
Identity = 89/194 (45.88%), Postives = 128/194 (65.98%), Query Frame = 3
Query:  435 RADYQDHLARQRSNDQLTQQRKFQEEQLRKQEDSVEKQENLKRGTIEYQAELAHQNALKEIQAKMVGKAKAERENHDIRMERMRAEAIEHRETVLTSIKNVGEIVGTGLNDFFHDKTKVATLIVAVTLTAGGI----SGMRTTFRFIESRIGKPSLIRETSRINAIDFLRHPIKTFKSRMDKPTDPLANIVLKP 1004
            RA YQD LARQR  DQL QQ+   EE LRKQE+SV+KQE ++R T+E + EL H+N +  ++A+   +AKA+REN DI  E++R +A EHR+T+L SI+  G ++G G   F  D  KV   +  +TL A G+    +      R+IE+R+GKPSL+RETSRI+ ++ LRHPI+  +  + +P D L  ++L P
Sbjct:    4 RAQYQDKLARQRYEDQLKQQQLLNEENLRKQEESVQKQEAIRRATVEREMELRHKNEMLRVEAEARARAKADRENADIIREQIRLKAAEHRQTILESIRTAGTLLGEGFRAFVTDWDKVTATVAGLTLLAVGVYSAKNATSVAGRYIEARLGKPSLVRETSRISVLEALRHPIQVSRRLVSRPQDALEGVILSP 197          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Mouse
Match: Vps4a (vacuolar protein sorting 4A [Source:MGI Symbol;Acc:MGI:1890520])

HSP 1 Score: 77.411 bits (189), Expect = 1.642e-14
Identity = 67/204 (32.84%), Postives = 100/204 (49.02%), Query Frame = 3
Query: 1071 YRNALLFGPPGTGKTFYAKSLAM-ASNMDYAIMSGGDVTP--LGERGVSE--MHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRSTLNAFL---QRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKNQRIRLEGGDKKINW-ESKCNQIAMITEGLSGRDISKIAVD 1655
            +R  LLFGPPGTGK++ AK++A  A+N  +  +S  D+    LGE   SE  +  +F  A+  +  + +FIDE D+    RN+ + SE  R     FL   Q  G  +   +V+ ATN P   D A+  R ++ +  PLP+                   A++ Q  RL  G    N  ++  +++A  TEG SG DIS I  D
Sbjct:  160 WRGILLFGPPGTGKSYLAKAVATEANNSTFFSVSSSDLMSKWLGE---SEKLVKNLFELARQHKPSI-IFIDEVDSLCGSRNENE-SEAARRIKTEFLVQMQGVGNNNDGTLVLGATNIPWVLDSAIRRRFEKRIYIPLPE------------------EAARAQMFRLHLGSTPHNLTDANIHELARKTEGYSGADISIIVRD 340          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Mouse
Match: Vps4b (vacuolar protein sorting 4B [Source:MGI Symbol;Acc:MGI:1100499])

HSP 1 Score: 72.7886 bits (177), Expect = 4.846e-13
Identity = 58/202 (28.71%), Postives = 97/202 (48.02%), Query Frame = 3
Query: 1071 YRNALLFGPPGTGKTFYAKSLAM-ASNMDYAIMSGGDVTP--LGERGVSE--MHKIFNWAQTSRRGLMLFIDEADAFLYKR--NQVQISENLRSTLNAFLQRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKNQRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVD 1655
            +R  LLFGPPGTGK++ AK++A  A+N  +  +S  D+    LGE   SE  +  +F  A+ ++  + +FIDE D+    R  N+ + +  +++     +Q  G  +   +V+ ATN P   D A+  R ++ +  PLP+   R  + R +                  G  +    E+   ++   T+G SG DIS I  D
Sbjct:  167 WRGILLFGPPGTGKSYLAKAVATEANNSTFFSISSSDLVSKWLGE---SEKLVKNLFQLARENKPSI-IFIDEIDSLCGSRSENESEAARRIKTEFLVQMQGVGVDNDGILVLGATNIPWVLDSAIRRRFEKRIYIPLPEAHARAAMFRLHL-----------------GSTQNSLTEADFQELGRKTDGYSGADISIIVRD 347          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Mouse
Match: Vps4b (vacuolar protein sorting 4B [Source:MGI Symbol;Acc:MGI:1100499])

HSP 1 Score: 72.7886 bits (177), Expect = 4.846e-13
Identity = 58/202 (28.71%), Postives = 97/202 (48.02%), Query Frame = 3
Query: 1071 YRNALLFGPPGTGKTFYAKSLAM-ASNMDYAIMSGGDVTP--LGERGVSE--MHKIFNWAQTSRRGLMLFIDEADAFLYKR--NQVQISENLRSTLNAFLQRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKNQRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVD 1655
            +R  LLFGPPGTGK++ AK++A  A+N  +  +S  D+    LGE   SE  +  +F  A+ ++  + +FIDE D+    R  N+ + +  +++     +Q  G  +   +V+ ATN P   D A+  R ++ +  PLP+   R  + R +                  G  +    E+   ++   T+G SG DIS I  D
Sbjct:  167 WRGILLFGPPGTGKSYLAKAVATEANNSTFFSISSSDLVSKWLGE---SEKLVKNLFQLARENKPSI-IFIDEIDSLCGSRSENESEAARRIKTEFLVQMQGVGVDNDGILVLGATNIPWVLDSAIRRRFEKRIYIPLPEAHARAAMFRLHL-----------------GSTQNSLTEADFQELGRKTDGYSGADISIIVRD 347          
BLAST of ATPase family AAA domain containing protein vs. UniProt/SwissProt
Match: sp|Q6PAX2|ATD3B_XENLA (ATPase family AAA domain-containing protein 3-B OS=Xenopus laevis OX=8355 GN=atad3-b PE=2 SV=1)

HSP 1 Score: 541.576 bits (1394), Expect = 0.000e+0
Identity = 280/531 (52.73%), Postives = 378/531 (71.19%), Query Frame = 3
Query:  255 KYAQEAFNLSKENERTKQIEYQKEIKAYELQLEHWKTDQFRVXXXXXXXXXXXXXXXXXMRADYQDHLARQRSNDQLTQQRKFQEEQLRKQEDSVEKQENLKRGTIEYQAELAHQNALKEIQAKMVGKAKAERENHDIRMERMRAEAIEHRETVLTSIKNVGEIVGTGLNDFFHDKTKVATLIVAVTLTAGGI----SGMRTTFRFIESRIGKPSLIRETSRINAIDFLRHPIKTFKSRMDKPTDPLANIVLKPTLEERLRRLAIATRHTKANNGFYRNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTPLGERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRSTLNAFLQRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKN-QRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVDWQASAYSSDDGVLTESMMDKIVEEAIEGYNKKEEWRKYLLPTAVKADSQQTILPPLDSN 1832
            ++A+EA NL+K  E T Q+E Q +IK YE  +E  K +Q RVQ EEKR+ + EETKQ + RA YQD LARQR  DQL QQ+   EE LR+QE+SV+KQE +++ T+E++ EL H+N +  I+A+   +AK EREN DI  E++R +A EHR+TVL SIK  G + G G   F  D  KV   +  +TL A G+    +G     R+IE+R+GKPSL+R+TSRI  ++ ++HPIK  K    K  D L  ++L P LEER+R +AIATR+TKAN G YRN L++GPPGTGKT +AK LAM S+MDYAIM+GGDV P+G  GV+ MHK+F+WA TS+RGL+LF+DEADAFL KR+  +ISE+LR+TLNAFL RTGEQS KFM+V A+N PEQFDWA+N RIDE+V F LP L ER RLVR YF ++VL PAS+  QR+++     + ++  KC+++A +TEG+SGR+ISK+ V WQA+AY+S+DG+LTE+M+D  V +AI  + +K EW K     + K   +  + P L+  
Sbjct:   65 RHAKEALNLAKVQEETLQMEQQAKIKEYEAAVEQIKNEQIRVQSEEKRKTLNEETKQHQARAQYQDKLARQRYEDQLRQQQLQNEENLRRQEESVQKQEAMRKATVEHEMELRHKNDMLRIEAEAHARAKVERENADIIREQIRLKAAEHRQTVLESIKTAGTVFGEGFRTFISDWDKVTATVAGLTLLAVGVYTAKNGTGVAGRYIEARLGKPSLVRDTSRITVVEAIKHPIKISKRIFSKIQDALEGVILSPRLEERVRDIAIATRNTKANKGLYRNILMYGPPGTGKTLFAKKLAMHSSMDYAIMTGGDVAPMGREGVTAMHKVFDWAGTSKRGLLLFVDEADAFLRKRSTEKISEDLRATLNAFLYRTGEQSNKFMLVLASNQPEQFDWAINDRIDEIVHFDLPGLEERERLVRLYFDKYVLQPASEGKQRLKV----AQFDYGKKCSELATLTEGMSGREISKLGVAWQAAAYASEDGILTEAMIDARVADAIRQHQQKMEWLKAEGKESTKEIGKNPLQPLLEGT 591          
BLAST of ATPase family AAA domain containing protein vs. UniProt/SwissProt
Match: sp|Q58E76|ATD3A_XENLA (ATPase family AAA domain-containing protein 3-A OS=Xenopus laevis OX=8355 GN=atad3-a PE=2 SV=1)

HSP 1 Score: 537.339 bits (1383), Expect = 0.000e+0
Identity = 278/533 (52.16%), Postives = 375/533 (70.36%), Query Frame = 3
Query:  255 KYAQEAFNLSKENERTKQIEYQKEIKAYELQLEHWKTDQFRVXXXXXXXXXXXXXXXXXMRADYQDHLARQRSNDQLTQQRKFQEEQLRKQEDSVEKQENLKRGTIEYQAELAHQNALKEIQAKMVGKAKAERENHDIRMERMRAEAIEHRETVLTSIKNVGEIVGTGLNDFFHDKTKVATLIVAVTLTAGGI----SGMRTTFRFIESRIGKPSLIRETSRINAIDFLRHPIKTFKSRMDKPTDPLANIVLKPTLEERLRRLAIATRHTKANNGFYRNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTPLGERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRSTLNAFLQRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKN-QRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVDWQASAYSSDDGVLTESMMDKIVEEAIEGYNKKEEWRKYLLPTAVKADSQQTILPPLDSNRL 1838
            ++A+EA NL+K  E T Q+E Q +IK YE  +E  K +Q RVQ EE+R+ + EETKQ + RA YQD LARQR  DQL QQ+   EE LR+QEDSV+KQE ++R T+E++ EL H+N +  I+A+   +AK EREN DI  E++R +A EHR+TVL SIK  G + G G   F  D  KV   +  +TL A G+    +      R+IE+R+GKPSL+R+TSRI   + ++HPIK  K    K  D L  ++L P LEER+R +AIATR+TKAN G YRN L++GPPGTGKT +AK LAM S MDYAIM+GGDV P+G  GV+ MHK+F+WA TS+RGL+LF+DEADAFL KR+  +ISE+LR+TLNAFL RTGEQS KFM+V A+N PEQFDWA+N RIDE+V F LP L ER RLVR YF ++VL PAS+  QR+++     + ++  KC++++ +TEG+SGR+ISK+ V WQA+AY+S+DG+LTE+M+D  V +AI  + +K  W K       K   +  + P L+  ++
Sbjct:   65 RHAKEAINLAKVQEETLQMEQQAKIKEYEAAVEQLKNEQIRVQAEERRKTLNEETKQHQARAQYQDKLARQRYEDQLRQQQLQNEENLRRQEDSVQKQEAMRRATVEHEMELRHKNEMLRIEAEARAQAKVERENADIIREQIRLKAAEHRQTVLESIKTAGTVFGEGFRTFISDWDKVTATVAGLTLLAVGVYTAKNATGVAGRYIEARLGKPSLVRDTSRITVAEAVKHPIKITKRLYSKIQDALEGVILSPRLEERVRDIAIATRNTKANKGLYRNILMYGPPGTGKTLFAKKLAMHSGMDYAIMTGGDVAPMGREGVTAMHKVFDWAGTSKRGLLLFVDEADAFLRKRSTEKISEDLRATLNAFLYRTGEQSNKFMLVLASNQPEQFDWAINDRIDEIVHFDLPGLEERERLVRLYFDKYVLQPASEGKQRLKV----AQFDYGKKCSELSKLTEGMSGREISKLGVAWQAAAYASEDGILTEAMIDARVADAIRQHQQKMAWLKAEGKEGAKEIGKNPLQPLLEGTQV 593          
BLAST of ATPase family AAA domain containing protein vs. UniProt/SwissProt
Match: sp|Q6NVR9|ATAD3_XENTR (ATPase family AAA domain-containing protein 3 OS=Xenopus tropicalis OX=8364 GN=atad3 PE=2 SV=1)

