FMRFamide-activated amiloride-sensitive sodium channel

Overview
NameFMRFamide-activated amiloride-sensitive sodium channel
Smed IDSMED30022207
Length (bp)2213
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of FMRFamide-activated amiloride-sensitive sodium channel (SMED30022207) t-SNE clustered cells

Violin plots show distribution of expression levels for FMRFamide-activated amiloride-sensitive sodium channel (SMED30022207) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of FMRFamide-activated amiloride-sensitive sodium channel (SMED30022207) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for FMRFamide-activated amiloride-sensitive sodium channel (SMED30022207) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022207

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30022207SMESG000013147.1 SmedASXL_010662SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Match: del-4 (DEgenerin Like [Source:UniProtKB/TrEMBL;Acc:P91835])

HSP 1 Score: 67.781 bits (164), Expect = 1.378e-11
Identity = 85/414 (20.53%), Postives = 161/414 (38.89%), Query Frame = 1
Query:  487 FHFKKFCETTSLRGVPKIVHSQKKQFRMLWVIFVLVFFIACMTCTILLIKQYLAYDVIHQPKTSYNDPSNFPSVTFCNLRPFSSRTVELLKRSNIKSLVDFLHGFGRSVVMNSSIMLNLTSEDKQXXXXXXXXXXXXXXXXXSISKESIGHSQNSMIIDCSIQYANGSEISSTKCELGGKWILTKNELFLNCYTYTMDEKYLQTATAVDLILHVDDRLEFECPDCNQFFTASQMTGIRFSLHTAH--TYPDVILEGQNLSPGTFTDAVFYTKQWNMMQPPYGKCSKTLVEKYAFEEGDFLYSLKGCQKYTIQNLLYDNCGCIKYTNIPKRFAHLNKSQDICNFFEYSVFKNVSKYKLDLNNVKFFLNRTKCKKIISHRFLNDFST-----CTNPCQYYTFDVKVSSGIYPTKSF 1707
            + F  F   TS  GVP I  +  +  R  W++ V+V     +   I L+  YL++ V  +    + +   FP+VT C+L P+     + +   ++ +L+D  +    S      +  +LT++ +Q  +    +    +N         I +S + M++ C+         ++  C +   +    N  + NC  +  D  Y  +       L +  R      D + +   ++ +G+   +H      YPDV   G    PGT +       Q   +  PYG C+     K     G   Y+++ C +  +Q  +  +CGC                     +  YS   N ++Y    N V+  L+   C  +I+     +F       C  PC+  ++ V VS+  +P+ S+
Sbjct:   10 YVFTDFSCWTSTHGVPHIGMANARWLRAFWILVVVVSIALFIWQFITLLTNYLSFSVNTETTLQFAE-RTFPTVTICHLNPWKLSETKSVD-PDMSALIDAYNSDSSSAQFG--LPASLTADRQQQASKWTLMYSERLNEKQYNDAADIAYSYDDMVVSCT--------YNAKTCNI-TDFNDFYNPSYGNCLQFNTDGMYSSSRAGPLYGLRMVMRT-----DQDTYLPWTEASGVIIDIHMQDEIPYPDVF--GYFAPPGTASSLGVSYVQTTRLSKPYGSCTTKTKLKTTHYTG--TYTVEACFRSCMQEKIIASCGCY--------------------YPAYSHASNTTQYVSCDNGVQ-TLSNLNCVDLINSADSTEFDVLTDCDCPQPCEIDSYGVTVSTAQWPSDSY 380          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Match: unc-105 (Degenerin-like protein unc-105 [Source:UniProtKB/Swiss-Prot;Acc:Q09274])

HSP 1 Score: 64.3142 bits (155), Expect = 2.264e-10
Identity = 57/264 (21.59%), Postives = 107/264 (40.53%), Query Frame = 1
Query:  919 SKESIGHSQNSMIIDCSIQYANGSEISSTKCELGGKWILTKNELFLNCYTYTMDEKYLQTATAVDLILHVDDRLEFEC-PDCNQFFTASQMTGIRFSLHTAHTYPDVILEGQNLSPGTFTDAVFYTKQWNMMQPPYGKCSKTLVEKYAFEEGDFLYSLKGCQKYTIQNLLYDNCGCI-KYTNIPKRFAHLNKSQDICNFFEYSVFKNVSKYKLDLNNVKFFLNRTKCKKIISHRFLNDFSTCTNPCQYYTFDVKVSSGIYPTKS 1704
            +KES+ +  + +++ CS    +        C++   + L  +  F NCYT+     Y +TA         +  L      + +++   ++  G R ++H  H  P     G +   G  +      KQ+  ++PPYG C     +   F    F YS++ C +   Q ++ + CGC      + + F +  K     N  +    +N + +  +L         +K K+ I    + D   C  PCQ   ++V  SS  +P+ S
Sbjct:  405 AKESMSYELDELVLKCSFNQKD--------CQMDRDFTLHYDNTFGNCYTFN----YNRTAEVASHRAGANYGLRVLLYANVSEYLPTTEAVGFRITVHDKHIVPFPDAFGYSAPTGFMSSFGVRMKQFIRLEPPYGHCRHGGEDAATFVYTGFQYSVEACHRSCAQKVIVEACGCADPMYPVAEMFGNNTKPCQAVNMDQRECLRNTTLWLGEL--------YSKGKEAI----IPD-CYCHQPCQETNYEVTYSSARWPSGS 643          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Match: unc-105 (Degenerin-like protein unc-105 [Source:UniProtKB/Swiss-Prot;Acc:Q09274])

HSP 1 Score: 64.3142 bits (155), Expect = 2.264e-10
Identity = 57/264 (21.59%), Postives = 107/264 (40.53%), Query Frame = 1
Query:  919 SKESIGHSQNSMIIDCSIQYANGSEISSTKCELGGKWILTKNELFLNCYTYTMDEKYLQTATAVDLILHVDDRLEFEC-PDCNQFFTASQMTGIRFSLHTAHTYPDVILEGQNLSPGTFTDAVFYTKQWNMMQPPYGKCSKTLVEKYAFEEGDFLYSLKGCQKYTIQNLLYDNCGCI-KYTNIPKRFAHLNKSQDICNFFEYSVFKNVSKYKLDLNNVKFFLNRTKCKKIISHRFLNDFSTCTNPCQYYTFDVKVSSGIYPTKS 1704
            +KES+ +  + +++ CS    +        C++   + L  +  F NCYT+     Y +TA         +  L      + +++   ++  G R ++H  H  P     G +   G  +      KQ+  ++PPYG C     +   F    F YS++ C +   Q ++ + CGC      + + F +  K     N  +    +N + +  +L         +K K+ I    + D   C  PCQ   ++V  SS  +P+ S
Sbjct:  405 AKESMSYELDELVLKCSFNQKD--------CQMDRDFTLHYDNTFGNCYTFN----YNRTAEVASHRAGANYGLRVLLYANVSEYLPTTEAVGFRITVHDKHIVPFPDAFGYSAPTGFMSSFGVRMKQFIRLEPPYGHCRHGGEDAATFVYTGFQYSVEACHRSCAQKVIVEACGCADPMYPVAEMFGNNTKPCQAVNMDQRECLRNTTLWLGEL--------YSKGKEAI----IPD-CYCHQPCQETNYEVTYSSARWPSGS 643          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Match: unc-105 (Degenerin-like protein unc-105 [Source:UniProtKB/Swiss-Prot;Acc:Q09274])

HSP 1 Score: 64.3142 bits (155), Expect = 2.527e-10
Identity = 57/264 (21.59%), Postives = 107/264 (40.53%), Query Frame = 1
Query:  919 SKESIGHSQNSMIIDCSIQYANGSEISSTKCELGGKWILTKNELFLNCYTYTMDEKYLQTATAVDLILHVDDRLEFEC-PDCNQFFTASQMTGIRFSLHTAHTYPDVILEGQNLSPGTFTDAVFYTKQWNMMQPPYGKCSKTLVEKYAFEEGDFLYSLKGCQKYTIQNLLYDNCGCI-KYTNIPKRFAHLNKSQDICNFFEYSVFKNVSKYKLDLNNVKFFLNRTKCKKIISHRFLNDFSTCTNPCQYYTFDVKVSSGIYPTKS 1704
            +KES+ +  + +++ CS    +        C++   + L  +  F NCYT+     Y +TA         +  L      + +++   ++  G R ++H  H  P     G +   G  +      KQ+  ++PPYG C     +   F    F YS++ C +   Q ++ + CGC      + + F +  K     N  +    +N + +  +L         +K K+ I    + D   C  PCQ   ++V  SS  +P+ S
Sbjct:  367 AKESMSYELDELVLKCSFNQKD--------CQMDRDFTLHYDNTFGNCYTFN----YNRTAEVASHRAGANYGLRVLLYANVSEYLPTTEAVGFRITVHDKHIVPFPDAFGYSAPTGFMSSFGVRMKQFIRLEPPYGHCRHGGEDAATFVYTGFQYSVEACHRSCAQKVIVEACGCADPMYPVAEMFGNNTKPCQAVNMDQRECLRNTTLWLGEL--------YSKGKEAI----IPD-CYCHQPCQETNYEVTYSSARWPSGS 605          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Match: unc-105 (Degenerin-like protein unc-105 [Source:UniProtKB/Swiss-Prot;Acc:Q09274])

HSP 1 Score: 64.3142 bits (155), Expect = 2.527e-10
Identity = 57/264 (21.59%), Postives = 107/264 (40.53%), Query Frame = 1
Query:  919 SKESIGHSQNSMIIDCSIQYANGSEISSTKCELGGKWILTKNELFLNCYTYTMDEKYLQTATAVDLILHVDDRLEFEC-PDCNQFFTASQMTGIRFSLHTAHTYPDVILEGQNLSPGTFTDAVFYTKQWNMMQPPYGKCSKTLVEKYAFEEGDFLYSLKGCQKYTIQNLLYDNCGCI-KYTNIPKRFAHLNKSQDICNFFEYSVFKNVSKYKLDLNNVKFFLNRTKCKKIISHRFLNDFSTCTNPCQYYTFDVKVSSGIYPTKS 1704
            +KES+ +  + +++ CS    +        C++   + L  +  F NCYT+     Y +TA         +  L      + +++   ++  G R ++H  H  P     G +   G  +      KQ+  ++PPYG C     +   F    F YS++ C +   Q ++ + CGC      + + F +  K     N  +    +N + +  +L         +K K+ I    + D   C  PCQ   ++V  SS  +P+ S
Sbjct:  367 AKESMSYELDELVLKCSFNQKD--------CQMDRDFTLHYDNTFGNCYTFN----YNRTAEVASHRAGANYGLRVLLYANVSEYLPTTEAVGFRITVHDKHIVPFPDAFGYSAPTGFMSSFGVRMKQFIRLEPPYGHCRHGGEDAATFVYTGFQYSVEACHRSCAQKVIVEACGCADPMYPVAEMFGNNTKPCQAVNMDQRECLRNTTLWLGEL--------YSKGKEAI----IPD-CYCHQPCQETNYEVTYSSARWPSGS 605          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: ASIC1 (acid sensing ion channel subunit 1 [Source:NCBI gene;Acc:100489966])

HSP 1 Score: 51.9878 bits (123), Expect = 3.593e-6
Identity = 89/445 (20.00%), Postives = 161/445 (36.18%), Query Frame = 1
Query:  436 VDSKHQDKIQSKTAIILFHFKKFCETTSLRGVPKIVHSQK-KQFRMLWVI-FVLVFFIACMTCTILLIKQYLAYDVIHQPKTSYNDPSNFPSVTFCNLRPFSSRTV---ELLKRSNIKSLVDFLHGFGRSVVMNSSIMLNLTSEDKQXXXXXXXXXXXXXXXXXSISKESIGHSQNSMIIDCSIQYANGSEISSTKCELGGKWILTKNELFLNCYTYTMDEK------YLQTATAVDLILHVDDRLEFECPDCNQFFTASQMTGIRFSLHTAHTYPDVILEGQNLSPGTFTDAVFYTKQWNMMQPPYGKCSKTLVEKYAFEEGDFLYSLKGCQKYTIQNLLYDNCGCIKYTNIPKRFAHLNKSQDICNFFEYSVFKNVSKYKLDLNNVKFFLNRTKCKKIISHRFLNDFSTCTNPCQYYTFDVKVSSGIYPTKSFHLYFTKNIQK 1737
            +D K  +++ S   + +   + F   ++L G+  I   ++    R++WV+ F+    +    CT  +I  Y  Y  + +          FP+VTFCNL  F    V   +L     + SL++  +    S + +  +M  L  +DK    +       +         +  GH    M++ C  +   G E S           +     +  CYT+             +  T   L L +D + +   P   +    S   GI+  +H+    P +   G  ++PG  T      ++   + PP+G C  + ++   F+     YS+  C+       L +NC C        R  H+      C      ++K  +   LD     F + +            NDF  C  PC    +  ++S    P+K+   Y  K   K
Sbjct:    1 MDVKEAEELGSPQPLSV---QAFASGSTLHGLAHIFTYERFSCRRLIWVLCFLGSLSLLLYVCTERII-YYFEYPHVTKLDEISTPRMIFPAVTFCNLNEFRFSRVTKNDLYHAGELLSLLNNRYELPDSQLADEKVMEIL--QDKANFRNFKPKPFNMREFY-----DRTGHDIREMLLSCKYR---GEECSVDD-------FVPVFTRYGKCYTFNSGRNGRSPLVTTKGGTGNGLELMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVSCQEQRLTYLPPPWGDCKSSAMDSEFFD----TYSISACRIDCETRYLVENCNC--------RMVHMPGDAAYCT---PELYKECADPALD-----FLVEKD-----------NDFCVCETPCNMTRYGKELSMVKIPSKASARYLAKKYNK 393          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|Q09274|UN105_CAEEL (Degenerin-like protein unc-105 OS=Caenorhabditis elegans OX=6239 GN=unc-105 PE=1 SV=3)

HSP 1 Score: 64.3142 bits (155), Expect = 2.880e-9
Identity = 57/264 (21.59%), Postives = 107/264 (40.53%), Query Frame = 1
Query:  919 SKESIGHSQNSMIIDCSIQYANGSEISSTKCELGGKWILTKNELFLNCYTYTMDEKYLQTATAVDLILHVDDRLEFEC-PDCNQFFTASQMTGIRFSLHTAHTYPDVILEGQNLSPGTFTDAVFYTKQWNMMQPPYGKCSKTLVEKYAFEEGDFLYSLKGCQKYTIQNLLYDNCGCI-KYTNIPKRFAHLNKSQDICNFFEYSVFKNVSKYKLDLNNVKFFLNRTKCKKIISHRFLNDFSTCTNPCQYYTFDVKVSSGIYPTKS 1704
            +KES+ +  + +++ CS    +        C++   + L  +  F NCYT+     Y +TA         +  L      + +++   ++  G R ++H  H  P     G +   G  +      KQ+  ++PPYG C     +   F    F YS++ C +   Q ++ + CGC      + + F +  K     N  +    +N + +  +L         +K K+ I    + D   C  PCQ   ++V  SS  +P+ S
Sbjct:  405 AKESMSYELDELVLKCSFNQKD--------CQMDRDFTLHYDNTFGNCYTFN----YNRTAEVASHRAGANYGLRVLLYANVSEYLPTTEAVGFRITVHDKHIVPFPDAFGYSAPTGFMSSFGVRMKQFIRLEPPYGHCRHGGEDAATFVYTGFQYSVEACHRSCAQKVIVEACGCADPMYPVAEMFGNNTKPCQAVNMDQRECLRNTTLWLGEL--------YSKGKEAI----IPD-CYCHQPCQETNYEVTYSSARWPSGS 643          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|Q25011|FANA_CORAP (FMRFamide-activated amiloride-sensitive sodium channel OS=Cornu aspersum OX=6535 PE=2 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 8.122e-9
Identity = 64/298 (21.48%), Postives = 115/298 (38.59%), Query Frame = 1
Query:  526 GVPKIVHSQKKQFRMLWVIFVLVFFIACMTCTILLIKQYLAYDVIHQPKTSYNDPSNFPSVTFCNLRPFSSRTVELL----KRSNIKSLVDFLHGFG--RSVVMNS--SIMLNLTSEDKQXXXXXXXXXXXXXXXXXSISKESIGHSQNSMIIDCSIQYANGSEISSTKCELGGKWILTKNELFLNCYTYTMDEKYLQTAT----AVDLILHV--DDRLEFECPDCNQFFTASQMTGIRFSLHTAHTYPDVILEGQNLSPGTFTDAVFYTKQWNMMQPPYGKCSKTLVE-----KYAF 1362
            G+ KIV S+  + +++W + V+  F A      LL+++YL + V+   +   + P  +PSV+ CN+ P S RT+  +    +  N+ + + F+  F   +   MNS  +   NL  + K+                       + H+   M++ C          +   C +           F NC+T+   ++    AT     + LI  V  DD L       N         G+R  +H   + P  +  G ++ PG  +           +  PYG C+  ++      KY F
Sbjct:   54 GLAKIVTSRDTKRKVIWALLVIAGFTAATLQLSLLVRKYLQFQVVELSEIKDSMPVQYPSVSICNIEPISLRTIRRMYFNNESQNLITWLRFIQKFRFEQDSFMNSIRAFYENLGQDAKK-----------------------LSHNLEDMLMHC--------RFNRELCHVSNFSTFFDGNYF-NCFTFNSGQRLQMHATGPENGLSLIFSVEKDDPLPGTYGVYNFDNNILHSAGVRVVVHAPGSMPSPVDHGIDIPPGYSSSVGLKAILHTRLPYPYGNCTNDMLNGIKQYKYTF 319          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|Q60NC0|MEC10_CAEBR (Degenerin mec-10 OS=Caenorhabditis briggsae OX=6238 GN=mec-10 PE=3 SV=2)

HSP 1 Score: 56.9954 bits (136), Expect = 5.823e-7
Identity = 25/89 (28.09%), Postives = 47/89 (52.81%), Query Frame = 1
Query:  481 ILFHFKKFCETTSLRGVPKIVHSQKKQFRMLWVIFVLVFFIACMTCTILLIKQYLAYDVIHQPKTSYNDPSNFPSVTFCNLRPFSSRTV 747
            I +H ++FC  TS  G+P +  +    +R +WV  +L+  I  +   + +I++Y   D I   +  + D + FP++T CNL P+    +
Sbjct:   96 IRWHLQQFCYKTSSHGIPMLGQAPNSLYRAVWVFLLLICAIQFINQAVAVIQKYQKMDKITDIQLKF-DTAPFPAITLCNLNPYKDSVI 183          

HSP 2 Score: 54.6842 bits (130), Expect = 2.700e-6
Identity = 46/235 (19.57%), Postives = 88/235 (37.45%), Query Frame = 1
Query: 1009 CELGGKWILTKNELFLNCYTYTMDEKYLQTATAVDLILHVDDRLEFECPDCNQFFTASQMTGIRFSLHTAHTYPDVILEGQNLSPGTFTDAVFYTKQWNMMQPPYGKCSKTLVEKYAFEEGDFLYSLKGCQKYTIQNLLYDNCGCIKYTNIPKRFAHLNKSQDICNFFEYSVFKNVSKYKLDLNNVKFFLNRTKCKKIISHRFLNDFSTCTNPCQYYTFDVKVSSGIYPTKSFHL 1713
            C++   + L  +  F NC+ +  D +  +++        +   L     D   +   S+  GIR ++H    +P     G +   G  +      K+ + +  PYG C +         +G + YS +GC +   Q L+ D CGC        RF  +   Q  C  F  +  + + K+   +  +       KC+             C  PC    +    S  I+P+++ ++
Sbjct:  417 CDIDKDFELVADPTFGNCFVFNHDREIFKSSVRAGPQYGLRVMLFVNASD---YLPTSEAVGIRLTIHDKDDFPFPDTFGYSAPTGYISSFGMRMKKMSRLPAPYGDCVEDGTTSNYIYKG-YAYSTEGCYRTCFQELIIDRCGCSD-----PRFPSIGGVQP-CQVFNKNHRECLEKHTHQIGEIH---GSFKCR-------------CQQPCNQTIYTTSYSEAIWPSQALNI 625          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|P34886|MEC10_CAEEL (Degenerin mec-10 OS=Caenorhabditis elegans OX=6239 GN=mec-10 PE=1 SV=1)

HSP 1 Score: 56.225 bits (134), Expect = 9.015e-7
Identity = 25/89 (28.09%), Postives = 46/89 (51.69%), Query Frame = 1
Query:  481 ILFHFKKFCETTSLRGVPKIVHSQKKQFRMLWVIFVLVFFIACMTCTILLIKQYLAYDVIHQPKTSYNDPSNFPSVTFCNLRPFSSRTV 747
            I +H ++FC  TS  G+P +  +    +R  WV  +L+  I  +   + +I++Y   D I   +  + D + FP++T CNL P+    +
Sbjct:   93 IRWHLQQFCYKTSSHGIPMLGQAPNSLYRAAWVFLLLICAIQFINQAVAVIQKYQKMDKITDIQLKF-DTAPFPAITLCNLNPYKDSVI 180          