HSP 1 Score: 534.643 bits (1376), Expect = 0.000e+0
Identity = 276/528 (52.27%), Postives = 371/528 (70.27%), Query Frame = 3
Query:  255 KYAQEAFNLSKENERTKQIEYQKEIKAYELQLEHWKTDQFRVXXXXXXXXXXXXXXXXXMRADYQDHLARQRSNDQLTQQRKFQEEQLRKQEDSVEKQENLKRGTIEYQAELAHQNALKEIQAKMVGKAKAERENHDIRMERMRAEAIEHRETVLTSIKNVGEIVGTGLNDFFHDKTKVATLIVAVTLTAGGI----SGMRTTFRFIESRIGKPSLIRETSRINAIDFLRHPIKTFKSRMDKPTDPLANIVLKPTLEERLRRLAIATRHTKANNGFYRNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTPLGERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRSTLNAFLQRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKN-QRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVDWQASAYSSDDGVLTESMMDKIVEEAIEGYNKKEEWRKYLLPTAVKADSQQTILPPL 1823
            ++A+EA NL+K  E T Q+E Q +IK YE  +E  K +Q RVQ EE+R+ + EETKQ + RA YQD LARQR  DQL QQ+   EE LR+QE+SV+KQE +++ T+E++ EL H+N +  I+A+   +AK EREN DI  E +R +A EHR+TVL SIK  G + G G   F  D  KV   +  ++L A GI    +      R+IE+R+GKPSL+R+TSR    + ++HP+K  K  + K  D L  ++L P LEER+R +AIATR+TKAN G YRN L++GPPGTGKT +AK LAM S MDYAIM+GGDV P+G  GV+ MHK+F+WA TS+RGL+LF+DEADAFL KR+  +ISE+LR+TLNAFL RTGEQS KFM+V A+N PEQFDWA+N RIDE+V F LP L ER RLVR YF ++VL PAS+  QR+++     + ++  KC+ +A +TEG+SGR+ISK+ V WQA+AY+S+DG+L E+M+D  V +AI  + +K EW K         +S +  L PL
Sbjct:   65 RHAKEALNLAKVQEETLQLEQQSKIKEYEAAVEQLKNEQIRVQAEERRKTLNEETKQHQARAQYQDKLARQRYEDQLRQQQLQNEENLRRQEESVQKQEAMRKATVEHEMELRHKNEMLRIEAEARARAKVERENADIIRENIRLKAAEHRQTVLESIKTAGTVFGEGFRAFISDWDKVTATVAGLSLLAVGIYTAKNATGVAGRYIEARLGKPSLVRDTSRFTVAEAVKHPVKISKRLLSKIQDALEGVILSPKLEERVRDIAIATRNTKANKGLYRNILMYGPPGTGKTLFAKKLAMHSGMDYAIMTGGDVAPMGREGVTAMHKVFDWAGTSKRGLLLFVDEADAFLRKRSTEKISEDLRATLNAFLYRTGEQSNKFMLVLASNQPEQFDWAINDRIDEIVHFDLPGLEERERLVRLYFDKYVLQPASEGKQRLKV----AQFDYGKKCSDLAQLTEGMSGREISKLGVAWQAAAYASEDGILNEAMIDARVADAIRQHQQKMEWLKAEGKENAAKESGKNPLQPL 588          
BLAST of ATPase family AAA domain containing protein vs. UniProt/SwissProt
Match: sp|A7YWC4|ATAD3_BOVIN (ATPase family AAA domain-containing protein 3 OS=Bos taurus OX=9913 GN=ATAD3 PE=2 SV=1)

HSP 1 Score: 526.168 bits (1354), Expect = 4.710e-180
Identity = 273/509 (53.63%), Postives = 370/509 (72.69%), Query Frame = 3
Query:  255 KYAQEAFNLSKENERTKQIEYQKEIKAYELQLEHWKTDQFRVXXXXXXXXXXXXXXXXXMRADYQDHLARQRSNDQLTQQRKFQEEQLRKQEDSVEKQENLKRGTIEYQAELAHQNALKEIQAKMVGKAKAERENHDIRMERMRAEAIEHRETVLTSIKNVGEIVGTGLNDFFHDKTKVATLIVAVTLTAGGI----SGMRTTFRFIESRIGKPSLIRETSRINAIDFLRHPIKTFKSRMDKPTDPLANIVLKPTLEERLRRLAIATRHTKANNGFYRNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTPLGERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRSTLNAFLQRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKN-QRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVDWQASAYSSDDGVLTESMMDKIVEEAIEGYNKKEEWRK 1766
            ++A+EA +L++  E+T Q+E+Q ++K YE  +E  K DQ RVQ EE+R+ + EET+Q + RA YQD LARQR  DQL QQ+   EE LRKQE+SV+KQE L+R T+E + EL H+N +  ++A+   +AKAEREN DI  E++R +A EHR+T+L SI+  G + G G   F  D  KV   +  +TL A GI    +      R+IE+R+GKPSL+RETSRI  ++ LRHPI+  +  + KP D L  +VL P+LE R+R +AIATR+TK N   YRN L++GPPGTGKT +AK LA+ S MDYAIM+GGDV P+G  GV+ MHK+F+WA TSRRGL+LF+DEADAFL KR   +ISE+LR+TLNAFL RTG+ S KFM+V A+N PEQFDWA+N RIDE+V F LP   ER RLVR YF ++VL PA++  QR++L     + ++  KC++IA +TEG+SGR+IS++AV WQA AY+S+DGVLTE+MMD  V++AI+ + +K +W K
Sbjct:   68 RHAKEALSLAQMQEQTLQLEHQAKLKEYEAAVEQLKGDQIRVQAEERRKTLSEETRQHQARAQYQDKLARQRYEDQLKQQQLLNEENLRKQEESVQKQEALRRATVEREMELRHKNEMLRVEAEARARAKAERENADIIREQIRLKAAEHRQTILESIRTAGTLFGEGFRAFVTDWDKVTATVAGLTLLAVGIYSAKNATSVAGRYIEARLGKPSLVRETSRITVLEALRHPIQVSRRLLSKPQDALEGVVLSPSLEARVRDIAIATRNTKKNKSLYRNVLMYGPPGTGKTLFAKKLALHSGMDYAIMTGGDVAPMGRDGVTAMHKVFDWASTSRRGLLLFVDEADAFLRKRATEKISEDLRATLNAFLHRTGQHSSKFMLVLASNQPEQFDWAINDRIDEMVSFELPQREERERLVRMYFDKYVLKPATEGKQRLKL----AQFDYGKKCSEIAQLTEGMSGREISQLAVAWQAMAYASEDGVLTEAMMDARVQDAIQQHRQKMQWLK 572          
BLAST of ATPase family AAA domain containing protein vs. UniProt/SwissProt
Match: sp|Q925I1|ATAD3_MOUSE (ATPase family AAA domain-containing protein 3 OS=Mus musculus OX=10090 GN=Atad3 PE=1 SV=1)

HSP 1 Score: 508.834 bits (1309), Expect = 2.961e-173
Identity = 272/530 (51.32%), Postives = 380/530 (71.70%), Query Frame = 3
Query:  255 KYAQEAFNLSKENERTKQIEYQKEIKAYELQLEHWKTDQFRVXXXXXXXXXXXXXXXXXMRADYQDHLARQRSNDQLTQQRKFQEEQLRKQEDSVEKQENLKRGTIEYQAELAHQNALKEIQAKMVGKAKAERENHDIRMERMRAEAIEHRETVLTSIKNVGEIVGTGLNDFFHDKTKVATLIVAVTLTAGGI----SGMRTTFRFIESRIGKPSLIRETSRINAIDFLRHPIKTFKSRMDKPTDPLANIVLKPTLEERLRRLAIATRHTKANNGFYRNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTPLGERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRSTLNAFLQRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKN-QRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVDWQASAYSSDDGVLTESMMDKIVEEAIEGYNKKEEWRKYLLPTAVKADSQQTILPPLDS 1829
            ++A+EA +L++  E+T Q+E Q ++K YE  +E  K++Q RVQ EE+R+ + EET+Q + RA YQD LARQR  DQL QQ+   EE LRKQE+SV+KQE ++R T+E + EL H+N +  ++A+   +AKA+REN DI  E++R +A EHR+T+L SI+  G ++G G   F  D  KV   +  +TL A G+    +      R+IE+R+GKPSL+RETSRI+ ++ LRHPI+  +  + +P D L  ++L P+LE R+R +AIATR+TK N   YRN L++GPPGTGKT +AK LA+ S MDYAIM+GGDV P+G  GV+ MHK+F+WA TSRRGL+LF+DEADAFL KR   +ISE+LR+TLNAFL RTG+ S KFM+V A+N PEQFDWA+N RIDE+V F LP   ER RLVR YF ++VL PA++  QR+++     + ++  KC+++A +TEG+SGR+I+++AV WQA AYSS+DGVLTE+MMD  V++A++ + +K +W K   P     DS QT  PP  S
Sbjct:   68 RHAKEALSLAQMQEQTLQLEQQSKLKEYEAAVEQLKSEQIRVQAEERRKTLTEETRQHQARAQYQDKLARQRYEDQLKQQQLLNEENLRKQEESVQKQEAIRRATVEREMELRHKNEMLRVEAEARARAKADRENADIIREQIRLKAAEHRQTILESIRTAGTLLGEGFRAFVTDWDKVTATVAGLTLLAVGVYSAKNATSVAGRYIEARLGKPSLVRETSRISVLEALRHPIQVSRRLVSRPQDALEGVILSPSLEARVRDIAIATRNTKKNKSLYRNVLMYGPPGTGKTLFAKKLALHSGMDYAIMTGGDVAPMGREGVTAMHKVFDWASTSRRGLLLFVDEADAFLRKRATEKISEDLRATLNAFLHRTGQHSSKFMLVLASNQPEQFDWAINDRIDEMVCFALPQREERERLVRMYFDKYVLKPATEGKQRLKV----AQFDYGKKCSEVAQLTEGMSGREIAQLAVAWQAMAYSSEDGVLTEAMMDARVQDAVQQHQQKMQWLKVERP-----DS-QTNKPPHPS 587          
BLAST of ATPase family AAA domain containing protein vs. TrEMBL
Match: A0A564Z0Y6 (AAA domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS11076 PE=4 SV=1)

HSP 1 Score: 625.55 bits (1612), Expect = 0.000e+0
Identity = 342/596 (57.38%), Postives = 440/596 (73.83%), Query Frame = 3
Query:   72 MSWIFGSGKSXXXXXXXX----XXXXXXXSKDKEKESTKVKAGAYSFXXXXXXXXXXXXXXXXXXKYAQEAFNLSKENERTKQIEYQKEIKAYELQLEHWKTDQFRVXXXXXXXXXXXXXXXXXMRADYQDHLARQRSNDQLTQQRKFQEEQLRKQEDSVEKQENLKRGTIEYQAELAHQNALKEIQAKMVGKAKAERENHDIRMERMRAEAIEHRETVLTSIKNVGEIVGTGLNDFFHDKTKVATLIVAVTLTAGGIS----GMRTTFRFIESRIGKPSLIRETSRINAIDFLRHPIKTFKSRMDKPTDPLANIVLKPTLEERLRRLAIATRHTKANNGFYRNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTPLGERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRSTLNAFLQRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPA-SKNQRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVDWQASAYSSDDGVLTESMMDKIVEEAIEGYNKKEEWRKYLLPTAVKADSQQTILPPLDSN 1832
            MSW+FG  +S      G     P PP  PSKD +K+  +  +G + FDSAALERAAKAA++LE SKYA+EAF LS+ NE T+Q+EYQ +IK YE  LE  K  Q R+Q+EE+R+ +EEE++ QK R +YQD LAR+R  DQL QQ +  EE LRKQE+SV+KQE L+R TIEY+A L HQN LK+I+A++ G+A+ EREN +IR+ER R EA EHRETVL SI+  G ++G G + F  DK KV T + A T+ AGGI     GM T  RFIESRIGKP L+RETSR+N +D L HPI+T K  +++P DPL NI+L+PTLE  LR++AIATRHTKAN GFYRN L+ GPPGTGKT +AKSLA  S +DYAIM+GGD+ PLG  GV+ +HK+FNWA+TSRRG++LF+DEADAFL KR Q +ISE +R+TLNAFL RTGEQS++FM+V A+N PEQFDWA+N R+DE+V F +P L ER R++R YF  ++L P+  K QRIRL  G   I++ +KC ++A  TEGLSGR++SK+A+ WQ  A+SS++G LTE MMD +V+ A+E   KK+EWR+Y LP A         LP L SN
Sbjct:    1 MSWLFGYSRSQNSGAGGEGGIPPPPPPPPSKDDKKKMEEAISG-FKFDSAALERAAKAARELEKSKYAKEAFELSRMNEHTQQLEYQAKIKEYEAGLEQLKGQQIRIQQEERRKTLEEESRIQKHRVEYQDMLARKRQEDQLAQQARMHEETLRKQEESVQKQEALRRQTIEYEANLRHQNELKQIEARLRGEAQVERENREIRLERSRVEAREHRETVLQSIQTAGSVIGAGFDAFLVDKNKVFTAVGAATVLAGGIYAAKFGMGTMARFIESRIGKPKLVRETSRLNTVDLLIHPIETVKKVLNRPGDPLKNIILEPTLEAHLRKIAIATRHTKANKGFYRNVLMAGPPGTGKTMFAKSLATHSGLDYAIMTGGDIAPLGGDGVTAVHKVFNWAKTSRRGVLLFVDEADAFLRKREQERISEGMRATLNAFLYRTGEQSQRFMLVLASNQPEQFDWAINDRMDEIVYFDVPKLRERERMIRHYFDMYILQPSLDKKQRIRLADG---IDYAAKCKEVAARTEGLSGRELSKVAIAWQTMAFSSENGTLTEEMMDNVVKNAVEANKKKQEWRQYRLPDA------HVDLPQLSSN 586          
BLAST of ATPase family AAA domain containing protein vs. TrEMBL
Match: A0A4Z2D076 (ATPase family AAA domain-containing protein isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_005938 PE=4 SV=1)