HSP 2 Score: 55.0694 bits (131), Expect = 2.035e-6
Identity = 46/235 (19.57%), Postives = 88/235 (37.45%), Query Frame = 1
Query: 1009 CELGGKWILTKNELFLNCYTYTMDEKYLQTATAVDLILHVDDRLEFECPDCNQFFTASQMTGIRFSLHTAHTYPDVILEGQNLSPGTFTDAVFYTKQWNMMQPPYGKCSKTLVEKYAFEEGDFLYSLKGCQKYTIQNLLYDNCGCIKYTNIPKRFAHLNKSQDICNFFEYSVFKNVSKYKLDLNNVKFFLNRTKCKKIISHRFLNDFSTCTNPCQYYTFDVKVSSGIYPTKSFHL 1713
            C++   + L  +  F NC+ +  D +  +++        +   L     D   +   S+  GIR ++H    +P     G +   G  +      K+ + +  PYG C +         +G + YS +GC +   Q L+ D CGC        RF  +   Q  C  F  +  + + K+   +  +       KC+             C  PC    +    S  I+P+++ ++
Sbjct:  417 CDIDQDFELVADPTFGNCFVFNHDREIFKSSVRAGPQYGLRVMLFVNASD---YLPTSEAVGIRLTIHDKDDFPFPDTFGYSAPTGYISSFGMRMKKMSRLPAPYGDCVEDGATSNYIYKG-YAYSTEGCYRTCFQELIIDRCGCSD-----PRFPSIGGVQP-CQVFNKNHRECLEKHTHQIGEIH---GSFKCR-------------CQQPCNQTIYTTSYSEAIWPSQALNI 625          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|P24612|MEC4_CAEEL (Degenerin mec-4 OS=Caenorhabditis elegans OX=6239 GN=mec-4 PE=1 SV=3)

HSP 1 Score: 55.8398 bits (133), Expect = 1.194e-6
Identity = 32/102 (31.37%), Postives = 55/102 (53.92%), Query Frame = 1
Query:  481 ILFHFKKFCETTSLRGVPKIVHSQKKQFRMLWVIFVLVFFIACMTCTIL----LIKQYLAYDVIHQPKTSYNDPSNFPSVTFCNLRPFSSR---TVELLKRS 765
            + +HFK+FC  TS  G+P I  +    +R +WV    V F+ CM    L    ++ +Y   + I   +  + D + FP++T CNL P+ +    +V+L+KR+
Sbjct:   80 LAWHFKEFCYKTSAHGIPMIGEAPNVYYRAVWV----VLFLGCMIMLYLNAQSVLDKYNRNEKIVDIQLKF-DTAPFPAITLCNLNPYKASLATSVDLVKRT 176          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A0R3SU47 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS8992 PE=3 SV=1)

HSP 1 Score: 328.946 bits (842), Expect = 1.092e-99
Identity = 198/553 (35.80%), Postives = 296/553 (53.53%), Query Frame = 1
Query:  439 DSKHQDKIQSKTAIILFHFKKFCETTSLRGVPKIVHSQKKQFRMLWVIFVLVFFIACMTCTILLIKQYLAYDVIHQPKTSYNDPSNFPSVTFCNLRPFSSRTVE-LLKRSN--IKSLVDFLHGFGRSVVMN-SSIMLNLTSEDKQXXXXXXXXXXXXXXXXXSISKESIGHSQNSMIIDCSIQYANGSEISSTKCELGGKWILTKNELFLNCYTYTMDEKYLQTATAVDLILHVDDRLEF-ECPDCNQFFTASQMTGIRFSLHTAHTYPDVILEGQNLSPGTFTDAVFYTKQWNMMQPPYGKCSKTLVEKYAFEEGDFLYSLKGCQKYTIQNLLYDNCGCIKYTNIPKRFAHLNKSQDICNFFEYSVF-------KNVSKYKLDLNNVKFFLNRTKCKKIISHRFLNDFSTCTNPCQYYTFDVKVSSGIYPTKSFHLYFTKNIQKILIRKIRNSSKIEDMN--------ELKSILHKFKIYDEISRKIKNGSIAEAEKLLKNTDVIEKNFLTIQINRQDFXXXXXXXXXXXXXTSFLSQTGGMFSIWSGITFF 2037
            D  H D+ +SK   I   F +FCE TSLRGVP+IV +  ++ R+LW  FV +FFI C+ C IL+ KQYL YDVIHQPKT ++ P  FPS+T CNLRPF S  V+ L+ R    +++  D +    R +  N +S   NL S +            +L+NLP  +    +GH    ++  C++ Y NG+    T C   G+WI T + ++ NCYT+ +D+++  +  +++++L++D+ +E   C DC      SQ+TG R  L+ A +YP +I EG NL PGT TD  F   +W+MM  PYG+CS    ++  F   ++ Y+ K C +  +Q +  + CGC+ Y ++P      N S   C +FE  V        + + K       VK F+NR  C   I+   L   + C  PC  YT++ ++S+  +PTK F   F     K   +K   +S +   N        E    L   + Y EI R   NGS +EA + L     +E+NFL+I ++R  F II+ EEK V+++TS  SQ GG+ SIW GIT  
Sbjct:   26 DFAHIDRTKSKFKQIYQLFIQFCENTSLRGVPRIVQASDRRKRLLWSNFVFIFFIGCIACLILITKQYLQYDVIHQPKTIFDAPRAFPSLTICNLRPFKSSDVDRLISRGAVPVETYFDAILNVARHLDKNYASQFTNLLSLES-----------YLLNLPEGMDPNDLGHHLEQLVRTCTVLYQNGTSTRGTSCNRAGRWIKTMDRIYHNCYTFELDDRFRTSTISIEMVLYLDNIVEHTSCFDCQDRIRGSQLTGARLLLNPASSYPRIIEEGINLMPGTLTDIHFTVHEWSMMTSPYGRCSHEAPKEICFAGQNYTYTEKACHQDVLQEMCAEQCGCLLY-DMPVPCRLTNASFPYCQYFELPVVNISSRKGEEIRKMYFSEEAVKRFVNRMNCSSTITRNTLTTETGCQVPCIRYTYETQISTAQWPTKRFITNFATTQMKKNTKKKNQTSNLYGPNVNNEIEIFEETRFLELLRPYTEIRRMTSNGSESEALERLMRLQNVEQNFLSIIVSRPAFDIIRTEEKAVVTLTSLFSQIGGLLSIWVGITMI 566          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A4S2KXN9 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010535 PE=3 SV=1)

HSP 1 Score: 329.331 bits (843), Expect = 2.922e-99
Identity = 189/533 (35.46%), Postives = 303/533 (56.85%), Query Frame = 1
Query:  490 HFKKFCETTSLRGVPKIVHSQKKQFRMLWVIFVLVFFIACMTCTILLIKQYLAYDVIHQPKTSYNDPSNFPSVTFCNLRPFSSRTVELLKRSNIKSLVDFLHGFGRSVVMNSSIMLNLTSEDKQXXXXXXXXXXXXXXXXXSISKESIGHSQNSMIIDCSIQYANGSEISSTKCELGGKWILTKNELFLNCYTYTMDEKYLQTATAVDLILHVDDRLE-FECPDCNQFFTASQMTGIRFSLHTAHTYPDVILEGQNLSPGTFTDAVFYTKQWNMMQPPYGKCSKTLVEKYAFEEGDFLYSLKGCQKYTIQNLLYDNCGCIKYTNIPKRFAHLNKSQDICNFFEYSV-------FKNVSKYKLDLNNVKFFLNRTKCKKIISHRFLNDFSTCTNPCQYYTFDVKVSSGIYPTKSFHLYF-TKNIQKILIRKIRNSSKI---------EDMNELKSILHKFKIYDEISRKIKNGSIAEAEKLLKNTDVIEKNFLTIQINRQDFXXXXXXXXXXXXXTSFLSQTGGMFSIWSGITF 2034
             FK+FCETTSLRGVP+IV ++  + R+LW+IFVL FF+ C+TC I LI QYLAYDVIHQPK  Y+ P +FPSVT CNLRPFS+R +  LK + +  +  +     R       ++ ++  E+++ +T    +  +L NLP ++ + ++GHS++ ++  C I Y  G+    T CE  G W  T++ +F NCYTYT+ +        +++++++D+ +E  +C DC +   ASQ+TG R  LH   +YP V  EG NL PGT TD  F   +W+MM+PP+G+CS +      F   ++ YS + C K+  Q  +   C C+   ++P     L+K  + C  F +         F    +   + +++   +  ++C + I  +  +  + C   C  YT+   +++  +PTK+F  +F TK +++I    IR    +         E ++EL+ +L     Y+EI    + G  AEA + L +T++ E+NFL I I+R +F + +VEEK V+S+TS  SQ GG+ SIW G+TF
Sbjct:   90 QFKQFCETTSLRGVPRIVSTKDTKRRLLWLIFVLAFFVGCITCLIFLINQYLAYDVIHQPKKLYDLPKSFPSVTICNLRPFSTRDIRKLKAAGVVPVDMYFDNIQR-------MIPHVRPENRRYMTMLWTMSAYLYNLPETLDEYALGHSKHDIVKRCYIVYKRGTMNRGTDCESSGYWTKTRDPVFHNCYTYTVFQNLTDQVLNMEMVVYLDNLVEQTDCFDCQERVRASQLTGARLLLHPRASYPRVAEEGINLMPGTMTDIRFSVYEWSMMEPPHGRCSTSTPASINFNRVNYSYSEEACHKHVRQLKVVQTCNCLT-QSLPIPTELLDKKLERCEAFRFPATIDLFNNFNTTKQSYFNDDSIARLVQSSRCAEEILTKLDSSATGCRPACVRYTYRPSITAAQWPTKTFLTWFVTKFLKRITTATIRGRPHMTEAEQVRVQESLDELQELLSP---YEEILNLTRTGKQAEAIQKLMSTEIFERNFLAIVISRPNFDVERVEEKAVVSLTSLFSQIGGLLSIWVGLTF 611          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: G7YD97 (FMRFamide-activated amiloride-sensitive sodium channel OS=Clonorchis sinensis OX=79923 GN=CLF_105251 PE=3 SV=1)