HSP 1 Score: 616.305 bits (1588), Expect = 0.000e+0
Identity = 333/583 (57.12%), Postives = 440/583 (75.47%), Query Frame = 3
Query:   72 MSWIFGSGKSXXXXXXXXXXXXXXXSKD----KEKESTKVKAGAYSFXXXXXXXXXXXXXXXXXXKYAQEAFNLSKENERTKQIEYQKEIKAYELQLEHWKTDQFRVXXXXXXXXXXXXXXXXXMRADYQDHLARQRSNDQLTQQRKFQEEQLRKQEDSVEKQENLKRGTIEYQAELAHQNALKEIQAKMVGKAKAERENHDIRMERMRAEAIEHRETVLTSIKNVGEIVGTGLNDFFHDKTKVATLIVAVTLTAGGISGMR----TTFRFIESRIGKPSLIRETSRINAIDFLRHPIKTFKSRMDKPTDPLANIVLKPTLEERLRRLAIATRHTKANNGFYRNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTPLGERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRSTLNAFLQRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPA-SKNQRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVDWQASAYSSDDGVLTESMMDKIVEEAIEGYNKKEEWRKYLLPTAVKA 1793
            MSW+FG GK T +        P  P       ++K+ +K  + AY FDSAALERAAKAA++LE+SK+A+EAF+LS+++E+T Q+EYQ ++K YEL LE  K  Q+R Q+EE+R+ +EEE K QK RADYQD LAR+R  DQ+  Q K Q E LRKQE+SV++QE+++R TIE++++L H+N +K+I+AK+ G+A+ EREN +IR+ER R EA E+R+TVL SI   G ++G G++ F  +  KVAT++ ++TL AGGI G +    T  R +ESRIGKP+L+RETSR+N +D  RHPI T K    +P+DPL  I+L+P LE  LR++AIATRHTKANNGFYRN L+ GPPGTGKT +AKSLAM S MDYAI++GGD+ P+G  GV+ +HK+F WA+TSR+G++LF+DEADAFL KR+Q +ISE +R+TLNAFL RTGEQSKKFM+V A+N PEQFDWA+N R+DE+V F LP L ER RLVR YF  F+L P+ +K+ RIRL    + IN+  KC +IA  T GLSGR+ISKIAV WQ +AYSS+DGVLTESMMD +V+ AI    +K+EWR Y LP  V+A
Sbjct:    1 MSWLFGFGKQTSKDFDIPNDTPPPPPMPPVGLQDKKHSKDTSSAYRFDSAALERAAKAARELESSKHAKEAFDLSQKHEQTLQMEYQSKMKEYELGLEQIKIQQYRAQQEERRKTLEEEAKIQKQRADYQDMLARKRQEDQIALQAKAQAENLRKQEESVQRQESMRRATIEFESDLRHKNEMKQIEAKIRGEAQVERENREIRLERARVEAREYRQTVLESITTAGSVIGNGVSSFLSEPDKVATVVGSLTLLAGGIYGAKYGIGTFTRIVESRIGKPALVRETSRLNIVDTCRHPIMTTKRIFQRPSDPLDGIILRPELEASLRKIAIATRHTKANNGFYRNILMAGPPGTGKTMFAKSLAMHSGMDYAILTGGDIAPMGNEGVTAVHKVFEWAKTSRKGVLLFVDEADAFLRKRDQERISEGIRATLNAFLYRTGEQSKKFMLVLASNQPEQFDWAINDRMDEIVHFTLPGLEERERLVRHYFDFFLLQPSLTKSHRIRLA---ENINYAVKCAEIAKRTTGLSGREISKIAVGWQTAAYSSEDGVLTESMMDAVVDSAIAANRQKQEWRHYKLPDTVEA 580          
BLAST of ATPase family AAA domain containing protein vs. TrEMBL
Match: A0A430Q719 (ATPase family AAA domain-containing protein 3A/B OS=Schistosoma bovis OX=6184 GN=DC041_0003330 PE=4 SV=1)

HSP 1 Score: 613.609 bits (1581), Expect = 0.000e+0
Identity = 331/582 (56.87%), Postives = 446/582 (76.63%), Query Frame = 3
Query:   72 MSWIFGSGKSXXXX---XXXXXXXXXXXSKDKEKESTKVKAGAYSFXXXXXXXXXXXXXXXXXXKYAQEAFNLSKENERTKQIEYQKEIKAYELQLEHWKTDQFRVXXXXXXXXXXXXXXXXXMRADYQDHLARQRSNDQLTQQRKFQEEQLRKQEDSVEKQENLKRGTIEYQAELAHQNALKEIQAKMVGKAKAERENHDIRMERMRAEAIEHRETVLTSIKNVGEIVGTGLNDFFHDKTKVATLIVAVTLTAGGISGMR----TTFRFIESRIGKPSLIRETSRINAIDFLRHPIKTFKSRMDKPTDPLANIVLKPTLEERLRRLAIATRHTKANNGFYRNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTPLGERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRSTLNAFLQRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPA-SKNQRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVDWQASAYSSDDGVLTESMMDKIVEEAIEGYNKKEEWRKYLLPTAVKA 1793
            MSW+FG GK T +    P   P PP+ P+  ++K+ +K  A AY FDSAALERAAKAA++LE+SK+A+EAF+LS+++E+T Q+EYQ ++K YEL LE  K  Q+R Q+EE+R+ +EEE + QK RADYQD LAR+R  DQ+  Q K Q + L+KQE+SV+KQE ++R TIE++++L H+N +K+I+AK+ G+A+ ER+N D+R+ER R +A E+R+TVL SI   G ++G G+++F  +  K+AT+I ++TL AGG+ G +    T  + +ESRIGKP+L+RETSR+N +D  RHPIKT K+   +PTDPL  I+L+P LE  LR++AIATRHTKAN GFYRN L+ GPPGTGKT +AKSLAM S MDYAI++GGD+ P+G  GV+ +HK+F WA+TSR+G++LF+DEADAFL KR+Q +ISE +R+TLNAFL RTGEQSKKFM+V A+N PEQFDWA+N R+DE+V+F LP L ER RLVR YF  F+L P+ +K+ RIRL    + I++  KC +IA  T GLSGR+ISKIAV WQ +AYSS+DGVLTE MMD +V+ AI    +K+EWR Y LP AV A
Sbjct:    1 MSWLFGFGKQTSKDFDIPGDVPPPPSPPASLQDKKQSKDTASAYRFDSAALERAAKAARELESSKHAKEAFDLSQKHEQTLQMEYQSKMKEYELGLEQIKIQQYRAQQEERRKTLEEEARIQKQRADYQDMLARKRQEDQIALQAKAQADNLKKQEESVQKQEAMRRATIEFESDLRHKNEMKQIEAKIRGEAEVERQNRDLRLERARVDAREYRQTVLESITTAGSVIGNGISNFLSEPDKMATVIGSLTLLAGGVYGAKYGIGTFTKVVESRIGKPALVRETSRLNIVDTCRHPIKTAKTVFQRPTDPLEGIILRPELEASLRKIAIATRHTKANRGFYRNILMAGPPGTGKTMFAKSLAMHSGMDYAILTGGDIAPMGSEGVTAVHKVFEWAKTSRKGVLLFVDEADAFLRKRDQERISEGVRATLNAFLYRTGEQSKKFMLVLASNQPEQFDWAINDRMDEIVQFTLPGLEERERLVRHYFDRFLLQPSLTKSHRIRLA---ENIDYAVKCAEIAKRTTGLSGREISKIAVGWQTAAYSSEDGVLTEGMMDAVVDSAIAANRQKQEWRHYRLPDAVDA 579          
BLAST of ATPase family AAA domain containing protein vs. TrEMBL
Match: A0A068WJD8 (ATPase family AAA domain containing protein OS=Echinococcus granulosus OX=6210 GN=EgrG_000242000 PE=4 SV=1)

HSP 1 Score: 612.453 bits (1578), Expect = 0.000e+0
Identity = 296/513 (57.70%), Postives = 392/513 (76.41%), Query Frame = 3
Query:  255 KYAQEAFNLSKENERTKQIEYQKEIKAYELQLEHWKTDQFRVXXXXXXXXXXXXXXXXXMRADYQDHLARQRSNDQLTQQRKFQEEQLRKQEDSVEKQENLKRGTIEYQAELAHQNALKEIQAKMVGKAKAERENHDIRMERMRAEAIEHRETVLTSIKNVGEIVGTGLNDFFHDKTKVATLIVAVTLTAGGIS----GMRTTFRFIESRIGKPSLIRETSRINAIDFLRHPIKTFKSRMDKPTDPLANIVLKPTLEERLRRLAIATRHTKANNGFYRNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTPLGERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRSTLNAFLQRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPA-SKNQRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVDWQASAYSSDDGVLTESMMDKIVEEAIEGYNKKEEWRKYLLP 1778
            KYA+EAF LS+ NE T+Q+EYQ ++K YEL +E  K  Q R+Q+EE+R+ ++EE K QK R +YQD LAR+R +DQ+ QQ +  EE LRKQE+SV+KQE ++R TIEY+A L HQN LK+I+A++ G+AK EREN DIR+ER R EA EHRET+L SI+  G ++G GLN F  D+ KV T + A T+ AGG+     GM T  R++ESRIGKPSL+RETSR+N +D +RHPI+ F+   ++P DPL NI+L+P+LE  LR++A+ATRHTKAN GFYRN L+ GPPGTGKT  AKSLA+ S +DYAIM+GGD+ PLG  GV+ +HK+FNWA+TSR+G++LF+DEADAFL KR Q +ISE +R+TLNAFL RTGEQS+KFM+V A+N PEQFDWA+N R+DE+V F LP   ER R++RQYF  ++L P+  K QRI L      I++ +KC ++A  TEGLSGR++SKI + WQ +A+SS DG L+E MMD +VE A+    KK+EWR++ LP
Sbjct:   66 KYAKEAFELSRMNEHTRQLEYQSKLKEYELGIEQMKGQQIRIQQEERRKTLDEEAKIQKHRVEYQDMLARKRQDDQMAQQTRMHEETLRKQEESVQKQETMRRQTIEYEANLRHQNELKQIEARLRGEAKIERENRDIRLERSRVEAREHRETILQSIQTAGSVIGAGLNAFLADRFKVVTAVGAATVLAGGVYAAKFGMGTLARYVESRIGKPSLVRETSRLNVVDMIRHPIQAFRKAFNRPGDPLKNIILEPSLEAHLRKVAVATRHTKANGGFYRNVLMAGPPGTGKTMMAKSLALHSGLDYAIMTGGDIAPLGSDGVTAIHKVFNWAKTSRKGVLLFVDEADAFLRKREQERISEGMRATLNAFLYRTGEQSQKFMLVLASNQPEQFDWAINDRMDEIVYFDLPKQRERERMIRQYFDLYLLQPSLDKKQRIHLA---DNIDYAAKCKEVAARTEGLSGRELSKITIAWQTAAFSSKDGTLSEEMMDSVVENAVAANKKKQEWRQHHLP 575          
BLAST of ATPase family AAA domain containing protein vs. TrEMBL
Match: A0A0R3SPC1 (AAA domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS6791 PE=4 SV=1)

HSP 1 Score: 612.453 bits (1578), Expect = 0.000e+0
Identity = 342/619 (55.25%), Postives = 440/619 (71.08%), Query Frame = 3
Query:   72 MSWIFGSGKSXXXXXXXX----XXXXXXXSKDKEKESTKVKAGAYSFXXXXXXXXXXXXXXXXXXKYAQEAFNLSKENERTKQIEYQKEIKAYELQLEHWKTDQFRVXXXXXXXXXXXXXXXXXMRADYQDHLARQRSNDQLTQQRKFQEEQLRKQEDSVEKQENLKRGTIEYQAELAHQNALKEIQAKMVGKAKAERENHDIRMERMRAEAIEHRETVLTSIKNVGEIVGTGLNDFFHDKTKVATLIVAVTLTAGGIS----GMRTTFRFIESRIGKPSLIRETSRINAIDFLRHPIKTFKSRMDKPTDPLANIVLKPTLEERLRRLAIATRHTKANNGFYRNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTPLGERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRSTLNAFLQRTGEQSKK-----------------------FMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPA-SKNQRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVDWQASAYSSDDGVLTESMMDKIVEEAIEGYNKKEEWRKYLLPTAVKADSQQTILPPLDSN 1832
            MSW+FG  +S      G     P PP  PSKD +K+  +  +G + FDSAALERAAKAA++LE SKYA+EAF LS+ NE T+Q+EYQ +IK YE  LE  K  Q R+Q+EE+R+ +EEE++ QK R +YQD LAR+R  DQL QQ +  EE LRKQE+SV+KQE L+R TIEY+A L HQN LK+I+A++ G+A+ EREN +IR+ER R EA EHRETVL SI+  G ++G G + F  DK KV T + A T+ AGGI     GM T  RFIESRIGKP L+RETSR+N +D L HPI+T K  +++P DPL NI+L+PTLE  LR++AIATRHTKAN GFYRN L+ GPPGTGKT +AKSLA  S +DYAIM+GGD+ PLG  GV+ +HK+FNWA+TSRRG++LF+DEADAFL KR Q +ISE +R+TLNAFL RTGEQS++                       FM+V A+N PEQFDWA+N R+DE+V F +P L ER R++R YF  ++L P+  K QRIRL  G   I++ +KC ++A  TEGLSGR++SK+A+ WQ  A+SS++G LTE MMD +V+ A+E   KK+EWR+Y LP A         LP L SN
Sbjct:    1 MSWLFGYSRSQNSGAGGEGGIPPPPPPPPSKDDKKKMEEAISG-FKFDSAALERAAKAARELEKSKYAKEAFELSRMNEHTQQLEYQAKIKEYEAGLEQLKGQQIRIQQEERRKTLEEESRIQKHRVEYQDMLARKRQEDQLAQQARMHEETLRKQEESVQKQEALRRQTIEYEANLRHQNELKQIEARLRGEAQVERENREIRLERSRVEAREHRETVLQSIQTAGSVIGAGFDAFLVDKNKVFTAVGAATVLAGGIYAAKFGMGTMARFIESRIGKPKLVRETSRLNTVDLLIHPIETVKKVLNRPGDPLKNIILEPTLEAHLRKIAIATRHTKANKGFYRNVLMAGPPGTGKTMFAKSLATHSGLDYAIMTGGDIAPLGGDGVTAVHKVFNWAKTSRRGVLLFVDEADAFLRKREQERISEGMRATLNAFLYRTGEQSQRQVHAVVGEIGSKINQMAKPLRPMFMLVLASNQPEQFDWAINDRMDEIVYFDVPKLRERERMIRHYFDMYILQPSLDKKQRIRLADG---IDYAAKCKEVAARTEGLSGRELSKVAIAWQTMAFSSENGTLTEEMMDNVVKNAVEANKKKQEWRQYRLPDA------HVDLPQLSSN 609          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Cavefish
Match: ATAD3A (ATPase family AAA domain containing 3A [Source:HGNC Symbol;Acc:HGNC:25567])