HSP 1 Score: 325.479 bits (833), Expect = 6.034e-98
Identity = 188/536 (35.07%), Postives = 302/536 (56.34%), Query Frame = 1
Query:  481 ILFHFKKFCETTSLRGVPKIVHSQKKQFRMLWVIFVLVFFIACMTCTILLIKQYLAYDVIHQPKTSYNDPSNFPSVTFCNLRPFSSRTVELLKRSNIKSLVDFLHGFGRSVVMNSSIMLNLTSEDKQXXXXXXXXXXXXXXXXXSISKESIGHSQNSMIIDCSIQYANGSEISSTKCELGGKWILTKNELFLNCYTYTMDEKYLQTATAVDLILHVDDRLE-FECPDCNQFFTASQMTGIRFSLHTAHTYPDVILEGQNLSPGTFTDAVFYTKQWNMMQPPYGKCSKTLVEKYAFEEGDFLYSLKGCQKYTIQNLLYDNCGCIKYTNIPKRFAHLNKSQDICNFFEYSV-------FKNVSKYKLDLNNVKFFLNRTKCKKIISHRFLNDFSTCTNPCQYYTFDVKVSSGIYPTKSFHLYF-TKNIQKILIRKIRNSSKI---------EDMNELKSILHKFKIYDEISRKIKNGSIAEAEKLLKNTDVIEKNFLTIQINRQDFXXXXXXXXXXXXXTSFLSQTGGMFSIWSGITF 2034
            I   FK+FCETTSLRGVP+IV ++  + R+LW+IFVL FF+ C+TC I LI QYLAYDVIHQPK  Y+ P +FPSVT CNLRPFS++ +  LK + +  +  +     R       ++  +  E+++ +T    +  +L NLP ++ + ++GHS++ ++  C I Y  G+    T CE  G W  T++ +F NCYTYT+ +        +++++++D+ +E  +C DC +   ASQ+TG R  LH   +YP V  EG NL PGT TD  F   +W+MM+PP+G+CS +      F   ++ YS + C K+  Q  +   C C+  + +P     L++  + C  F +         F    +   +  ++   +  ++C + I  +  +  + C   C  YT+   +++  +PTK+F  +F TK +++I    IR    +         E ++EL+ +L     Y+EI    + G  AEA + L +T++ E+NFL I I+R +F + +VEEK V+S+TS  SQ GG+ SIW G+TF
Sbjct:   81 IRGQFKQFCETTSLRGVPRIVSTKDTKRRLLWLIFVLAFFVGCITCLIFLINQYLAYDVIHQPKKLYDLPRSFPSVTICNLRPFSTKDIRKLKAAGVVPVDMYFDNIQR-------MIPQVRPENRRYMTMLWTMSAYLYNLPETLDESALGHSKHDIVKRCYIVYKRGTMNRGTDCESSGYWTKTRDPVFHNCYTYTIFQNLTNQVLNMEMVVYLDNLVEQTDCFDCQERVRASQLTGARLLLHPRASYPRVAEEGINLMPGTMTDIRFSVYEWSMMEPPHGRCSTSTPVSINFNHVNYSYSEEACHKHVRQLKVVQTCNCLTQS-LPIPTELLDRKLNRCEAFRFPATIDLSDNFNMTKQSYFNDESIARLVQSSRCAEEILTKLDSSATGCRPACVRYTYRPSITAAQWPTKTFLTWFVTKFLKRITTATIRGRPHMTEAEQVRVQESLDELQELLSP---YEEILNLTRAGKQAEAIQKLMSTEIFERNFLAIVISRPNFDVERVEEKAVVSLTSLFSQIGGLLSIWVGLTF 605          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: G4V8Q7 (Putative amiloride-sensitive sodium channel OS=Schistosoma mansoni OX=6183 GN=Smp_093210 PE=3 SV=1)

HSP 1 Score: 319.316 bits (817), Expect = 2.480e-95
Identity = 191/525 (36.38%), Postives = 292/525 (55.62%), Query Frame = 1
Query:  490 HFKKFCETTSLRGVPKIVHSQKKQFRMLWVIFVLVFFIACMTCTILLIKQYLAYDVIHQPKTSYNDPSNFPSVTFCNLRPFSSRTVELLKRSNIKSLVDFLHGFGRSVVMNSSIMLNLTSEDKQXXXXXXXXXXXXXXXXXSISKESIGHSQNSMIIDCSIQYANGSEISSTKCELGGKWILTKNELFLNCYTYTMDEKYLQTATAVDLILHVDDRLE-FECPDCNQFFTASQMTGIRFSLHTAHTYPDVILEGQNLSPGTFTDAVFYTKQWNMMQPPYGKCSKTLVEKYAFEEGDFLYSLKGCQKYTIQNLLYDNCGCI-KYTNIPKRFAHLNKSQDICNFFE----YSVFKNVSKYK-LDLNN--VKFFLNRTKCKKIISHRFLNDFSTCTNPCQYYTFDVKVSSGIYPTKSFHLYFTKNIQKILIRKIRNSSKIEDMNE-LKSILHKFKIYDEISRKIKNGSIAEAEKLLKNTDVIEKNFLTIQINRQDFXXXXXXXXXXXXXTSFLSQTGGMFSIWSGITF 2034
             F++FCETTSLRGVP+IV ++  + R LW+IFV+ FFI C+TC   +I QYL +DVIHQPK  Y+ P  FPSVT CNLRPFS+R +  LK++ +  +  +     R        M+++  E ++ LT       +L NLP  +   ++GH+   ++  C I Y  GS    T CE  G W  T++ +F NCYTYT++     TA  ++L++++D+ +E  +C DC +   ASQ+TG R  LH   +YP V  EG NL PGT TD  F   +W+MM+PP+G+CSK   +  +F   ++ +S + C  + +Q  +  NC C+ ++  IP     L K    C  F+    Y +  N ++ K L  NN  V  +    +C +       +    C   C  YT+   +++  +PTK+F  +F        + K  N+  +   NE ++ I    + Y+ I+   K G + EA K+L  T + E+NFL+I I+R +F + +VEEK V+S+TS  SQ GG+ SIW G+TF
Sbjct:  111 QFRQFCETTSLRGVPRIVSTKDSKRRFLWLIFVISFFIGCITCLTFIINQYLEFDVIHQPKKLYDQPRPFPSVTLCNLRPFSTRDIRKLKKAEVLPVDMYFEMLKR-------FMISVPVEYRRYLTMLWDFSTYLANLPDLVDANNLGHTLEDIVKRCFILYKTGSVTRGTACEKSGYWTKTQDRVFHNCYTYTINPNKTNTALNMELVVYLDNLIEQTDCFDCQERVMASQLTGARLLLHPGASYPRVAEEGVNLMPGTMTDIRFTVYEWSMMEPPHGRCSKNTPQFISFNNVNYTFSEEACHAHMVQEKVASNCQCLTQHLPIPTHL--LGKDLRKCQAFKLPATYQMLDNFNESKQLYFNNEAVSTYARFAECAEKTGTAMDSYQIGCRPACVRYTYKPSITAAQWPTKTFLTWF--------VTKSTNNETLSIFNERMEEIRKPLQPYEIIANLTKEGRLQEAIKMLMQTQIFEQNFLSIIISRPNFDLERVEEKAVVSLTSLFSQIGGLLSIWIGLTF 618          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A3Q0KJ87 (Putative amiloride-sensitive sodium channel OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 318.931 bits (816), Expect = 4.799e-95
Identity = 194/531 (36.53%), Postives = 298/531 (56.12%), Query Frame = 1
Query:  490 HFKKFCETTSLRGVPKIVHSQKKQFRMLWVIFVLVFFIACMTCTILLIKQYLAYDVIHQPKTSYNDPSNFPSVTFCNLRPFSSRTVELLKRSNIKSLVDFLHGFGRSVVMNSSIMLNLTSEDKQXXXXXXXXXXXXXXXXXSISKESIGHSQNSMIIDCSIQYANGSEISSTKCELGGKWILTKNELFLNCYTYTMDEKYLQTATAVDLILHVDDRLE-FECPDCNQFFTASQMTGIRFSLHTAHTYPDVILEGQNLSPGTFTDAVFYTKQWNMMQPPYGKCSKTLVEKYAFEEGDFLYSLKGCQKYTIQNLLYDNCGCI-KYTNIPKRFAHLNKSQDICNFFE----YSVFKNVSKYK-LDLNN--VKFFLNRTKCKKIISHRFLNDFSTCTNPCQYYTFDVKVSSGIYPTKSFHLYF-TKNIQKILIR-----KIRNSSKIEDMNE-LKSILHKFKIYDEISRKIKNGSIAEAEKLLKNTDVIEKNFLTIQINRQDFXXXXXXXXXXXXXTSFLSQTGGMFSIWSGITF 2034
             F++FCETTSLRGVP+IV ++  + R LW+IFV+ FFI C+TC   +I QYL +DVIHQPK  Y+ P  FPSVT CNLRPFS+R +  LK++ +  +  +     R        M+++  E ++ LT       +L NLP  +   ++GH+   ++  C I Y  GS    T CE  G W  T++ +F NCYTYT++     TA  ++L++++D+ +E  +C DC +   ASQ+TG R  LH   +YP V  EG NL PGT TD  F   +W+MM+PP+G+CSK   +  +F   ++ +S + C  + +Q  +  NC C+ ++  IP     L K    C  F+    Y +  N ++ K L  NN  V  +    +C +       +    C   C  YT+   +++  +PTK+F  +F TK I+++ +      K  N+  +   NE ++ I    + Y+ I+   K G + EA K+L  T + E+NFL+I I+R +F + +VEEK V+S+TS  SQ GG+ SIW G+TF
Sbjct:  111 QFRQFCETTSLRGVPRIVSTKDSKRRFLWLIFVISFFIGCITCLTFIINQYLEFDVIHQPKKLYDQPRPFPSVTLCNLRPFSTRDIRKLKKAEVLPVDMYFEMLKR-------FMISVPVEYRRYLTMLWDFSTYLANLPDLVDANNLGHTLEDIVKRCFILYKTGSVTRGTACEKSGYWTKTQDRVFHNCYTYTINPNKTNTALNMELVVYLDNLIEQTDCFDCQERVMASQLTGARLLLHPGASYPRVAEEGVNLMPGTMTDIRFTVYEWSMMEPPHGRCSKNTPQFISFNNVNYTFSEEACHAHMVQEKVASNCQCLTQHLPIPTHL--LGKDLRKCQAFKLPATYQMLDNFNESKQLYFNNEAVSTYARFAECAEKTGTAMDSYQIGCRPACVRYTYKPSITAAQWPTKTFLTWFVTKFIKEMELSGYSRLKSTNNETLSIFNERMEEIRKPLQPYEIIANLTKEGRLQEAIKMLMQTQIFEQNFLSIIISRPNFDLERVEEKAVVSLTSLFSQIGGLLSIWIGLTF 632          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Cavefish
Match: asic1c (acid-sensing ion channel 1C-like [Source:NCBI gene;Acc:103034544])

HSP 1 Score: 58.5362 bits (140), Expect = 1.937e-8
Identity = 92/425 (21.65%), Postives = 158/425 (37.18%), Query Frame = 1
Query:  502 FCETTSLRGVPKIVHSQKKQF-RMLWVIFVLVFFIACMTCTILLIKQYLAYDVIHQPKTSYNDPSNFPSVTFCNLRPFSSRTVELLKRSNIKSLVDFLHGFGRSVVMNSSIMLNLTSEDKQXXXXXXXXXXXXXXXXXSISKESI---GHSQNSMIIDCSIQYANGSEISSTKCELGGKWILTKNELFLNCYTYT--MDEKYLQT----ATAVDLILHVDDRLEFECPDCNQFFTASQMTGIRFSLHTAHTYPDVILEGQNLSPGTFTDAVFYTKQWNMMQ---PPYGKCSKTLVEKYAFEEGDFLYSLKGCQKYTIQNLLYDNCGCIKYTNIPKRFAHLNKSQDICNFFEYSVFKNVSKYKLDLNNVKFFLNRTKCKKIISHRFLNDFSTCTNPCQYYTFDVKVSSGIYPTKSFHLYFTKNIQK 1737
            F   T + G+  +    K +  R LW++ + V      T +   I   ++Y  + +    +     FP+VT CN   F   ++      +    +D +H    SV   S  ML  +   ++L+    F            + E I   GH    M+++C  +  N S  + T        I T+   +  CYT+   +D   L T     T   L + +D + +   P        S   GI+  +H+    P +   G  ++PG  T   F + Q  ++Q   PP+G C  T ++   F      YS+  C+       L +NC C        R  H+  +  +C   +Y   K+ +   LD     F + +            ND+  C  PC    +  ++S    P+K+   Y  K   K
Sbjct:   34 FVLRTKVHGLKYVFAPGKSRIHRFLWLLAMFVCLGLLFTWSWNRILYLMSYPAVTKIYMVWAHNMTFPAVTLCNQNLFRVSSLTKADLYHSGYWMDIMH-LNHSVNRQSLAMLKHSRHRERLMRLLDFAGYSPPARHKLSTTEMISRLGHQLEDMLLECRFRGENCSFRNFTP-------IYTR---YGKCYTFNSGLDGNPLLTTLKGGTGNGLEIMLDIQQDEYLPVWGDTDETSYEAGIKVQIHSQDEPPFIDQLGFGVAPGFQT---FVSCQQQLLQYLPPPWGDCKSTPIDSEFFST----YSITACRIDCETRYLLENCNC--------RMVHMPGTSTVCTPEQY---KDCADPALD-----FLVEKD-----------NDYCVCQTPCNMTRYGKELSMVKIPSKASAKYLAKKFNK 413          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Cavefish
Match: asic1c (acid-sensing ion channel 1C-like [Source:NCBI gene;Acc:103034544])

HSP 1 Score: 55.8398 bits (133), Expect = 1.126e-7
Identity = 90/422 (21.33%), Postives = 154/422 (36.49%), Query Frame = 1
Query:  502 FCETTSLRGVPKIVHSQKKQF-RMLWVIFVLVFFIACMTCTILLIKQYLAYDVIHQPKTSYNDPSNFPSVTFCNLRPFSSRTVELLKRSNIKSLVDFLHGFGRSVVMNSSIMLNLTSEDKQXXXXXXXXXXXXXXXXXSISKESI---GHSQNSMIIDCSIQYANGSEISSTKCELGGKWILTKNELFLNCYTYT--MDEKYLQT----ATAVDLILHVDDRLEFECPDCNQFFTASQMTGIRFSLHTAHTYPDVILEGQNLSPGTFTDAVFYTKQWNMMQPPYGKCSKTLVEKYAFEEGDFLYSLKGCQKYTIQNLLYDNCGCIKYTNIPKRFAHLNKSQDICNFFEYSVFKNVSKYKLDLNNVKFFLNRTKCKKIISHRFLNDFSTCTNPCQYYTFDVKVSSGIYPTKSFHLYFTKNIQK 1737
            F   T + G+  +    K +  R LW++ + V      T +   I   ++Y  + +    +     FP+VT CN   F   ++      +    +D +H    SV   S  ML  +   ++L+    F            + E I   GH    M+++C  +  N S  + T        I T+   +  CYT+   +D   L T     T   L + +D + +   P        S   GI+  LH+    P     G  ++PG  T      ++   + PP+G C  T ++   F      YS+  C+       L +NC C        R  H+  +  +C   +Y   K+ +   LD     F + +            ND+  C  PC    +  ++S    P+K+   Y  K   K
Sbjct:   16 FVLRTKVHGLKYVFAPGKSRIHRFLWLLAMFVCLGLLFTWSWNRILYLMSYPAVTKIYMVWAHNMTFPAVTLCNQNLFRVSSLTKADLYHSGYWMDIMH-LNHSVNRQSLAMLKHSRHRERLMRLLDFAGYSPPARHKLSTTEMISRLGHQLEDMLLECRFRGENCSFRNFTP-------IYTR---YGKCYTFNSGLDGNPLLTTLKGGTGNGLEIMLDIQQDEYLPVWGDTDETSYEAGIKVQLHSQSEPPFPNELGFWVTPGFQTFVSTQEQRLQYLPPPWGDCKSTPIDSEFFST----YSITACRIDCETRYLLENCNC--------RMVHMPGTSTVCTPEQY---KDCADPALD-----FLVEKD-----------NDYCVCQTPCNMTRYGKELSMVKIPSKASAKYLAKKFNK 395          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Cavefish
Match: asic1c (acid-sensing ion channel 1C-like [Source:NCBI gene;Acc:103034544])

HSP 1 Score: 50.8322 bits (120), Expect = 4.771e-6
Identity = 90/442 (20.36%), Postives = 164/442 (37.10%), Query Frame = 1
Query:  451 QDKIQSKTAIILFHFKKFCETTSLRGVPKIVHSQKKQFR-MLWVIFVLVFFIACMTCTILLIKQYLAYDVIHQPKTSYNDPSNFPSVTFCNLRPFSSRTV---ELLKRSNIKSLVDFLHGFGRSVVMNSSIMLNLTSEDKQXXXXXXXXXXXXXXXXXSISKESIGHSQNSMIIDCSIQYANGSEISSTKCELGGKWILTKNELFLNCYTYT--MDEKYLQT----ATAVDLILHVDDRLEFECPDCNQFFTASQMTGIRFSLHTAHTYPDVILEGQNLSPGTFTDAVFYTKQWNMMQ---PPYGKCSKTLVEKYAFEEGDFLYSLKGCQKYTIQNLLYDNCGCIKYTNIPKRFAHLNKSQDICNFFEYSVFKNVSKYKLDLNNVKFFLNRTKCKKIISHRFLNDFSTCTNPCQYYTFDVKVSSGIYPTKSFHLYFTKNIQK 1737
            +D I+S   I   + + F  +++L G+  I       FR +LW +  L      +   +  +  YL +  I +          FP+VTFCNL  F    +   +L     + +L++  +      +    ++  L  +         F+        ++      GH  N M++ C+ +  +    + +        I T+   +  CYT+   +D   L T     T   L + +D + +   P        S   GI+  +H+    P +   G  ++PG  T   F + Q  ++Q   PP+G C  T ++   F      YS+  C+       L +NC C        R  H+  +  +C   +Y   K+ +   LD     F + +            ND+  C  PC    +  ++S    P+K+   Y  K   K
Sbjct:    9 EDSIES---IRPSNLQAFANSSTLHGMSHIFAYGHMTFRRLLWTLSFLGSLGLLLVVCMDRVSYYLQFPHITKLDEVAAPNLTFPAVTFCNLNEFRFSKITKNDLYHVGELLALLNENYQIANPHLAEPEVLAALKEKGN-------FVNFKPKQFNMTDFYNRTGHDINEMLLQCTFRGEDCYPFNFST-------IYTR---YGKCYTFNSGLDGNPLLTTLKGGTGNGLEIMLDIQQDEYLPVWGDTDETSYEAGIKVQIHSQDEPPFIDQLGFGVAPGFQT---FVSCQQQLLQYLPPPWGDCKSTPIDSEFFST----YSITACRIDCETRYLLENCNC--------RMVHMPGTSTVCTPEQY---KDCADPALD-----FLVEKD-----------NDYCVCQTPCNMTRYGKELSMVKIPSKASAKYLAKKFNK 396          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Cavefish
Match: asic1c (acid-sensing ion channel 1C-like [Source:NCBI gene;Acc:103034544])

HSP 1 Score: 50.447 bits (119), Expect = 5.045e-6
Identity = 90/442 (20.36%), Postives = 164/442 (37.10%), Query Frame = 1
Query:  451 QDKIQSKTAIILFHFKKFCETTSLRGVPKIVHSQKKQFR-MLWVIFVLVFFIACMTCTILLIKQYLAYDVIHQPKTSYNDPSNFPSVTFCNLRPFSSRTV---ELLKRSNIKSLVDFLHGFGRSVVMNSSIMLNLTSEDKQXXXXXXXXXXXXXXXXXSISKESIGHSQNSMIIDCSIQYANGSEISSTKCELGGKWILTKNELFLNCYTYT--MDEKYLQT----ATAVDLILHVDDRLEFECPDCNQFFTASQMTGIRFSLHTAHTYPDVILEGQNLSPGTFTDAVFYTKQWNMMQ---PPYGKCSKTLVEKYAFEEGDFLYSLKGCQKYTIQNLLYDNCGCIKYTNIPKRFAHLNKSQDICNFFEYSVFKNVSKYKLDLNNVKFFLNRTKCKKIISHRFLNDFSTCTNPCQYYTFDVKVSSGIYPTKSFHLYFTKNIQK 1737
            +D I+S   I   + + F  +++L G+  I       FR +LW +  L      +   +  +  YL +  I +          FP+VTFCNL  F    +   +L     + +L++  +      +    ++  L  +         F+        ++      GH  N M++ C+ +  +    + +        I T+   +  CYT+   +D   L T     T   L + +D + +   P        S   GI+  +H+    P +   G  ++PG  T   F + Q  ++Q   PP+G C  T ++   F      YS+  C+       L +NC C        R  H+  +  +C   +Y   K+ +   LD     F + +            ND+  C  PC    +  ++S    P+K+   Y  K   K
Sbjct:    9 EDSIES---IRPSNLQAFANSSTLHGMSHIFAYGHMTFRRLLWTLSFLGSLGLLLVVCMDRVSYYLQFPHITKLDEVAAPNLTFPAVTFCNLNEFRFSKITKNDLYHVGELLALLNENYQIANPHLAEPEVLAALKEKGN-------FVNFKPKQFNMTDFYNRTGHDINEMLLQCTFRGEDCYPFNFST-------IYTR---YGKCYTFNSGLDGNPLLTTLKGGTGNGLEIMLDIQQDEYLPVWGDTDETSYEAGIKVQIHSQDEPPFIDQLGFGVAPGFQT---FVSCQQQLLQYLPPPWGDCKSTPIDSEFFST----YSITACRIDCETRYLLENCNC--------RMVHMPGTSTVCTPEQY---KDCADPALD-----FLVEKD-----------NDYCVCQTPCNMTRYGKELSMVKIPSKASAKYLAKKFNK 396          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Sea Lamprey
Match: asic1b (acid-sensing (proton-gated) ion channel 1b [Source:NCBI gene;Acc:407672])