HSP 1 Score: 533.872 bits (1374), Expect = 0.000e+0
Identity = 276/527 (52.37%), Postives = 371/527 (70.40%), Query Frame = 3
Query:  255 KYAQEAFNLSKENERTKQIEYQKEIKAYELQLEHWKTDQFRVXXXXXXXXXXXXXXXXXMRADYQDHLARQRSNDQLTQQRKFQEEQLRKQEDSVEKQENLKRGTIEYQAELAHQNALKEIQAKMVGKAKAERENHDIRMERMRAEAIEHRETVLTSIKNVGEIVGTGLNDFFHDKTKVATLIVAVTLTAGGISGMRTT----FRFIESRIGKPSLIRETSRINAIDFLRHPIKTFKSRMDKPTDPLANIVLKPTLEERLRRLAIATRHTKANNGFYRNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTPLGERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRSTLNAFLQRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKN-QRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVDWQASAYSSDDGVLTESMMDKIVEEAIEGYNKKEEWRKYLLPTAVKADSQQTILPP 1820
            ++A+EA  LS+  E+T Q+E+Q ++K YE  LE  K DQ R+Q EE+R+ + EETKQ + RA YQD LARQR  DQL QQ+   EE LR+QE+SV+KQE +++ TIE++ EL H+N +  ++A+   +A+ EREN DI  E++R +A EHR+TVL SI+  G + G G   F  D  KV   +  +TL A G+   R       R+IE+R+GKPSL+RETSRI   + ++HP+   K  M KP D L  +VL P+LEER+R +AIATR+T+ N G YRN L++GPPGTGKT +AK LA+ S MDYAIM+GGDV P+G  GV+ MHK+F+WA TSRRGL+LF+DEADAFL KR   +ISE+LR+TLNAFL RTGEQS KFM+V A+N PEQFDWA+N RIDE+V F LP   ER RLVR YF  +VL PA+   QR++L     + ++  KC++IA  TEG+SGR+ISK+ V WQA+AYSS+DGVLTE+M+D  V++A+  + +K  W +         DS+ T + P
Sbjct:   66 RHAKEALELSRMQEQTVQMEHQSKMKEYEAALEQLKGDQIRIQGEERRKTLNEETKQHQSRAQYQDKLARQRYEDQLRQQQALNEENLRRQEESVQKQEAMRKATIEHEMELRHKNEMLRVEAEAKARARVERENADIIREQIRLKAAEHRQTVLDSIRTAGAVFGEGFKAFISDWDKVTATVAGLTLLAVGVYTARNATGVGARYIEARLGKPSLVRETSRITVTEAIKHPMS--KRLMSKPQDALEGVVLSPSLEERVRDIAIATRNTRQNRGLYRNILMYGPPGTGKTLFAKKLAVHSGMDYAIMTGGDVAPMGREGVTAMHKVFDWAGTSRRGLLLFVDEADAFLRKRATEKISEDLRATLNAFLYRTGEQSNKFMLVLASNQPEQFDWAINDRIDEIVNFALPGPEERERLVRLYFDRYVLEPATGGKQRLKL----AQFDYGKKCSEIAKRTEGMSGREISKLGVAWQAAAYSSEDGVLTEAMIDARVDDAVRQHAQKMNWLQ---------DSEGTTMSP 577          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Cavefish
Match: vps4a (vacuolar protein sorting 4 homolog A [Source:NCBI gene;Acc:103042556])

HSP 1 Score: 80.1073 bits (196), Expect = 1.567e-15
Identity = 62/202 (30.69%), Postives = 98/202 (48.51%), Query Frame = 3
Query: 1071 YRNALLFGPPGTGKTFYAKSLAM-ASNMDYAIMSGGDVTP--LGERGVSE--MHKIFNWAQTSRRGLMLFIDEADAFLYKR--NQVQISENLRSTLNAFLQRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKNQRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVD 1655
            +R  LLFGPPGTGK++ AK++A  A+N  +  +S  D+    LGE   SE  +  +F  A+  R+  ++FIDE D+    R  N+ + +  +++     +Q  G  + K +V+ ATN P   D A+  R ++ +  PLP+   R  + R +                  G       E+   Q+A  T+G SG DIS I  D
Sbjct:  159 WRGILLFGPPGTGKSYLAKAVATEANNSTFFSVSSSDLMSKWLGE---SEKLVRNLFELARL-RKPSIIFIDEVDSLCGSRSENESEAARRIKTEFLVQMQGVGNNNDKILVLGATNIPWVLDAAIRRRFEKRIYIPLPEEPARAAMFRLHL-----------------GNTPHSLTEADLRQLARKTDGYSGADISIIVRD 339          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Cavefish
Match: vps4a (vacuolar protein sorting 4 homolog A [Source:NCBI gene;Acc:103042556])

HSP 1 Score: 80.1073 bits (196), Expect = 1.703e-15
Identity = 62/202 (30.69%), Postives = 98/202 (48.51%), Query Frame = 3
Query: 1071 YRNALLFGPPGTGKTFYAKSLAM-ASNMDYAIMSGGDVTP--LGERGVSE--MHKIFNWAQTSRRGLMLFIDEADAFLYKR--NQVQISENLRSTLNAFLQRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKNQRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVD 1655
            +R  LLFGPPGTGK++ AK++A  A+N  +  +S  D+    LGE   SE  +  +F  A+  R+  ++FIDE D+    R  N+ + +  +++     +Q  G  + K +V+ ATN P   D A+  R ++ +  PLP+   R  + R +                  G       E+   Q+A  T+G SG DIS I  D
Sbjct:  183 WRGILLFGPPGTGKSYLAKAVATEANNSTFFSVSSSDLMSKWLGE---SEKLVRNLFELARL-RKPSIIFIDEVDSLCGSRSENESEAARRIKTEFLVQMQGVGNNNDKILVLGATNIPWVLDAAIRRRFEKRIYIPLPEEPARAAMFRLHL-----------------GNTPHSLTEADLRQLARKTDGYSGADISIIVRD 363          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Cavefish
Match: vps4a (vacuolar protein sorting 4 homolog A [Source:NCBI gene;Acc:103042556])

HSP 1 Score: 79.7221 bits (195), Expect = 1.790e-15
Identity = 62/202 (30.69%), Postives = 98/202 (48.51%), Query Frame = 3
Query: 1071 YRNALLFGPPGTGKTFYAKSLAM-ASNMDYAIMSGGDVTP--LGERGVSE--MHKIFNWAQTSRRGLMLFIDEADAFLYKR--NQVQISENLRSTLNAFLQRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKNQRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVD 1655
            +R  LLFGPPGTGK++ AK++A  A+N  +  +S  D+    LGE   SE  +  +F  A+  R+  ++FIDE D+    R  N+ + +  +++     +Q  G  + K +V+ ATN P   D A+  R ++ +  PLP+   R  + R +                  G       E+   Q+A  T+G SG DIS I  D
Sbjct:  159 WRGILLFGPPGTGKSYLAKAVATEANNSTFFSVSSSDLMSKWLGE---SEKLVRNLFELARL-RKPSIIFIDEVDSLCGSRSENESEAARRIKTEFLVQMQGVGNNNDKILVLGATNIPWVLDAAIRRRFEKRIYIPLPEEPARAAMFRLHL-----------------GNTPHSLTEADLRQLARKTDGYSGADISIIVRD 339          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Cavefish
Match: spast (spastin [Source:NCBI gene;Acc:405851])

HSP 1 Score: 75.8702 bits (185), Expect = 5.381e-14
Identity = 62/203 (30.54%), Postives = 97/203 (47.78%), Query Frame = 3
Query: 1074 RNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTPL----GERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRSTLNAFLQRTGEQS---KKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKNQRIRLEGGDKKINWESKCNQIA--MITEGLSGRDISKIAVD 1655
            R  LLFGPPG GKT  AK++AM SN  +  +S   +T      GE+ V  +  +    Q S    ++FIDE D+ L +R + +   + R      +Q  G QS    + +V+ ATN P++ D AV  R  + V   LP    R++L+R                  L G       + + +Q+A  ++T+G SG D++ +A D
Sbjct:  306 RGLLLFGPPGNGKTMLAKAVAMESNATFFNISAASLTSKYVGEGEKLVRALFAVARELQPS----VIFIDEIDSLLCERREGEHDASRRLKTEFLIQFDGVQSGGDDRVLVMGATNRPQELDEAVLRRFAKRVYVTLPTEETRLKLLRN-----------------LLGKHGNPLTQKELSQLARLLMTDGYSGSDLTSLAKD 487          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Sea Lamprey
Match: ATAD3A (ATPase family AAA domain containing 3A [Source:HGNC Symbol;Acc:HGNC:25567])

HSP 1 Score: 504.597 bits (1298), Expect = 1.507e-172
Identity = 259/483 (53.62%), Postives = 349/483 (72.26%), Query Frame = 3
Query:  327 IKAYELQLEHWKTDQFRVXXXXXXXXXXXXXXXXXMRADYQDHLARQRSNDQLTQQRKFQEEQLRKQEDSVEKQENLKRGTIEYQAELAHQNALKEIQAKMVGKAKAERENHDIRMERMRAEAIEHRETVLTSIKNVGEIVGTGLNDFFHDKTKVATLIVAVTLTAGGISGMR----TTFRFIESRIGKPSLIRETSRINAIDFLRHPIKTFKSRMDKPTDPLANIVLKPTLEERLRRLAIATRHTKANNGFYRNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTPLGERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRSTLNAFLQRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKN-QRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVDWQASAYSSDDGVLTESMMDKIVEEAIEGYNKKEEW 1760
            ++ YE  +E  K+DQ RVQ EEKR+ + EETKQ + RA YQD LAR+R  DQL QQ+   EE LR+QE+SV+KQE +++ TIE++ EL H+N +  I+A+   + K EREN D+  E++R +A EHR+TVL SIK  G + G G   F  D  KV      +TL A G+   R       R++E+R+GKPSL+R+TSR+  ++ ++HPIK  K    KP D L  +VL P LEER+R +AIATR+T++N G YRN L++GPPGTGKT +AK LA+ S MDYAIM+GGDV P+G  GV+ MHK+F+WA TS+RGL+LF+DEADAFL KR+  +ISE+LR+TLNAFL RTGEQS KFM+V A+N PEQFDWA+N RIDE+V F LP L ER RLVR YF  +VL PA++  QR++L     + ++  KC++IA + EG+SGR+ISK+ V WQA+AY+S+DG+LTE+M+D  V EA+  + +K EW
Sbjct:  144 LQEYEGAIEQMKSDQIRVQSEEKRKTLVEETKQHQARAQYQDQLARRRYEDQLKQQQLMNEENLRRQEESVQKQEAMRKATIEHEMELRHKNEMLRIEAEARARGKVERENADLIREQIRLKAAEHRQTVLDSIKTAGAVFGEGFRAFVSDWDKVTAAAAGLTLLAVGVYTARNATGVAARYVEARLGKPSLVRDTSRLTLLEAVKHPIKVGKRFTSKPLDALEGVVLSPRLEERVRDIAIATRNTRSNRGLYRNILMYGPPGTGKTLFAKKLAVHSGMDYAIMTGGDVAPMGRDGVTAMHKVFDWASTSKRGLLLFVDEADAFLRKRSTERISEDLRATLNAFLYRTGEQSNKFMLVLASNQPEQFDWAINDRIDEIVNFALPALEERERLVRLYFDRYVLEPATQGKQRLKL----AQFDYGKKCSEIAKVAEGMSGREISKLGVAWQAAAYASEDGILTEAMVDSRVSEAMRQHRQKMEW 622          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003236.1 (pep scaffold:Pmarinus_7.0:GL477724:37443:44438:-1 gene:ENSPMAG00000002921.1 transcript:ENSPMAT00000003236.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.559 bits (179), Expect = 3.674e-14
Identity = 63/203 (31.03%), Postives = 97/203 (47.78%), Query Frame = 3
Query: 1071 YRNALLFGPPGTGKTFYAKSLAM-ASNMDYAIMSGGDVTP--LGERGVSE--MHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRSTLNAFL---QRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKNQRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVD 1655
            +R  LLFGPPGTGK++ AK++A  A+N  +  +S  D+    LGE   SE  +  +F  A+  +  + +FIDE D+    RN+ + SE  R     FL   Q  G  +   +V+ ATN P   D A+  R ++ +  PLP+   R+ + + +           N  + L         E+    +   TEG SG DIS +  D
Sbjct:  163 WRGILLFGPPGTGKSYLAKAVATEANNSTFFSVSSSDLVSKWLGE---SEKLVKNLFEMARQHKPSI-IFIDEVDSLCGSRNENE-SEAARRIKTEFLVQMQGVGVDNDGILVLGATNIPWTLDSAIRRRFEKRIYIPLPEEQARLSMFKLHL---------GNTPLSLS--------ETDFRDLGKKTEGYSGADISIVVRD 343          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Sea Lamprey
Match: fignl1 (fidgetin-like 1 [Source:ZFIN;Acc:ZDB-GENE-030131-1862])