HSP 1 Score: 48.1358 bits (113), Expect = 6.351e-6
Identity = 80/416 (19.23%), Postives = 139/416 (33.41%), Query Frame = 1
Query:  565 RMLWVIFVLVFFIACMTCTILLIKQYLAYDVIHQPKTSYNDPSNFPSVTFCNLRPF------------SSRTVELLKRSNIKSLVDFLHGFGRSVVMNSSIMLNLTSEDKQXXXXXXXXXX-XXXXXXXSISK---ESIGHSQNSMIIDCSIQYANGSEISSTKCELGGKWILTKNELFLNCYTYTMDEKYLQTATAV------DLILHVDDRLEFECPDCNQFFTASQMTGIRFSLHTAHTYPDVILEGQNLSPGTFTDAVFYTKQWNMMQPPYGKCSKTLVEKYAFEEGDFLYSLKGCQKYTIQNLLYDNCGCIKYTNIPKRFAHLNKSQDICNFFEYSVFKNVSKYKLDLNNVKFFLNRTKCKKIISHRFL---NDFSTCTNPCQYYTFDVKVSSGIYPTKSFHLYFTKNIQK 1737
            R+LW++  +      +  +   I+  L+     +  TS+     FP+VTFCN  P             +   + LL  +  +           ++  N  +M  L+   +Q                   IS+   + +GH  + M++ C      G +             +T    +  CYT+   +      T V       L + +D + E   P   +    S   GI+  +H+    P +   G  +SPG  T      ++   + PP+G C  T +    FE     YS+  C+       L +NC C        R  H+      C   +Y                      T+C + +    +   NDF  C  PC    +  ++S    P+K+   Y  K   K
Sbjct:   29 RILWLLAFMAALGLLLAWSADRIQHLLSRPAHTRVSTSWVRGLPFPAVTFCNNNPVRFPRLTKSDLYVAGMWLGLLTHAESQQPQATFAATAANLTANPHMMAGLSEPRRQWFQRMSDFSRFLPPREAPGISQGLLDRLGHPLDEMVLSCRF---CGQDCKPQD-------FITVYTRYGKCYTFNSGKGGRPLLTTVKGGMGNGLEIMLDIQQEEYLPVWGENDETSFEAGIKVQIHSQDEPPLIDQLGFGVSPGFQTFVSCQEQRLIYLPPPWGDCKSTPISSDFFET----YSITACRIDCETRYLVENCNC--------RMVHMPGDAPYCTPEQY----------------------TECARPVLDVLVKRDNDFCLCETPCNMTRYGKELSMVKIPSKASAKYLAKKYNK 400          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Nematostella
Match: EDO34532 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP23])

HSP 1 Score: 48.9062 bits (115), Expect = 4.694e-6
Identity = 32/113 (28.32%), Postives = 55/113 (48.67%), Query Frame = 1
Query:  448 HQDKIQSKTAIILFHFKKFCETTSLRGVPKIVHSQKKQFRMLWVIFVL-VFFIACMTCTILLIKQYLAYDVIHQPKTSYNDPSNFPSVTFCNLRPFSSRTVELLKRSNIKSLV 783
            + D  ++ T   L   + F  +T+  G+ K+  +     R LW++  L V+ +    C  LL++ YL   V+ + + SY +   FP+VT CNL       V   K  +I+SL+
Sbjct:   48 NDDATKNATGGFLSLIRDFAASTTAHGIGKVFAADSMVRRALWLLGCLTVYAVMIFMCAQLLVR-YLEKPVVSRVEVSYEESLVFPAVTICNLNMLKHSKVA--KNPSIQSLM 157          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Medaka
Match: ENSORLT00000031246.1 (acid sensing ion channel subunit 1 [Source:NCBI gene;Acc:101155423])

HSP 1 Score: 61.2326 bits (147), Expect = 2.539e-9
Identity = 86/421 (20.43%), Postives = 156/421 (37.05%), Query Frame = 1
Query:  502 FCETTSLRGVPKIVHSQKKQF-RMLWVIFVLVFFIACMTCTILLIKQYLAYDVIHQPKTSYNDPSNFPSVTFCNLRPFSSRTVELLKRSNIKSLVDFLHGFGRSVVMNSSIMLNLTSEDKQXXXXXXXXXXXXXXXXXSISK--ESIGHSQNSMIIDCSIQYANGSEISSTKCELGGKWILTKNELFLNCYTYTMDEK------YLQTATAVDLILHVDDRLEFECPDCNQFFTASQMTGIRFSLHTAHTYPDVILEGQNLSPGTFTDAVFYTKQWNMMQPPYGKCSKTLVEKYAFEEGDFLYSLKGCQKYTIQNLLYDNCGCIKYTNIPKRFAHLNKSQDICNFFEYSVFKNVSKYKLDLNNVKFFLNRTKCKKIISHRFLNDFSTCTNPCQYYTFDVKVSSGIYPTKSFHLYFTKNIQK 1737
            F   ++L G+  +   ++    R LW++F ++     +   +  ++ Y  Y  + +          FP++TFCNL  F    V      +   L+  L+G  R  + +     +L  E+   +               ++ +  +  GH    M++ CS +   G+E S+       K I T+   +  CYT+   +        ++  T   L L +D + +   P   +    S   GI+  +HT    P +   G  ++PG  T      ++   + PP+G C  T ++   F      YS+  C+       L +NC C        R  H+      C+  +Y   K  +   LD     F + R            ND+  C  PC    +  ++S    P+K+   Y  K   K
Sbjct:   21 FATRSTLHGISHMFTYERMCLKRTLWILFFMLSVGVLVMVCVDRVQFYFEYPHVTKLDEVAASMIVFPAITFCNLNSFRFSRVTRNDLYHAGELLALLNG--RYEIRDP----HLVEENVLQVLRERADFESYKPRSFNMREFYDRTGHDIKDMLLSCSYR---GTECSAENF----KVIFTR---YGKCYTFNSGKDGQPLMVTMKGGTGNGLELMLDIQQDEYLPVWGETDETSFEAGIKVQIHTQEEPPFIDQLGFGVAPGFQTFVSCQEQRLTYLPPPWGDCKSTPMDSDFFNS----YSITACRIDCETRYLVENCNC--------RMVHMPGDAPYCSPEQY---KECADPALD-----FLVERD-----------NDYCVCETPCNLTRYGKELSFVKIPSKASAKYLAKKFNK 394          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Medaka
Match: asic1a (acid-sensing ion channel 1 [Source:NCBI gene;Acc:101159102])

HSP 1 Score: 57.3806 bits (137), Expect = 4.009e-8
Identity = 86/429 (20.05%), Postives = 150/429 (34.97%), Query Frame = 1
Query:  502 FCETTSLRGVPKIVHSQKKQF-RMLWVIFVLVFFIACMTCTILLIKQYLAYDVIHQPKTSYNDPSNFPSVTFCNLRPFSSRTV---------ELLKRSNIKSLVDFLHGFGRSVVMNSSIMLNLTSEDKQXXXXXXXXXXXXXXXXXSISKESIGHSQNSMIIDCSIQYANGSEISSTKCELGG-KWILTKNELFLNCYTYTMDEK------YLQTATAVDLILHVDDRLEFECPDCNQFFTASQMTGIRFSLHTAHTYPDVILEGQNLSPGTFTDAVFYTKQWNMMQPPYGKCSKTLVEKYAFEEGDFLYSLKGCQKYTIQNLLYDNCGCIKYTNIPKRFAHLNKSQDICNFFEYSVFKNVSKYKLDLNNVKFFLNRTKCKKIISHRFLNDFSTCTNPCQYYTFDVKVSSGIYPTKSFHLYFTKNIQK 1737
            F  +++L G+  I   ++    R LW++  L      +   +  I  YL Y  + +          FP++TFCNL  F    V         ELL   N +  +  +H    SV+ +  +  +  +   +      F              +  GH    M++ C            T+C  G  K + T+   +  CYT+             +      L L +D + +   P        S   G++  +H+    P +   G  ++PG  T      ++   + PP+G C  T ++   F+     YS+  C+       L DNC C        R  ++      C+     ++K  +   LD     F + R            NDF  C  PC    ++ ++S    P+K+   Y  K   K
Sbjct:   21 FAHSSTLHGIAHIFTYERLCIKRCLWLLVFLCSLTLLLYVCVDRIHYYLEYPHVTRLDEVATPIMTFPAITFCNLNAFRFSRVTRNDLYHAGELLALLNHRYEIRDVHLVEESVLESLKVKADFHNFKPRPFNMREFY-------------DRTGHDIKDMLLSCHFH--------GTECRPGDFKVVFTR---YGKCYTFNAGGDGRPPLITTKGGMGNGLELMLDIQQDEYLPVWGDTDETSFEAGVKVQIHSQDEPPSIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKVTPMDSDFFDS----YSITACRVDCETRYLVDNCNC--------RMVYMPGDAPYCS---PELYKECADPALD-----FLVQRD-----------NDFCVCETPCNMTRYNKELSFVKIPSKASAKYLAKKYNK 394          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Medaka
Match: ENSORLT00000031708.1 (acid sensing ion channel subunit 1 [Source:NCBI gene;Acc:101155423])

HSP 1 Score: 55.4546 bits (132), Expect = 1.684e-7
Identity = 90/425 (21.18%), Postives = 149/425 (35.06%), Query Frame = 1
Query:  502 FCETTSLRGVPKIVHSQKK--QFRMLWV---IFVLVFFIACMTCTILLIKQYLAYDVIHQPKTSYNDPSNFPSVTFCNLRPFSSRTVELLKRSNIKSLVDFLHGFGRSVVMNSSIMLNLTSEDKQXXXXXXXXXXXXXXXXXSISK--ESIGHSQNSMIIDCSIQYANGSEISSTKCELGGKWILTKNELFLNCYTYTMDEK------YLQTATAVDLILHVDDRLEFECPDCNQFFTASQMTGIRFSLHTAHTYPDVILEGQNLSPGTFTDAVFYTKQWNMMQPPYGKCSKTLVEKYAFEEGDFLYSLKGCQKYTIQNLLYDNCGCIKYTNIPKRFAHLNKSQDICNFFEYSVFKNVSKYKLDLNNVKFFLNRTKCKKIISHRFLNDFSTCTNPCQYYTFDVKVSSGIYPTKSFHLYFTKNIQK 1737
            FC  +SL G   +   +KK    + LW    I  L FF+  +   I+  +QY    ++ + K + N    FP++T CN        +       +  L+ F  G      +       L S                     S+ +      H  + M++DCS +   G E          K I T+   +  CYT+   +        ++  T   L L +D + +   P   +    S   GI+  +HT    P +   G  ++PG  T      ++   + PP+G C  T ++   F      YS+  C+       L +NC C        R  H+      C+  +Y   K  +   LD     F + R            ND+  C  PC    +  ++S    P+K+   Y  K   K
Sbjct:   67 FCSNSSLHGANHVFVEEKKFGVRQGLWAVAFIVALSFFVLQVADRIIYYRQYDRITLLDE-KVANN--MTFPAITICNYNLVRKTQMSYSDLIFMGPLLGFEDGMAPGFALAPEPDRPLGSR-------------------FSLDEFYTRTRHRIDEMLLDCSFR---GLECGPENF----KEIFTR---YGKCYTFNSGKDGQPLMVTMKGGTGNGLELMLDIQQDEYLPVWGETDETSFEAGIKVQIHTQEEPPFIDQLGFGVAPGFQTFVSCQEQRLTYLPPPWGDCKSTPMDSDFFNS----YSITACRIDCETRYLVENCNC--------RMVHMPGDAPYCSPEQY---KECADPALD-----FLVERD-----------NDYCVCETPCNLTRYGKELSFVKIPSKASAKYLAKKFNK 428          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Medaka
Match: ENSORLT00000021925.2 (acid-sensing ion channel 1C [Source:NCBI gene;Acc:101174951])