HSP 1 Score: 72.4034 bits (176), Expect = 1.722e-13
Identity = 57/203 (28.08%), Postives = 96/203 (47.29%), Query Frame = 3
Query: 1065 GFYRNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTP--LGERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRSTLNAFLQRTGEQS---KKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKNQRIRLEGGDKKINWESKCNQIAMI---TEGLSGRDISKIA 1649
            G  +  LLFGPPGTGKT   K +A  S   +  +S   +T   +GE G   +  +F  A+  R+  ++FIDE D+ L +R   +   + R      +Q  G  +   ++ ++V ATN P++ D A   R+ + +  PLPD +      R+   E +L P S               W+    ++A +   +EG SG D++++ 
Sbjct:  423 GPPKGILLFGPPGTGKTLIGKCIASQSGATFFSISASCLTSKWVGE-GEKMVRALFAVARC-RQPAVIFIDEIDSLLSQRADGEHDSSRRIKTEFLVQLDGATTARDERVLLVGATNRPQEIDEAARRRLAKRLYVPLPDAA-----ARRCLLERLLAPQS---------------WQLSAEELAAVVERSEGFSGADVTQLC 603          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Sea Lamprey
Match: spg7 (SPG7 matrix AAA peptidase subunit, paraplegin [Source:ZFIN;Acc:ZDB-GENE-030131-5391])

HSP 1 Score: 67.3958 bits (163), Expect = 6.301e-12
Identity = 64/234 (27.35%), Postives = 100/234 (42.74%), Query Frame = 3
Query: 1074 RNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGD-VTPLGERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQ---ISENLRSTLNAFL-QRTGEQSKKFMVVFA-TNAPEQFDWAV--NSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKNQRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVDWQASAYSSDDGVLTESMMDKIVEEAIEGYNKK 1751
            + ALL GPPG GKT   K++A  + + +  M+G + V  +G  G + +  +F  A+ +R   +++IDE DA   KR++      +     TLN  L +  G   K  ++V A TN  +  D A+    R D  +   LP L ER  +  Q+     L     +   RL                A +T G SG DI+ +  +    A   +   +     +  VE  I G  KK
Sbjct:  235 KGALLLGPPGCGKTLLGKAVATEAQVPFLAMAGSEFVEVIGGLGAARVRSLFKEAR-ARAPCIVYIDEIDAVGKKRSRNTGGFANTEEEQTLNQLLVEMDGMGPKDHVIVLASTNRADILDGALMRPGRFDRHIYIDLPTLQERREIFEQHLKSLKLAQLETHYSQRL----------------AELTPGFSGADIANVCNEAALHAARENSKSVGVDDFEYAVERVIAGTAKK 451          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Sea Lamprey
Match: yme1l1b (YME1-like 1b [Source:ZFIN;Acc:ZDB-GENE-070410-25])

HSP 1 Score: 67.0106 bits (162), Expect = 8.343e-12
Identity = 58/218 (26.61%), Postives = 102/218 (46.79%), Query Frame = 3
Query: 1074 RNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTPL-GERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRSTLNAFLQRTG--EQSKKFMVVFATNAPEQFDWAV--NSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKNQRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVDWQASAYSSDDGVLTESMMD 1712
            +  LL GPPGTGKT  A+++A  +++ +   SG +   +    G S +  +F  A+ +    ++FIDE D+   KR +  +    R T+N  L      + ++  +V+ ATN PE  D A+    R D  V  P PD+  R  +++ Y             ++++E G   +        IA  T G +G ++  +    QA+  ++ DG    SM++
Sbjct:  326 KGILLVGPPGTGKTLMARAVAGEADVPFYYASGSEFDEMFVGVGASRIRNLFREAK-ANAPCVIFIDELDSVGGKRIESPMHPYSRQTINQLLAEMDGFKPNEGVIVIGATNFPEALDNALVRPGRFDMQVTVPRPDVKGRTEILKLYL-----------SKVKMESGVDPMT-------IARGTVGFTGAELENLV--NQAALKAAMDGKEVVSMVE 522          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Yeast
Match: YME1 (Catalytic subunit of i-AAA protease complex; complex is located in mitochondrial inner membrane; responsible for degradation of unfolded or misfolded mitochondrial gene products; serves as nonconventional translocation motor to pull PNPase into intermembrane space; also has role in intermembrane space protein folding; mutation causes elevated rate of mitochondrial turnover; human homolog YME1L1 can complement yeast null mutant [Source:SGD;Acc:S000006228])

HSP 1 Score: 78.1814 bits (191), Expect = 1.474e-15
Identity = 71/239 (29.71%), Postives = 109/239 (45.61%), Query Frame = 3
Query: 1008 LEERLRRLAIATRHTKANNGFYRNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGG--DVTPLGERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRSTLNAFLQRTG--EQSKKFMVVFATNAPEQFDWAVN--SRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKNQRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVDWQASAYSSDDGVLTESM 1706
            LEE +  L   T++        +  LL GPPGTGKT  A++ A  + +D+  MSG   D   +G  G   +  +F  A+ SR   ++FIDE DA   KRN  +     + TLN  L       Q+   +++ ATN PE  D A+    R D+VV   LPD+  R  +++ +  +  L           +  D  I        IA  T GLSG +++ +    QA+ Y+     ++  M
Sbjct:  293 LEEIVDFLKDPTKYESLGGKLPKGVLLTGPPGTGKTLLARATAGEAGVDFFFMSGSEFDEVYVG-VGAKRIRDLFAQAR-SRAPAIIFIDELDAIGGKRNP-KDQAYAKQTLNQLLVELDGFSQTSGIIIIGATNFPEALDKALTRPGRFDKVVNVDLPDVRGRADILKHHMKKITL----------ADNVDPTI--------IARGTPGLSGAELANLVN--QAAVYACQKNAVSVDM 508          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Yeast
Match: VPS4 (AAA-ATPase involved in multivesicular body (MVB) protein sorting; ATP-bound Vps4p localizes to endosomes and catalyzes ESCRT-III disassembly and membrane release; ATPase activity is activated by Vta1p; regulates cellular sterol metabolism [Source:SGD;Acc:S000006377])

HSP 1 Score: 77.411 bits (189), Expect = 1.513e-15
Identity = 58/207 (28.02%), Postives = 98/207 (47.34%), Query Frame = 3
Query: 1053 KANNGFYRNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTP--LGERGVSE--MHKIFNWAQTSRRGLMLFIDEADAFLYKRNQ--VQISENLRSTLNAFLQRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKNQRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVD 1655
            K N       LL+GPPGTGK++ AK++A  +N  +  +S  D+    +GE   SE  + ++F  A+ ++  + +FIDE DA    R +   + S  +++ L   +   G  S+  +V+ ATN P Q D A+  R +  +  PLPDL+ R  +      +   +   ++ R                  +  +TEG SG DI+ +  D
Sbjct:  160 KGNRKPTSGILLYGPPGTGKSYLAKAVATEANSTFFSVSSSDLVSKWMGE---SEKLVKQLFAMARENKPSI-IFIDEVDALTGTRGEGESEASRRIKTELLVQMNGVGNDSQGVLVLGATNIPWQLDSAIRRRFERRIYIPLPDLAARTTMFEINVGDTPCVLTKEDYRT-----------------LGAMTEGYSGSDIAVVVKD 345          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Yeast
Match: RPT1 (ATPase of the 19S regulatory particle of the 26S proteasome; one of six ATPases of the regulatory particle; involved in the degradation of ubiquitinated substrates; required for optimal CDC20 transcription; interacts with Rpn12p and Ubr1p; mutant has aneuploidy tolerance [Source:SGD;Acc:S000001628])

HSP 1 Score: 77.0258 bits (188), Expect = 2.027e-15
Identity = 70/246 (28.46%), Postives = 113/246 (45.93%), Query Frame = 3
Query: 1074 RNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTP--LGERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKR--------NQVQISENLRSTLNAFLQRTG-EQSKKFMVVFATNAPEQFDWAV--NSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKNQRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVDWQASAYSSDDGVLTESMMDKIVEEAIEGYNKKEEWRKYL 1772
            +  LL+GPPGTGKT  A+++A  ++  +  + G ++    +GE G   + ++F  A+T ++  ++F DE DA    R        N+VQ     R+ L    Q  G +      V+FATN P   D A+    RID  VEF LPDL  R  + R +         SK+  +     ++ I WE     I+ +    +G ++  +  +    A  +   V TE    K V++ I GY K     +Y+
Sbjct:  244 KGILLYGPPGTGKTLCARAVANRTDATFIRVIGSELVQKYVGE-GARMVRELFEMART-KKACIIFFDEIDAVGGARFDDGAGGDNEVQ-----RTMLELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANIFRIH---------SKSMSV-----ERGIRWE----LISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLKAVDKVISGYKKFSSTSRYM 464          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Yeast
Match: AFG3 (Mitochondrial inner membrane m-AAA protease component; mediates degradation of misfolded or unassembled proteins; also required for correct assembly of mitochondrial enzyme complexes; involved in cytoplasmic mRNA translation and aging; expression of human homolog AFG3L2 can complement yeast yta12 afg3 double mutant [Source:SGD;Acc:S000000819])

HSP 1 Score: 70.8626 bits (172), Expect = 2.933e-13
Identity = 66/245 (26.94%), Postives = 109/245 (44.49%), Query Frame = 3
Query: 1044 RHTKANNGFYRNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGD-VTPLGERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKRNQ----VQISENLRSTLNAFLQRTG--EQSKKFMVVFATNAPEQFDWAV--NSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKNQRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVDWQASAYSSDDGVLTESMMDKIVEEAIEGYNKK 1751
            ++TK      R A+L GPPGTGKT  AK+ A  +N+ +  +SG + V      G S +  +F  A+ S    ++FIDE DA   +R +       ++   +TLN  L        S + +V+  TN P+  D A+    R D  ++   PD++ R ++   +     L P   +    L G            ++A +T G +G DI+    +    A   +D  +T    ++ +E  I G  KK
Sbjct:  312 KYTKLGAKIPRGAILSGPPGTGKTLLAKATAGEANVPFLSVSGSEFVEMFVGVGASRVRDLFTQAR-SMAPSIIFIDEIDAIGKERGKGGALGGANDEREATLNQLLVEMDGFTTSDQVVVLAGTNRPDVLDNALMRPGRFDRHIQIDSPDVNGRQQIYLVHLKRLNLDPLLTDDMNNLSG------------KLATLTPGFTGADIANACNEAALIAARHNDPYITIHHFEQAIERVIAGLEKK 543          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Yeast
Match: SAP1 (Putative ATPase of the AAA family; interacts with the Sin1p transcriptional repressor in the two-hybrid system [Source:SGD;Acc:S000000849])

HSP 1 Score: 67.3958 bits (163), Expect = 4.216e-12
Identity = 63/223 (28.25%), Postives = 99/223 (44.39%), Query Frame = 3
Query: 1074 RNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTP--LGERGVSE--MHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRSTLNAFL----------------------QRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKNQRI---RLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVD 1655
            R  LLFGPPGTGKT  A+++A  S+  +  +S   +T   LGE   SE  +  +F  A+     + +F+DE D+ +  RN    +E+ R   N FL                          E   + +V+ ATN P    W++             D + R R VR+   +++ LP  + + +   +L    K    ES  +++  ITEG SG DI+ +A D
Sbjct:  639 RGMLLFGPPGTGKTMLARAVATESHSTFFSISASSLTSKYLGE---SEKLVRALFAIAKKLSPSI-IFVDEIDSIMGSRNNENENESSRRIKNEFLVQWSSLSSAAAGSNKSNTNNSDTNGDEDDTRVLVLAATNLP----WSI-------------DEAARRRFVRR---QYIPLPEDQTRHVQFKKLLSHQKHTLTESDFDELVKITEGYSGSDITSLAKD 837          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Nematostella
Match: EDO42350 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1M1])

HSP 1 Score: 492.656 bits (1267), Expect = 2.088e-169
Identity = 245/435 (56.32%), Postives = 323/435 (74.25%), Query Frame = 3
Query:  258 YAQEAFNLSKENERTKQIEYQKEIKAYELQLEHWKTDQFRVXXXXXXXXXXXXXXXXXMRADYQDHLARQRSNDQLTQQRKFQEEQLRKQEDSVEKQENLKRGTIEYQAELAHQNALKEIQAKMVGKAKAERENHDIRMERMRAEAIEHRETVLTSIKNVGEIVGTGLNDFFHDKTKVATLIVAVTLTAGGIS----GMRTTFRFIESRIGKPSLIRETSRINAIDFLRHPIKTFKSRMDKPTDPLANIVLKPTLEERLRRLAIATRHTKANNGFYRNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTPLGERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRSTLNAFLQRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKNQRIR 1550
            +AQ+A +L+K  E TKQ+E Q++IK YE  +   + D+ RV++EEKR+ +  ET+Q + RA Y+D LAR+R NDQL QQR+ QEE LRKQE+SV++QE ++R T+EY+AEL H+N +K ++A++ GKAK EREN DI +E++R +A E R TVL SIK  G I+G G + F  D  K++     +TL A GI     G   T RF+E+R+GKPSL+R+TSRIN    +RHPIKT K     P D L  I+LKP LEE L  ++IAT +TK N G YRN L +GPPGTGKT +AKSLA  S MDYA+M+GGDV P+G+ GV+ MHK+F+WA+TSRRG++LF+DEADAFL KR+Q +ISE+LRSTLNAFL RTGE S++FM+V A+N P+QFDWA+N RIDE+VEF LP++ ER RLVRQYF E+ L PA+   R R
Sbjct:   74 HAQKALDLAKLQESTKQLEKQEKIKEYEAGINQMQLDRVRVEQEEKRKTLSAETQQHQQRAQYEDQLARKRYNDQLGQQRQMQEENLRKQEESVKRQEAIRRSTVEYEAELKHKNDMKRLEAELRGKAKIERENKDINLEKIRVKAAEQRATVLESIKTAGSILGAGFDAFISDWDKISATAAGLTLLALGIYTAKYGTGVTARFVEARLGKPSLVRDTSRINLFSAIRHPIKTTKKLFVNPEDSLKGIILKPNLEEHLSSISIATSNTKRNKGMYRNLLFYGPPGTGKTMFAKSLARHSGMDYAVMTGGDVVPMGKEGVTAMHKVFDWAETSRRGVLLFVDEADAFLRKRSQEKISEDLRSTLNAFLYRTGESSRRFMLVLASNQPDQFDWAINDRIDELVEFGLPNVDERERLVRQYFEEYCLKPATSGSRTR 508          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Nematostella
Match: EDO35907 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK75])

HSP 1 Score: 78.1814 bits (191), Expect = 2.245e-15
Identity = 60/200 (30.00%), Postives = 101/200 (50.50%), Query Frame = 3
Query: 1071 YRNALLFGPPGTGKTFYAKSLAM-ASNMDYAIMSGGDVTP--LGERGVSE--MHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRSTLNAFL---QRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKNQRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKI 1646
            +R  LL+GPPGTGK++ AK++A  A+N  +  +S  D+    LGE   SE  + ++F  A+ ++  + +FIDE D+    R++ + SE+ R     FL   Q  G  + + +V+ ATN P   D A+  R ++ +  PLP+ + R ++   +                  GG K +    +  Q+   T+G SG DIS +
Sbjct:  165 WRGILLYGPPGTGKSYLAKAVATEANNSTFISVSSSDLVSKWLGE---SERLVKQLFELARENKPSI-IFIDEVDSLCGSRSENE-SESARRIKTEFLVQMQGVGVDNDQVLVLGATNIPWTLDSAIRRRFEKRIYIPLPEQAARSKMFELHL-----------------GGSKTLLGAQEIKQLGQKTDGYSGADISVV 342          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Nematostella
Match: EDO36218 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ61])

HSP 1 Score: 70.8626 bits (172), Expect = 1.007e-12
Identity = 58/201 (28.86%), Postives = 98/201 (48.76%), Query Frame = 3
Query: 1074 RNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDV-TPLGERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQ------ISENLRSTLNAFLQRTGEQSKKFMVVFATNAPEQFDWAVN--SRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKNQRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIA 1649
            R  LLFGPPGTGKT  A+++A  +   + +++G ++ + L     S + K F  A+ +   + +FIDE DA   KR++        I   L + ++   QR+       +V+ ATN P   D A+    R D  V+  +PD + R+ ++R +         +KN ++    GD  ++ E    QIA  T G  G D++ + 
Sbjct:  234 RGILLFGPPGTGKTLMARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNSPAI-IFIDEIDAIAPKRDKTHGEVERRIVSQLLTLMDGLKQRS-----HVIVMAATNRPNSVDVALRRFGRFDREVDIGIPDATGRLEILRIH---------TKNMKL----GD-DVDLE----QIAAETHGYVGSDVASLC 410          

HSP 2 Score: 58.5362 bits (140), Expect = 7.165e-9
Identity = 50/200 (25.00%), Postives = 91/200 (45.50%), Query Frame = 3
Query: 1074 RNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTPL--GERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRS--TLNAFL-QRTGEQSKK-FMVVFATNAPEQFDWAV--NSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKNQRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIA 1649
            +  L +GPPG GKT  AK++A     ++  + G ++  +  GE   + +  +F+ A+++    +LF DE D+    R          +   +N  L +  G   KK   ++ ATN P+  D A+    R+D+++  PLPD   R  +++             N R      D  +++      +A +T G SG D+++I 
Sbjct:  507 KGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGE-SEANVRDVFDKARSA-APCVLFFDELDSIAKSRGGNVGDGGGAADRVINQVLTEMDGMNVKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDDGSRSSILKA------------NLRKSPIAKDVDLDY------VAKVTHGFSGADLTEIC 686          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Nematostella
Match: EDO31428 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXZ8])

HSP 1 Score: 67.0106 bits (162), Expect = 2.946e-12
Identity = 55/201 (27.36%), Postives = 89/201 (44.28%), Query Frame = 3
Query: 1071 YRNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTPLGERGVSE--MHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRSTLNAFLQRTGEQ----SKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKNQRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVD 1655
            +R  LL+GPPGTGKT  A+++A   N  +  +S  D+      G SE  + ++F+ A+      ++FIDE D+   KR+  +     R       Q  G      S ++ ++ ATN P + D A   R  + +  PLP+   R+ L++ +       PA   +R     G+K              T G SG D++    D
Sbjct:   16 WRRVLLYGPPGTGKTRLAQAVASEVNSTFYSVSSADLIS-SWVGESEKLIRELFHDARKREGRSVIFIDEIDSVCRKRSTREEEHTRRVKTELLNQMEGTDSLSLSGQYFLLCATNCPWELDSAFIRRFQKRIYIPLPEQDARISLIKMHLGT---TPACLTERDWCVLGEK--------------TRGFSGSDLANCTSD 198          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Nematostella
Match: EDO40553 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S706])

HSP 1 Score: 67.781 bits (164), Expect = 6.881e-12
Identity = 63/234 (26.92%), Postives = 105/234 (44.87%), Query Frame = 3
Query: 1074 RNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTPL-GERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKR---NQVQISENLRSTLNAFL-QRTGEQSKKFMVVFA-TNAPEQFDWAV--NSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKNQRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVDWQASAYSSDDGVLTESMMDKIVEEAIEGYNKK 1751
            + A+L GPPGTGKT  AK++A  + + +  +SG +   +    G + +  +F  A+ +    ++FIDE DA    R    Q    +   +TLN  L +  G  S   +VV + TN P+  D A+    R D  +  P PD+  R  + + +     L P  KN           ++ E    ++A +T G +G DI+ +  +    A       + E   ++ +E  I G  KK
Sbjct:  180 KGAILSGPPGTGKTLLAKAVAGEAGVPFLSISGSEFLEMFVGVGPARVRDLFAQARKNAP-CIIFIDEIDAVGRARGRGGQFGGHDERENTLNQLLVEMDGFSSSTNVVVLSGTNRPDVLDPALLRPGRFDRQIHLPAPDIKGRCSIFKVH-----LKPIKKN-----------VDEEKLARKMAALTPGFTGADIANVCNEAALIAARYLAPFVEEKHFEQAIERVIGGLEKK 396          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Medaka
Match: ATAD3A (ATPase family AAA domain containing 3A [Source:NCBI gene;Acc:101170821])

HSP 1 Score: 545.428 bits (1404), Expect = 0.000e+0
Identity = 278/507 (54.83%), Postives = 368/507 (72.58%), Query Frame = 3
Query:  255 KYAQEAFNLSKENERTKQIEYQKEIKAYELQLEHWKTDQFRVXXXXXXXXXXXXXXXXXMRADYQDHLARQRSNDQLTQQRKFQEEQLRKQEDSVEKQENLKRGTIEYQAELAHQNALKEIQAKMVGKAKAERENHDIRMERMRAEAIEHRETVLTSIKNVGEIVGTGLNDFFHDKTKVATLIVAVTLTAGGISGMRTTF----RFIESRIGKPSLIRETSRINAIDFLRHPIKTFKSRMDKPTDPLANIVLKPTLEERLRRLAIATRHTKANNGFYRNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTPLGERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRSTLNAFLQRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKN-QRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVDWQASAYSSDDGVLTESMMDKIVEEAIEGYNKKEEW 1760
            ++A+EA  L++  E T Q+EYQ +IK YE  +E  K DQ R+Q EE+R+ + EETKQ + RA YQD LARQR  DQL QQ+   EE LRKQE+SV+KQE +++ TIE++ EL H+N L  I+A+   +A+ EREN DI  E++R +A EHR+TVL SIK  G + G G   F  D  KV   +  +TL A G+   R       R+IE+R+GKPSL+RETSR    + ++HP+KT K    KP D L  +VL P+LEER+R +AIATR+T+ N G YRN L++GPPGTGKT +AK LA+ S MDYAIM+GGDV P+G  GV+ MHK+F+WA TSRRGL+LF+DEADAFL KR   +ISE+LR+TLNAFL RTGEQS KFM+V A+N PEQFDWA+N RIDE+V F LP L ER RLVR YF ++VL PA+   QR++L     + ++  KC++IA  TEG+SGR+ISK+ V WQA+AYSS+DGVLTE+M+D  V++AI+ +++K +W
Sbjct:   64 RHAKEALELARMQEGTTQMEYQSKIKEYEAAVEQLKGDQIRIQAEERRKTLNEETKQHQARAQYQDKLARQRYEDQLRQQQLLNEENLRKQEESVQKQEAMRKATIEHEMELRHKNELLRIEAETKARARVERENADIIREQIRLKAAEHRQTVLESIKTAGAVFGEGFRAFVSDWDKVTATVAGLTLLAVGVYSARNATGVAGRYIEARLGKPSLVRETSRFTVAEAIKHPVKTAKRLKSKPQDALEGVVLSPSLEERVRDIAIATRNTRQNKGLYRNILMYGPPGTGKTLFAKKLAVHSGMDYAIMTGGDVAPMGRDGVTAMHKVFDWANTSRRGLLLFVDEADAFLRKRATEKISEDLRATLNAFLYRTGEQSNKFMLVLASNQPEQFDWAINDRIDEIVNFALPRLEERERLVRLYFDKYVLEPATGGRQRLKL----AQFDYGRKCSEIAKRTEGMSGREISKLGVAWQAAAYSSEDGVLTEAMIDARVDDAIKQHHQKMDW 566          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Medaka
Match: ATAD3A (ATPase family AAA domain containing 3A [Source:NCBI gene;Acc:101170821])

HSP 1 Score: 521.161 bits (1341), Expect = 4.176e-178
Identity = 270/507 (53.25%), Postives = 359/507 (70.81%), Query Frame = 3
Query:  255 KYAQEAFNLSKENERTKQIEYQKEIKAYELQLEHWKTDQFRVXXXXXXXXXXXXXXXXXMRADYQDHLARQRSNDQLTQQRKFQEEQLRKQEDSVEKQENLKRGTIEYQAELAHQNALKEIQAKMVGKAKAERENHDIRMERMRAEAIEHRETVLTSIKNVGEIVGTGLNDFFHDKTKVATLIVAVTLTAGGISGMRTTF----RFIESRIGKPSLIRETSRINAIDFLRHPIKTFKSRMDKPTDPLANIVLKPTLEERLRRLAIATRHTKANNGFYRNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTPLGERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRSTLNAFLQRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKN-QRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVDWQASAYSSDDGVLTESMMDKIVEEAIEGYNKKEEW 1760
            ++A+EA  L++  E T Q+EYQ +IK YE  +E  K DQ R+Q EE+R+ + EETKQ + RA YQD LARQR  DQL QQ+   EE LRKQE+SV+KQE +++ TIE++ EL H+N L  I+A+   +A+ EREN DI  E++R +A EHR+TVL SIK  G + G G   F  D  KV   +  +TL A G+   R       R+IE+R+GKPSL+RETSR    + ++HP+K                   P+LEER+R +AIATR+T+ N G YRN L++GPPGTGKT +AK LA+ S MDYAIM+GGDV P+G  GV+ MHK+F+WA TSRRGL+LF+DEADAFL KR   +ISE+LR+TLNAFL RTGEQS KFM+V A+N PEQFDWA+N RIDE+V F LP L ER RLVR YF ++VL PA+   QR++L     + ++  KC++IA  TEG+SGR+ISK+ V WQA+AYSS+DGVLTE+M+D  V++AI+ +++K +W
Sbjct:   64 RHAKEALELARMQEGTTQMEYQSKIKEYEAAVEQLKGDQIRIQAEERRKTLNEETKQHQARAQYQDKLARQRYEDQLRQQQLLNEENLRKQEESVQKQEAMRKATIEHEMELRHKNELLRIEAETKARARVERENADIIREQIRLKAAEHRQTVLESIKTAGAVFGEGFRAFVSDWDKVTATVAGLTLLAVGVYSARNATGVAGRYIEARLGKPSLVRETSRFTVAEAIKHPVK-------------------PSLEERVRDIAIATRNTRQNKGLYRNILMYGPPGTGKTLFAKKLAVHSGMDYAIMTGGDVAPMGRDGVTAMHKVFDWANTSRRGLLLFVDEADAFLRKRATEKISEDLRATLNAFLYRTGEQSNKFMLVLASNQPEQFDWAINDRIDEIVNFALPRLEERERLVRLYFDKYVLEPATGGRQRLKL----AQFDYGRKCSEIAKRTEGMSGREISKLGVAWQAAAYSSEDGVLTEAMIDARVDDAIKQHHQKMDW 547          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Medaka
Match: ATAD3A (ATPase family AAA domain containing 3A [Source:NCBI gene;Acc:101170821])

HSP 1 Score: 80.1073 bits (196), Expect = 8.420e-17
Identity = 55/103 (53.40%), Postives = 74/103 (71.84%), Query Frame = 3
Query:  255 KYAQEAFNLSKENERTKQIEYQKEIKAYELQLEHWKTDQFRVXXXXXXXXXXXXXXXXXMRADYQDHLARQRSNDQLTQQRKFQEEQLRKQEDSVEKQENLKR 563
            ++A+EA  L++  E T Q+EYQ +IK YE  +E  K DQ R+Q EE+R+ + EETKQ + RA YQD LARQR  DQL QQ+   EE LRKQE+SV+KQE +++
Sbjct:   64 RHAKEALELARMQEGTTQMEYQSKIKEYEAAVEQLKGDQIRIQAEERRKTLNEETKQHQARAQYQDKLARQRYEDQLRQQQLLNEENLRKQEESVQKQEAMRK 166          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Medaka
Match: vps4a (vacuolar protein sorting 4 homolog A [Source:NCBI gene;Acc:101168949])