HSP 1 Score: 51.2174 bits (121), Expect = 3.598e-6
Identity = 88/429 (20.51%), Postives = 159/429 (37.06%), Query Frame = 1
Query:  490 HFKKFCETTSLRGVPKIVHSQKKQFR-MLWVIFVLVFFIACMTCTILLIKQYLAYDVIHQPKTSYNDPSNFPSVTFCNLRPFSSRTV---ELLKRSNIKSLVDFLHGFGRSVVMNSSIMLNLTSEDKQXXXXXXXXXXXXXXXXXSISKESIGHSQNSMIIDCSIQYANGSEISSTKCELGGKWILTKNELFLNCYTYT--MDEKYLQT----ATAVDLILHVDDRLEFECPDCNQFFTASQMTGIRFSLHTAHTYPDVILEGQNLSPGTFTDAVFYTKQWNMMQ---PPYGKCSKTLVEKYAFEEGDFLYSLKGCQKYTIQNLLYDNCGCIKYTNIPKRFAHLNKSQDICNFFEYSVFKNVSKYKLDLNNVKFFLNRTKCKKIISHRFLNDFSTCTNPCQYYTFDVKVSSGIYPTKSFHLYFTKNIQK 1737
            + + F   ++L G+  I       FR  LW +  L      M   +  +  YL Y  + +          FP+VTFCNL  F    +   +L     + +L++  H      +    ++  L  +DK    +       + +          GH  + M++ C+ +  +   ++ T        I T+   +  CYT+   +D   L T     T   L + +D + +   P   +    S   GI+  +H+    P +   G  ++PG  T   F + Q  ++Q   PP+G C  T ++   F      YS+  C+       L +NC C        R  H+  +  +C   +Y   K+ +   LD     F + +            N++  C  PC    +  ++S    P+K+   Y  K   K
Sbjct:   16 NLQAFANISTLHGMSHIFAYGHMTFRRFLWTLSFLGSLSLLMLVCMDRVVYYLEYPHVTKLDEVAATNLTFPAVTFCNLNEFRFSKITRNDLYHVGELLALLNNDHQIANPHLAEPEVLAAL--KDKANFNNFKPKLFNMTDFY-----NRTGHDISEMLLQCTFRGEDCYAMNFTT-------IYTR---YGKCYTFNSGLDGNPLLTTLKGGTGNGLEIMLDIQQDEYLPVWGETDETSYEAGIKVQIHSQDEPPFIDQLGFGVAPGFQT---FVSCQQQLLQYLPPPWGDCKSTPIDSEFFST----YSITACRIDCETRYLLENCNC--------RMVHMPGTSTVCTPDQY---KDCADPALD-----FLVEKD-----------NNYCVCETPCNMTRYGKELSMVKIPSKASAKYLAKKFNK 393          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000013147.1 (SMESG000013147.1)

HSP 1 Score: 1289.25 bits (3335), Expect = 0.000e+0
Identity = 657/657 (100.00%), Postives = 657/657 (100.00%), Query Frame = 1
Query:   67 QLSSGMDSQNLTGTDTLCFPLTKDDADKLSRKVSLERNDLSSTECQDNQHFHDKALNNGAFYEWNCVNHNYNNLSADPWIPRSKSLKSKYFCVKNESSLDSSPKNELNFCSKCNLVFERKFPVVDSKHQDKIQSKTAIILFHFKKFCETTSLRGVPKIVHSQKKQFRMLWVIFVLVFFIACMTCTILLIKQYLAYDVIHQPKTSYNDPSNFPSVTFCNLRPFSSRTVELLKRSNIKSLVDFLHGFGRSVVMNSSIMLNLTSEDKQXXXXXXXXXXXXXXXXXSISKESIGHSQNSMIIDCSIQYANGSEISSTKCELGGKWILTKNELFLNCYTYTMDEKYLQTATAVDLILHVDDRLEFECPDCNQFFTASQMTGIRFSLHTAHTYPDVILEGQNLSPGTFTDAVFYTKQWNMMQPPYGKCSKTLVEKYAFEEGDFLYSLKGCQKYTIQNLLYDNCGCIKYTNIPKRFAHLNKSQDICNFFEYSVFKNVSKYKLDLNNVKFFLNRTKCKKIISHRFLNDFSTCTNPCQYYTFDVKVSSGIYPTKSFHLYFTKNIQKILIRKIRNSSKIEDMNELKSILHKFKIYDEISRKIKNGSIAEAEKLLKNTDVIEKNFLTIQINRQDFXXXXXXXXXXXXXTSFLSQTGGMFSIWSGITFF 2037
            QLSSGMDSQNLTGTDTLCFPLTKDDADKLSRKVSLERNDLSSTECQDNQHFHDKALNNGAFYEWNCVNHNYNNLSADPWIPRSKSLKSKYFCVKNESSLDSSPKNELNFCSKCNLVFERKFPVVDSKHQDKIQSKTAIILFHFKKFCETTSLRGVPKIVHSQKKQFRMLWVIFVLVFFIACMTCTILLIKQYLAYDVIHQPKTSYNDPSNFPSVTFCNLRPFSSRTVELLKRSNIKSLVDFLHGFGRSVVMNSSIMLNLTSEDKQLLTSTLFLELFLMNLPLSISKESIGHSQNSMIIDCSIQYANGSEISSTKCELGGKWILTKNELFLNCYTYTMDEKYLQTATAVDLILHVDDRLEFECPDCNQFFTASQMTGIRFSLHTAHTYPDVILEGQNLSPGTFTDAVFYTKQWNMMQPPYGKCSKTLVEKYAFEEGDFLYSLKGCQKYTIQNLLYDNCGCIKYTNIPKRFAHLNKSQDICNFFEYSVFKNVSKYKLDLNNVKFFLNRTKCKKIISHRFLNDFSTCTNPCQYYTFDVKVSSGIYPTKSFHLYFTKNIQKILIRKIRNSSKIEDMNELKSILHKFKIYDEISRKIKNGSIAEAEKLLKNTDVIEKNFLTIQINRQDFSIIKVEEKEVISITSFLSQTGGMFSIWSGITFF
Sbjct:    6 QLSSGMDSQNLTGTDTLCFPLTKDDADKLSRKVSLERNDLSSTECQDNQHFHDKALNNGAFYEWNCVNHNYNNLSADPWIPRSKSLKSKYFCVKNESSLDSSPKNELNFCSKCNLVFERKFPVVDSKHQDKIQSKTAIILFHFKKFCETTSLRGVPKIVHSQKKQFRMLWVIFVLVFFIACMTCTILLIKQYLAYDVIHQPKTSYNDPSNFPSVTFCNLRPFSSRTVELLKRSNIKSLVDFLHGFGRSVVMNSSIMLNLTSEDKQLLTSTLFLELFLMNLPLSISKESIGHSQNSMIIDCSIQYANGSEISSTKCELGGKWILTKNELFLNCYTYTMDEKYLQTATAVDLILHVDDRLEFECPDCNQFFTASQMTGIRFSLHTAHTYPDVILEGQNLSPGTFTDAVFYTKQWNMMQPPYGKCSKTLVEKYAFEEGDFLYSLKGCQKYTIQNLLYDNCGCIKYTNIPKRFAHLNKSQDICNFFEYSVFKNVSKYKLDLNNVKFFLNRTKCKKIISHRFLNDFSTCTNPCQYYTFDVKVSSGIYPTKSFHLYFTKNIQKILIRKIRNSSKIEDMNELKSILHKFKIYDEISRKIKNGSIAEAEKLLKNTDVIEKNFLTIQINRQDFSIIKVEEKEVISITSFLSQTGGMFSIWSGITFF 662          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000013147.1 (SMESG000013147.1)

HSP 1 Score: 1289.25 bits (3335), Expect = 0.000e+0
Identity = 657/657 (100.00%), Postives = 657/657 (100.00%), Query Frame = 1
Query:   67 QLSSGMDSQNLTGTDTLCFPLTKDDADKLSRKVSLERNDLSSTECQDNQHFHDKALNNGAFYEWNCVNHNYNNLSADPWIPRSKSLKSKYFCVKNESSLDSSPKNELNFCSKCNLVFERKFPVVDSKHQDKIQSKTAIILFHFKKFCETTSLRGVPKIVHSQKKQFRMLWVIFVLVFFIACMTCTILLIKQYLAYDVIHQPKTSYNDPSNFPSVTFCNLRPFSSRTVELLKRSNIKSLVDFLHGFGRSVVMNSSIMLNLTSEDKQXXXXXXXXXXXXXXXXXSISKESIGHSQNSMIIDCSIQYANGSEISSTKCELGGKWILTKNELFLNCYTYTMDEKYLQTATAVDLILHVDDRLEFECPDCNQFFTASQMTGIRFSLHTAHTYPDVILEGQNLSPGTFTDAVFYTKQWNMMQPPYGKCSKTLVEKYAFEEGDFLYSLKGCQKYTIQNLLYDNCGCIKYTNIPKRFAHLNKSQDICNFFEYSVFKNVSKYKLDLNNVKFFLNRTKCKKIISHRFLNDFSTCTNPCQYYTFDVKVSSGIYPTKSFHLYFTKNIQKILIRKIRNSSKIEDMNELKSILHKFKIYDEISRKIKNGSIAEAEKLLKNTDVIEKNFLTIQINRQDFXXXXXXXXXXXXXTSFLSQTGGMFSIWSGITFF 2037
            QLSSGMDSQNLTGTDTLCFPLTKDDADKLSRKVSLERNDLSSTECQDNQHFHDKALNNGAFYEWNCVNHNYNNLSADPWIPRSKSLKSKYFCVKNESSLDSSPKNELNFCSKCNLVFERKFPVVDSKHQDKIQSKTAIILFHFKKFCETTSLRGVPKIVHSQKKQFRMLWVIFVLVFFIACMTCTILLIKQYLAYDVIHQPKTSYNDPSNFPSVTFCNLRPFSSRTVELLKRSNIKSLVDFLHGFGRSVVMNSSIMLNLTSEDKQLLTSTLFLELFLMNLPLSISKESIGHSQNSMIIDCSIQYANGSEISSTKCELGGKWILTKNELFLNCYTYTMDEKYLQTATAVDLILHVDDRLEFECPDCNQFFTASQMTGIRFSLHTAHTYPDVILEGQNLSPGTFTDAVFYTKQWNMMQPPYGKCSKTLVEKYAFEEGDFLYSLKGCQKYTIQNLLYDNCGCIKYTNIPKRFAHLNKSQDICNFFEYSVFKNVSKYKLDLNNVKFFLNRTKCKKIISHRFLNDFSTCTNPCQYYTFDVKVSSGIYPTKSFHLYFTKNIQKILIRKIRNSSKIEDMNELKSILHKFKIYDEISRKIKNGSIAEAEKLLKNTDVIEKNFLTIQINRQDFSIIKVEEKEVISITSFLSQTGGMFSIWSGITFF
Sbjct:    3 QLSSGMDSQNLTGTDTLCFPLTKDDADKLSRKVSLERNDLSSTECQDNQHFHDKALNNGAFYEWNCVNHNYNNLSADPWIPRSKSLKSKYFCVKNESSLDSSPKNELNFCSKCNLVFERKFPVVDSKHQDKIQSKTAIILFHFKKFCETTSLRGVPKIVHSQKKQFRMLWVIFVLVFFIACMTCTILLIKQYLAYDVIHQPKTSYNDPSNFPSVTFCNLRPFSSRTVELLKRSNIKSLVDFLHGFGRSVVMNSSIMLNLTSEDKQLLTSTLFLELFLMNLPLSISKESIGHSQNSMIIDCSIQYANGSEISSTKCELGGKWILTKNELFLNCYTYTMDEKYLQTATAVDLILHVDDRLEFECPDCNQFFTASQMTGIRFSLHTAHTYPDVILEGQNLSPGTFTDAVFYTKQWNMMQPPYGKCSKTLVEKYAFEEGDFLYSLKGCQKYTIQNLLYDNCGCIKYTNIPKRFAHLNKSQDICNFFEYSVFKNVSKYKLDLNNVKFFLNRTKCKKIISHRFLNDFSTCTNPCQYYTFDVKVSSGIYPTKSFHLYFTKNIQKILIRKIRNSSKIEDMNELKSILHKFKIYDEISRKIKNGSIAEAEKLLKNTDVIEKNFLTIQINRQDFSIIKVEEKEVISITSFLSQTGGMFSIWSGITFF 659          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000072389.1 (SMESG000072389.1)