HSP 1 Score: 79.7221 bits (195), Expect = 1.827e-15
Identity = 64/203 (31.53%), Postives = 101/203 (49.75%), Query Frame = 3
Query: 1071 YRNALLFGPPGTGKTFYAKSLAM-ASNMDYAIMSGGDVTP--LGERGVSE--MHKIFNWAQTSRRGLMLFIDEADAFLYKR--NQVQISENLRSTLNAFLQRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKNQRIRLEGGDKKINW-ESKCNQIAMITEGLSGRDISKIAVD 1655
            +R  LLFGPPGTGK++ AK++A  A+N  +  +S  D+    LGE   SE  +  +F+ A+  +  + +FIDE D+    R  N+ +    +++ L   +Q  G  +   +V+ ATN P   D A+  R ++ +  PLP+   RV++ R +                   G+   N  E+   Q+A  TEG SG DIS I  D
Sbjct:  159 WRGILLFGPPGTGKSYLAKAVATEANNSTFFSVSSSDLMSKWLGE---SEKLVKNLFDLARQHKPSI-IFIDEVDSLCGSRNENEGEAVRRIKTELLVQMQGVGNNNDGVLVLGATNIPWVLDAAIRRRFEKRIYIPLPEEPARVQMFRIHL------------------GNTPHNLSEADLRQLAHKTEGYSGADISIIVRD 339          
BLAST of ATPase family AAA domain containing protein vs. Ensembl Medaka
Match: fignl1 (fidgetin like 1 [Source:NCBI gene;Acc:101168425])

HSP 1 Score: 73.1738 bits (178), Expect = 4.598e-13
Identity = 58/202 (28.71%), Postives = 94/202 (46.53%), Query Frame = 3
Query: 1065 GFYRNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTPL----GERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRSTLNAFLQRTGEQSK---KFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKNQRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIA 1649
            G  +  LLFGPPGTGKT   K +A  S   +  +S   +T      GE+ V  +  I    Q +    ++FIDE D+ L +R   +   + R      +Q  G  +    + +VV ATN P++ D A   R+ + +  PLP+ + R ++V      F L+   K+Q +R          E +   +   TEG SG D++++ 
Sbjct:  393 GPPKGILLFGPPGTGKTLIGKCIACQSGATFFSISASSLTSKWVGEGEKMVRALFAIAGCHQPA----VIFIDEIDSLLSQRTDGEHDSSRRIKTEFLVQLDGAATASEDRILVVGATNRPQEIDEAARRRLAKRLYIPLPEAAARRQIV------FNLMAQEKSQ-LR----------EPELESVVRATEGFSGADMTQLC 573          
BLAST of ATPase family AAA domain containing protein vs. Planmine SMEST
Match: SMESG000003318.1 (SMESG000003318.1)

HSP 1 Score: 1099.35 bits (2842), Expect = 0.000e+0
Identity = 588/589 (99.83%), Postives = 589/589 (100.00%), Query Frame = 3
Query:   72 MSWIFGSGKSXXXXXXXXXXXXXXXSKDKEKESTKVKAGAYSFXXXXXXXXXXXXXXXXXXKYAQEAFNLSKENERTKQIEYQKEIKAYELQLEHWKTDQFRVXXXXXXXXXXXXXXXXXMRADYQDHLARQRSNDQLTQQRKFQEEQLRKQEDSVEKQENLKRGTIEYQAELAHQNALKEIQAKMVGKAKAERENHDIRMERMRAEAIEHRETVLTSIKNVGEIVGTGLNDFFHDKTKVATLIVAVTLTAGGISGMRTTFRFIESRIGKPSLIRETSRINAIDFLRHPIKTFKSRMDKPTDPLANIVLKPTLEERLRRLAIATRHTKANNGFYRNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTPLGERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRSTLNAFLQRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKNQRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVDWQASAYSSDDGVLTESMMDKIVEEAIEGYNKKEEWRKYLLPTAVKADSQQTILPPLDSNRL 1838
            MSWIFGSGKSTPQIPPGAPQPPTDPSKDKEKESTKVKAGAYSFDSAALERAAKAAKDLEASKYAQEAFNLSKENERTKQIEYQKEIKAYELQLEHWKTDQFRVQEEEKRRRMEEETKQQKMRADYQDHLARQRSNDQLTQQRKFQEEQLRKQEDSVEKQENLKRGTIEYQAELAHQNALKEIQAKMVGKAKAERENHDIRMERMRAEAIEHRETVLTSIKNVGEIVGTGLNDFFHDKTKVATLIVAVTLTAGGISGMRTTFRFIESRIGKPSLIRETSRINAIDFLRHPIKTFKSRMDKPTDPLANIVLKPTLEERLRRLAIATRHTKANNGFYRNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTPLGERGVSEMHKIFNWAQTS+RGLMLFIDEADAFLYKRNQVQISENLRSTLNAFLQRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKNQRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVDWQASAYSSDDGVLTESMMDKIVEEAIEGYNKKEEWRKYLLPTAVKADSQQTILPPLDSNRL
Sbjct:    1 MSWIFGSGKSTPQIPPGAPQPPTDPSKDKEKESTKVKAGAYSFDSAALERAAKAAKDLEASKYAQEAFNLSKENERTKQIEYQKEIKAYELQLEHWKTDQFRVQEEEKRRRMEEETKQQKMRADYQDHLARQRSNDQLTQQRKFQEEQLRKQEDSVEKQENLKRGTIEYQAELAHQNALKEIQAKMVGKAKAERENHDIRMERMRAEAIEHRETVLTSIKNVGEIVGTGLNDFFHDKTKVATLIVAVTLTAGGISGMRTTFRFIESRIGKPSLIRETSRINAIDFLRHPIKTFKSRMDKPTDPLANIVLKPTLEERLRRLAIATRHTKANNGFYRNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTPLGERGVSEMHKIFNWAQTSKRGLMLFIDEADAFLYKRNQVQISENLRSTLNAFLQRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKNQRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVDWQASAYSSDDGVLTESMMDKIVEEAIEGYNKKEEWRKYLLPTAVKADSQQTILPPLDSNRL 589          
BLAST of ATPase family AAA domain containing protein vs. Planmine SMEST
Match: SMESG000077944.1 (SMESG000077944.1)

HSP 1 Score: 75.0998 bits (183), Expect = 4.242e-14
Identity = 68/231 (29.44%), Postives = 107/231 (46.32%), Query Frame = 3
Query: 1083 LLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTPL-GERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRSTLNAFL-QRTGEQSKKFMVVF-ATNAPEQFDWAV--NSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKNQRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIAVDWQASAYSSDDGVLTESMMDKIVEEAIEGYNKKEEW 1760
            +L GPPG GKT   K+LA  +N+ +   SG D   + G +  +++ ++F  A +S   + +FIDE DA    R       +   TLN  L +  G +S   ++VF ATN  +  D A+    R D  +    P L ER  L   Y         SKNQ+  ++G  K ++     +++++ T G++G DIS I  +    A   D   +T    D  +E  I G   K  +
Sbjct:    1 MLLGPPGCGKTLLVKALASEANVPFFYKSGPDFIDMRGGQAAAKLREVFRKASSSAPSI-IFIDEIDAIGKTRGFHSGESDEDQTLNQLLVEMDGMESVAGVIVFAATNRVDILDKALIRPGRFDRHILVDYPVLEERKELFTLYL--------SKNQQ-HIQGSIKNLS-----DRLSLQTPGMTGADISNICNEAAVIASRMDYKTVTNECFDIALERVIAGSESKTRF 216          
BLAST of ATPase family AAA domain containing protein vs. Planmine SMEST
Match: SMESG000009448.1 (SMESG000009448.1)

HSP 1 Score: 75.0998 bits (183), Expect = 4.710e-14
Identity = 59/199 (29.65%), Postives = 95/199 (47.74%), Query Frame = 3
Query: 1071 YRNALLFGPPGTGKTFYAKSLAM-ASNMDYAIMSGGDVTP--LGERGVSE--MHKIFNWAQTSRRGLMLFIDEADAFL--YKRNQVQISENLRSTLNAFLQRTGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKNQRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKI 1646
            +R  LL+GPPGTGK++ AK++A  A N  +  +S  D+    LGE   SE  +  +F  A+  R  + +FIDE D+       ++ + +  +++     ++  G Q+ K +V+ ATN P   D A+  R ++ +  PLPDL  R  L R                    G       E+  N ++  TEG SG DI+ +
Sbjct:  155 WRGILLYGPPGTGKSYLAKAVATEAENSTFFAISSSDLVSKWLGE---SEKLVKNLFELAREHRPSI-IFIDEIDSMCGSRSESESESARRIKTEFLVQMEGVGAQNDKVLVLAATNIPWALDSAIRRRFEKRIYIPLPDLGARALLFRLSL-----------------GDTPNTISEADINSLSKRTEGYSGSDIANL 332          
BLAST of ATPase family AAA domain containing protein vs. Planmine SMEST
Match: SMESG000045800.1 (SMESG000045800.1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.827e-12
Identity = 61/198 (30.81%), Postives = 92/198 (46.46%), Query Frame = 3
Query: 1083 LLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTPL----GERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKRNQVQISENLRSTLNAFLQR-----TGEQSKKFMVVFATNAPEQFDWAVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKNQRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIA 1649
            LLFGPPGTGKT   K +A  S   +  +S   +T      GE+ V  M  +    Q +    ++FIDE D+ L +RN+ +  E+ R     FL       TGE ++K + + ATN P + D AV  R  + V  PLP    R    RQ  Y+ +     KN+ + +         E +   I   ++G SG D++ + 
Sbjct:  304 LLFGPPGTGKTLIGKCIASQSKSTFFSISASSLTSKWVGDGEKMVRIMFTVARLLQPA----VIFIDEIDSLLSQRNETE-HESSRKIKTQFLVEMEGVGTGE-NEKLLFIGATNRPYEIDEAVRRRFVKRVYIPLPSAKAR----RQIIYKLL-----KNESLNI--------TEEELESILEKSDGYSGADMTNLC 478          
BLAST of ATPase family AAA domain containing protein vs. Planmine SMEST
Match: SMESG000027507.1 (SMESG000027507.1)

HSP 1 Score: 69.707 bits (169), Expect = 4.359e-12
Identity = 57/198 (28.79%), Postives = 99/198 (50.00%), Query Frame = 3
Query: 1074 RNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDV-TPLGERGVSEMHKIFNWAQTSRRGLMLFIDEADAFLYKRNQV--QISENLRSTLNAFLQRTGEQSKKFMVVF-ATNAPEQFDWAVN--SRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKNQRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIA 1649
            R  LLFGPPGTGKT  A+++A  +   + +++G ++ + +     S + K F  A+ +   + LFIDE D+   KR++   ++ + + S L   +   G +S+  +VV  ATN P   D A+    R D  V+  +PD + R+ ++R +         +KN +I        +N E    Q+A  T G  G D++ + 
Sbjct:  221 RGILLFGPPGTGKTMIARAVANETGAFFFLINGPEIMSKMAGESESNLRKAFEEAEKNSPSI-LFIDEVDSIAPKRDKTNGEVEKRIVSQLLTLMD--GLKSRSNVVVMAATNRPNSIDPALRRFGRFDREVDIGIPDTTGRLEILRIH---------TKNMKI-----SDDVNLE----QVANETHGCVGADLASLC 397          

HSP 2 Score: 65.0846 bits (157), Expect = 1.022e-10
Identity = 53/200 (26.50%), Postives = 94/200 (47.00%), Query Frame = 3
Query: 1074 RNALLFGPPGTGKTFYAKSLAMASNMDYAIMSGGDVTPL--GERGVSEMHKIFNWAQTSRRGLMLFIDEAD--AFLYKRNQVQISENLRSTLNAFL-QRTGEQSKK-FMVVFATNAPEQFDWAV--NSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKNQRIRLEGGDKKINWESKCNQIAMITEGLSGRDISKIA 1649
            +  L +GPPG GKT  AK++A     ++  + G ++  +  GE   + + +IF+ A+ +    +LF DE D  A                 +N  L +  G  SKK   ++ ATN P+  D A+    R+D+++  PLPD   R+ +++    +     +  +QR+ LE              +A +T+G SG D+++I 
Sbjct:  494 KGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMYFGESE-ANIREIFDKARQAAP-CVLFFDELDSIATARGSGAGDAGGAGDRVINQLLTEMDGMSSKKNVFIIGATNRPDILDGAILRPGRLDQLIYIPLPDEKSRLAILKANLRK-----SPVSQRVNLE-------------HLARVTDGFSGADLTEIC 673          
The following BLAST results are available for this feature:
BLAST of ATPase family AAA domain containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATAD3B6.290e-17452.36ATPase family AAA domain containing 3B [Source:HGN... [more]
ATAD3A2.280e-17252.85ATPase family AAA domain containing 3A [Source:HGN... [more]
ATAD3A9.406e-17153.29ATPase family AAA domain containing 3A [Source:HGN... [more]
ATAD3A4.177e-16853.20ATPase family AAA domain containing 3A [Source:HGN... [more]
ATAD3C3.629e-13150.80ATPase family AAA domain containing 3C [Source:HGN... [more]
back to top
BLAST of ATPase family AAA domain containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atad-32.514e-17449.30ATPase family AAA domain-containing protein 3 [So... [more]
atad-32.514e-17449.30ATPase family AAA domain-containing protein 3 [So... [more]
ppgn-16.530e-1428.51ParaPleGiN AAA protease family; Paraplegin [Sourc... [more]
ppgn-16.530e-1428.51ParaPleGiN AAA protease family; Paraplegin [Sourc... [more]
rpt-15.194e-1224.9026S proteasome regulatory subunit 7 [Source:UniPr... [more]
back to top
BLAST of ATPase family AAA domain containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bor9.519e-15947.45gene:FBgn0040237 transcript:FBtr0083276[more]
bor9.519e-15947.45gene:FBgn0040237 transcript:FBtr0305998[more]
Fign4.786e-1327.69gene:FBgn0031519 transcript:FBtr0077603[more]
Fign4.786e-1327.69gene:FBgn0031519 transcript:FBtr0331372[more]
Vps42.224e-1228.57gene:FBgn0283469 transcript:FBtr0074504[more]
back to top
BLAST of ATPase family AAA domain containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atad34.839e-3248.43ATPase family AAA domain containing 3 [Source:ZFIN... [more]
vps4a1.477e-1432.02vacuolar protein sorting 4 homolog A [Source:ZFIN;... [more]
vps4b3.059e-1229.21vacuolar protein sorting 4 homolog B [Source:ZFIN;... [more]
vps4b3.308e-1229.21vacuolar protein sorting 4 homolog B [Source:ZFIN;... [more]
vps4b3.308e-1229.21vacuolar protein sorting 4 homolog B [Source:ZFIN;... [more]
back to top
BLAST of ATPase family AAA domain containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nkx3-10.000e+052.27NK3 homeobox 1 [Source:Xenbase;Acc:XB-GENE-479027][more]
nkx3-10.000e+053.44NK3 homeobox 1 [Source:Xenbase;Acc:XB-GENE-479027][more]
nkx3-10.000e+053.44NK3 homeobox 1 [Source:Xenbase;Acc:XB-GENE-479027][more]
nkx3-11.045e-17552.50NK3 homeobox 1 [Source:Xenbase;Acc:XB-GENE-479027][more]
nkx3-19.745e-17250.19NK3 homeobox 1 [Source:Xenbase;Acc:XB-GENE-479027][more]
back to top
BLAST of ATPase family AAA domain containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Atad3a4.232e-17451.32ATPase family, AAA domain containing 3A [Source:MG... [more]
Atad3a2.153e-4645.88ATPase family, AAA domain containing 3A [Source:MG... [more]
Vps4a1.642e-1432.84vacuolar protein sorting 4A [Source:MGI Symbol;Acc... [more]
Vps4b4.846e-1328.71vacuolar protein sorting 4B [Source:MGI Symbol;Acc... [more]
Vps4b4.846e-1328.71vacuolar protein sorting 4B [Source:MGI Symbol;Acc... [more]
back to top
BLAST of ATPase family AAA domain containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6PAX2|ATD3B_XENLA0.000e+052.73ATPase family AAA domain-containing protein 3-B OS... [more]
sp|Q58E76|ATD3A_XENLA0.000e+052.16ATPase family AAA domain-containing protein 3-A OS... [more]
sp|Q6NVR9|ATAD3_XENTR0.000e+052.27ATPase family AAA domain-containing protein 3 OS=X... [more]
sp|A7YWC4|ATAD3_BOVIN4.710e-18053.63ATPase family AAA domain-containing protein 3 OS=B... [more]
sp|Q925I1|ATAD3_MOUSE2.961e-17351.32ATPase family AAA domain-containing protein 3 OS=M... [more]
back to top
BLAST of ATPase family AAA domain containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A564Z0Y60.000e+057.38AAA domain-containing protein OS=Hymenolepis dimin... [more]
A0A4Z2D0760.000e+057.12ATPase family AAA domain-containing protein isofor... [more]
A0A430Q7190.000e+056.87ATPase family AAA domain-containing protein 3A/B O... [more]
A0A068WJD80.000e+057.70ATPase family AAA domain containing protein OS=Ech... [more]
A0A0R3SPC10.000e+055.25AAA domain-containing protein OS=Hymenolepis dimin... [more]
back to top
BLAST of ATPase family AAA domain containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATAD3A0.000e+052.37ATPase family AAA domain containing 3A [Source:HGN... [more]
vps4a1.567e-1530.69vacuolar protein sorting 4 homolog A [Source:NCBI ... [more]
vps4a1.703e-1530.69vacuolar protein sorting 4 homolog A [Source:NCBI ... [more]
vps4a1.790e-1530.69vacuolar protein sorting 4 homolog A [Source:NCBI ... [more]
spast5.381e-1430.54spastin [Source:NCBI gene;Acc:405851][more]
back to top
BLAST of ATPase family AAA domain containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATAD3A1.507e-17253.62ATPase family AAA domain containing 3A [Source:HGN... [more]
ENSPMAT00000003236.13.674e-1431.03pep scaffold:Pmarinus_7.0:GL477724:37443:44438:-1 ... [more]
fignl11.722e-1328.08fidgetin-like 1 [Source:ZFIN;Acc:ZDB-GENE-030131-1... [more]
spg76.301e-1227.35SPG7 matrix AAA peptidase subunit, paraplegin [Sou... [more]
yme1l1b8.343e-1226.61YME1-like 1b [Source:ZFIN;Acc:ZDB-GENE-070410-25][more]
back to top
BLAST of ATPase family AAA domain containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
YME11.474e-1529.71Catalytic subunit of i-AAA protease complex; compl... [more]
VPS41.513e-1528.02AAA-ATPase involved in multivesicular body (MVB) p... [more]
RPT12.027e-1528.46ATPase of the 19S regulatory particle of the 26S p... [more]
AFG32.933e-1326.94Mitochondrial inner membrane m-AAA protease compon... [more]
SAP14.216e-1228.25Putative ATPase of the AAA family; interacts with ... [more]
back to top
BLAST of ATPase family AAA domain containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO423502.088e-16956.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO359072.245e-1530.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO362181.007e-1228.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO314282.946e-1227.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405536.881e-1226.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ATPase family AAA domain containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATAD3A0.000e+054.83ATPase family AAA domain containing 3A [Source:NCB... [more]
ATAD3A4.176e-17853.25ATPase family AAA domain containing 3A [Source:NCB... [more]
ATAD3A8.420e-1753.40ATPase family AAA domain containing 3A [Source:NCB... [more]
vps4a1.827e-1531.53vacuolar protein sorting 4 homolog A [Source:NCBI ... [more]
fignl14.598e-1328.71fidgetin like 1 [Source:NCBI gene;Acc:101168425][more]
back to top
BLAST of ATPase family AAA domain containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000003318.10.000e+099.83SMESG000003318.1[more]
SMESG000077944.14.242e-1429.44SMESG000077944.1[more]
SMESG000009448.14.710e-1429.65SMESG000009448.1[more]
SMESG000045800.11.827e-1230.81SMESG000045800.1[more]
SMESG000027507.14.359e-1228.79SMESG000027507.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022209 ID=SMED30022209|Name=ATPase family AAA domain containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1901bp
ATTTATACCATAATCATCACTTTGTTTTAAATTTGTGAATATTTGAATAT
TTCGCGTGCCATATTATTAGCATGTCTTGGATTTTTGGTTCTGGAAAATC
AACTCCTCAAATACCCCCAGGAGCCCCTCAGCCTCCTACAGATCCAAGTA
AAGACAAAGAAAAAGAAAGTACCAAGGTAAAAGCTGGAGCTTATAGCTTT
GATTCAGCCGCACTAGAAAGAGCAGCTAAAGCTGCCAAAGATCTTGAAGC
TTCCAAATATGCACAAGAAGCTTTTAATTTGTCTAAAGAAAATGAAAGAA
CTAAACAAATAGAGTACCAAAAAGAAATCAAAGCTTATGAATTGCAATTA
GAGCACTGGAAAACCGATCAATTCAGAGTTCAAGAAGAAGAAAAACGCCG
TAGGATGGAAGAAGAAACCAAACAACAAAAAATGCGTGCAGATTACCAAG
ATCACTTAGCACGCCAGCGTAGCAATGATCAATTAACGCAACAAAGAAAA
TTTCAAGAAGAGCAATTAAGAAAACAAGAAGATTCAGTTGAAAAACAGGA
AAATCTCAAGCGTGGCACTATTGAATACCAAGCTGAATTGGCTCATCAAA
ATGCCCTTAAAGAAATTCAAGCGAAAATGGTTGGAAAAGCCAAAGCTGAA
CGTGAAAATCATGATATTCGAATGGAAAGAATGCGAGCCGAAGCTATTGA
ACACAGAGAAACCGTTCTTACATCGATCAAAAACGTTGGTGAGATTGTCG
GTACTGGTCTAAATGATTTCTTTCACGATAAAACCAAAGTAGCAACTTTA
ATCGTGGCTGTAACATTGACTGCTGGTGGAATCTCTGGAATGCGGACAAC
TTTCAGGTTCATTGAATCTCGGATTGGCAAACCGTCTCTAATTCGCGAGA
CGTCCAGGATAAATGCAATAGACTTTTTAAGGCATCCTATAAAGACTTTC
AAATCAAGAATGGATAAACCAACCGATCCATTGGCAAACATCGTGCTCAA
GCCCACATTGGAAGAACGACTTAGACGACTGGCTATAGCTACTAGACATA
CCAAGGCAAATAATGGGTTTTATAGGAACGCTTTATTATTCGGTCCTCCG
GGAACCGGTAAAACATTTTATGCGAAAAGTTTAGCAATGGCATCTAACAT
GGATTATGCAATCATGTCAGGTGGGGACGTCACTCCTTTAGGTGAACGGG
GAGTCAGTGAGATGCATAAGATATTTAACTGGGCACAGACCAGTAGAAGA
GGTTTGATGCTATTTATTGACGAAGCAGACGCTTTTCTTTACAAACGTAA
TCAAGTTCAAATTAGCGAGAATCTTCGGTCAACTTTGAATGCATTTTTAC
AACGAACTGGTGAACAATCAAAAAAGTTTATGGTTGTGTTTGCTACAAAC
GCTCCAGAGCAATTTGATTGGGCTGTAAACAGCCGTATCGATGAGGTTGT
TGAATTTCCTTTGCCAGATTTATCAGAACGAGTTCGACTCGTTCGACAAT
ATTTCTATGAATTTGTTCTGTTACCAGCGAGTAAAAATCAAAGAATTCGT
TTGGAAGGTGGAGATAAGAAGATTAACTGGGAATCTAAATGCAATCAGAT
TGCCATGATAACTGAAGGATTATCTGGGCGAGATATATCGAAAATTGCAG
TAGATTGGCAGGCATCGGCATATTCCAGTGATGATGGAGTTTTGACTGAA
TCGATGATGGATAAGATCGTGGAAGAGGCTATTGAAGGTTATAATAAGAA
AGAGGAGTGGAGAAAATATCTGTTGCCAACTGCAGTAAAAGCAGATTCCC
AACAAACCATTTTACCGCCATTAGACTCCAATCGACTCTAGTAATAATTT
TGTGAATCCGATTAGCATTTTACAAATATTATTTGTTTTACTTGAAAAAA
A
back to top

protein sequence of SMED30022209-orf-1

>SMED30022209-orf-1 ID=SMED30022209-orf-1|Name=SMED30022209-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=590bp
MSWIFGSGKSTPQIPPGAPQPPTDPSKDKEKESTKVKAGAYSFDSAALER
AAKAAKDLEASKYAQEAFNLSKENERTKQIEYQKEIKAYELQLEHWKTDQ
FRVQEEEKRRRMEEETKQQKMRADYQDHLARQRSNDQLTQQRKFQEEQLR
KQEDSVEKQENLKRGTIEYQAELAHQNALKEIQAKMVGKAKAERENHDIR
MERMRAEAIEHRETVLTSIKNVGEIVGTGLNDFFHDKTKVATLIVAVTLT
AGGISGMRTTFRFIESRIGKPSLIRETSRINAIDFLRHPIKTFKSRMDKP
TDPLANIVLKPTLEERLRRLAIATRHTKANNGFYRNALLFGPPGTGKTFY
AKSLAMASNMDYAIMSGGDVTPLGERGVSEMHKIFNWAQTSRRGLMLFID
EADAFLYKRNQVQISENLRSTLNAFLQRTGEQSKKFMVVFATNAPEQFDW
AVNSRIDEVVEFPLPDLSERVRLVRQYFYEFVLLPASKNQRIRLEGGDKK
INWESKCNQIAMITEGLSGRDISKIAVDWQASAYSSDDGVLTESMMDKIV
EEAIEGYNKKEEWRKYLLPTAVKADSQQTILPPLDSNRL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
Vocabulary: biological process
TermDefinition
GO:0007005mitochondrion organization
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000039gamma neoblast
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR039188ATAD3
IPR003593AAA+_ATPase
IPR003959ATPase_AAA_core
IPR021911DUF3523
IPR027417P-loop_NTPase
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 72..99
NoneNo IPR availableCOILSCoilCoilcoord: 135..162
NoneNo IPR availableCOILSCoilCoilcoord: 187..209
NoneNo IPR availableCOILSCoilCoilcoord: 102..123
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 292..481
e-value: 1.3E-29
score: 104.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 105..131
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..39
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 143..159
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 105..159
NoneNo IPR availablePANTHERPTHR23075:SF0ATPASE FAMILY AAA DOMAIN-CONTAINING PROTEIN 3coord: 12..565
NoneNo IPR availableCDDcd00009AAAcoord: 318..464
e-value: 6.00243E-11
score: 58.6967
IPR003593AAA+ ATPase domainSMARTSM00382AAA_5coord: 333..466
e-value: 3.8E-7
score: 39.7
IPR021911ATPase family AAA domain-containing protein 3, domain of unknown function DUF3523PFAMPF12037DUF3523coord: 26..275
e-value: 1.3E-77
score: 260.8
IPR003959ATPase, AAA-type, corePFAMPF00004AAAcoord: 338..464
e-value: 2.2E-21
score: 76.7
IPR039188ATPase family AAA domain-containing protein 3PANTHERPTHR23075PUTATIVE ATP-ASEcoord: 12..565
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 314..557