HSP 1 Score: 392.889 bits (1008), Expect = 1.277e-127
Identity = 213/528 (40.34%), Postives = 317/528 (60.04%), Query Frame = 1
Query:  466 SKTAIILFHFKKFCETTSLRGVPKIVHSQKKQFRMLWVIFVLVFFIACMTCTILLIKQYLAYDVIHQPKTSYNDPSNFPSVTFCNLRPFSSRTVELLKRSNIKSLVDFLHGFGRSVVMNSSIMLNLTSEDKQXXXXXXXXXXXXXXXXXSISKESIGHSQNSMIIDCSIQYANGSEISSTKCELGGKWILTKNELFLNCYTYTMDEKYLQTATAVDLILHVDDRLEFECPDCNQFFTASQMTGIRFSLHTAHTYPDVILEGQNLSPGTFTDAVFYTKQWNMMQPPYGKCSKTLVEKYAFEEGDFLYSLKGCQKYTIQNLLYDNCGCIKYTNIPKRFAHLNKSQDICNFFEYSVFKNVSKYKLDLNNVKFFLNRTKCKKIISHRFLNDFSTCTNPCQYYTFDVKVSSGIYPTKSFHLYFTKNIQKILIRKIRN--SSKIED--MNELKSILHKFKIYDEISRKIKNGSIAEAEKLLKNTDVIEKNFLTIQINRQDFXXXXXXXXXXXXXTSFLSQTGGMFSIWSGITFF 2037
            S   +I  H  KFCETTSLRGVP+I+ S   + R+LW  FV VFFIAC+TC  LL+ QY AYDVIHQP+T YN    FPS+T CNLRP +SR +++L ++NI +  +F+      +    S    LT    +L+T++  L  + +NLP SI    +GHS+++M++ C+I Y  G   S   CE  GKW+ T ++++ NC+T+ ++E Y     +++++L++D+  + ECPDC     A+Q+TG   +LH+  TYP +  EG NL PGT T+  F  ++W+MM+PP+GKCSK +    +F+   F YS   C++  +Q  L   C CI Y  +P       +   IC F  + V +NV+KY +  + ++ F NRTKC+   + R  N    C +PC Y+T+D  +SS  +P KS+H  F K I++ + R   +   SK  D  +  LK +  K   Y  + +  +   + +A +LL+N   IE+N L +Q+ R +F I  VEEK V+S+TSFLSQTGG+ SIWSGITFF
Sbjct:   54 SSKQVIKSHCIKFCETTSLRGVPRIIKSSNPKQRLLWTFFVAVFFIACVTCVGLLVSQYRAYDVIHQPRTVYNQSRPFPSLTVCNLRPLTSRGIQILLKNNILTAREFIQRLKTQL---RSYKKKLTPIQSKLVTTSWNLNTYFLNLPKSIDPNDLGHSRHNMVLSCAIVYREGIYSSGAACEKVGKWVSTVSKIYHNCHTFIVNEAYTNRTFSLEMVLYLDNFEDIECPDCQPLQIATQLTGAHLNLHSEGTYPQIETEGLNLLPGTLTEIRFTPREWSMMEPPHGKCSKNIDMSMSFDNEQFKYSESSCKQKLLQQELIKQCNCIDYLQVPTELMWAKEPLKICKFLRFPVERNVTKYNISWDILEKFTNRTKCESETASRPHNILDQCKSPCTYFTYDTSISSAKWPAKSYHTMFVKYIEEKMKRMHTDLPVSKSSDNVIEPLKDLYKKLLPYKRVMKLKEEKKLIKANELLRNLTFIEQNLLAVQVTRPNFDITLVEEKAVVSLTSFLSQTGGLLSIWSGITFF 578          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000081650.1 (SMESG000081650.1)

HSP 1 Score: 378.637 bits (971), Expect = 4.492e-122
Identity = 204/521 (39.16%), Postives = 326/521 (62.57%), Query Frame = 1
Query:  490 HFKKFCETTSLRGVPKIVHSQKKQFRMLWVIFVLVFFIACMTCTILLIKQYLAYDVIHQPKTSYNDPSNFPSVTFCNLRPFSSRTVELLKRSNIKSLVDFLHGFGRSV--VMNSSIMLNLTSEDKQXXXXXXXXXXXXXXXXXSISKESIGHSQNSMIIDCSIQYANGSEISSTKCELGGKWILTKNELFLNCYTYTMDEKYLQTATAVDLILHVDDRLEFECPDCNQFFTASQMTGIRFSLHTAHTYPDVILEGQNLSPGTFTDAVFYTKQWNMMQPPYGKCSKTLVEKYAFEEGDFLYSLKGCQKYTIQNLLYDNCGCIKYTNIPKRFAHLNKSQDICNFFEYSVFKNVSKYKLDLNNVKFFLNRTKCKKIISHRFLNDFSTCTNPCQYYTFDVKVSSGIYPTKSFHLYFTKNIQKILIRKIRNSSKIED--MNELKSILHKFKIYDEISRKI-KNGSIAEAEKLLKNTDVIEKNFLTIQINRQDFXXXXXXXXXXXXXTSFLSQTGGMFSIWSGITFF 2037
            H+K FCETTSLRGVP+I  ++  + R LW+ FV  FF+AC+TC +LLI QY  YDVIHQPKT YN P+ FPS++FCNLRP SS +++ LK + + S+ ++L    +S+  +  SS   N+T  +++LLT +  +  + +NLP S     +GH +  M++ C + Y  G   S   C+  G W+ T N +++NC+T+ +++K+     +++++L++D   E  C DCN+    SQ+TG+R +LH++ TYP++I +G NL PGT T+  F  +QWNMM+PP+GKCSK + +K +F + +F YS + C++  +Q  L  NC C+ +  +P    +  + + IC +   + F N +    + +    +LN+T C    S   +N  + C +PC ++T+D  +SS  +PTKSFH  F K+++  + +++RN   I +   +   +I+ + K Y  +  KI K  ++   +KLL +   +  NFL+IQ+ R +F II VEEK  +S+T+FLSQTGG+FSIWSGITFF
Sbjct:   61 HWKVFCETTSLRGVPRIAKTRDPKRRFLWIFFVTAFFLACITCIVLLIMQYRQYDVIHQPKTVYNKPTPFPSLSFCNLRPLSSHSIKTLKNNGLNSVSEYLKQLKQSMEDLRKSS---NIT--ERKLLTMSWNINSYFLNLPNSTQPNDLGHDRLEMVMYCLLIYKQGIYNSGIVCDKAGHWVSTLNSIYINCHTFIVNKKFTNKTFSMEVVLYLDHADEIYCNDCNEMKIYSQLTGVRLNLHSSGTYPEIIEKGINLMPGTLTEIKFIPRQWNMMEPPHGKCSKQVSKKISFNKVEFQYSEEACKRKVLQEELAKNCDCVDFNQVPDDLNNYLQHKKICQYLPATPFSNATLSSFNHSQTADYLNKTHCNLQTSSE-INYQNKCNSPCTFFTYDTTISSAEWPTKSFHTSFLKSLRDYIQKRMRNFYNITESTRSAWTTIIEELKPYLSLIEKIEKEENVTLNKKLLNDLKFVSNNFLSIQVGRTNFDIILVEEKASVSLTNFLSQTGGIFSIWSGITFF 575          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000044381.1 (SMESG000044381.1)

HSP 1 Score: 234.958 bits (598), Expect = 7.535e-68
Identity = 158/533 (29.64%), Postives = 265/533 (49.72%), Query Frame = 1
Query:  493 FKKFCETTSLRGVPKIVHSQKKQFRMLWVIFVLVFFIACMTCTILLIKQYLAYDVIHQPKTSYNDPSNFPSVTFCNLRPFSSRTVELLKRSNIKSLVDFLHGFGRSVVMNSSIMLNLTSEDKQXXXXXXXXXXXXXXXXXSISKESIGHSQNSMIIDCSIQYANGSEISSTKCELGGKWILTKNELFLNCYTYTMDEKYLQTATAVDLILHVDDRL-EFECPDCNQFFTASQMTGIRFSLHTAHTYPDVILEGQNLSPGTFTDAVFYTKQWNMMQPPYGKCSKTLVEKYAFEEGDFLYSLKGCQKYTIQNLLYDNCGC--IKY----------TNIPK----RFAHLNKSQDICNFFEYSVFKNVSKYKLDLNNVKFFLNRTKCKKIISHRFLNDF-STCTNPCQYYTFDVKVSSGIYPTKSFHLYFTKNIQKILIRKIRNSSKIEDMNELKSILHKFKIYDEISRKIKNGSIAEAEKLLKNTDVIEKNFLTIQINRQDFXXXXXXXXXXXXXTSFLSQTGGMFSIWSGITFF 2037
            F +FCE T+LRGVP+IV S+K   R LW+ F ++ FI  M C I L  QYL Y+VIH P+   ++ + FPS+T CN RP     +E++K+ NIK   +F H   +  +       NL    ++  +              + ++  +GH +  +II C + Y NGS      C   GKW +  +  ++NCY+Y + E Y +    ++L  ++D  + +  C DC      SQ++G    +H   T+P+   +  NL PGT T+           +PPYG+CS    +        + YS   C+  TIQ+ +   CGC  I+Y          +N+P+    +  H ++S   C            K++LD       + +  CK  +S ++  D   +C+ PC  Y+++   S+  +PTK++ + + K+      R++R   ++             K Y +  R+  NGS+ ++ ++L   +++E+N L + INR ++++  VEEKEV+S+TSFLSQ GG+ SIW G+T  
Sbjct:   22 FLRFCENTTLRGVPRIVKSRKSHIRHLWLTFFILLFIGFMVCIIFLCYQYLEYNVIHPPRILSDNKAPFPSLTVCNYRPMKRNILEIMKKRNIKDPREFAHSINKYAIKYYY-KKNLGKNYQRASSIMNMGAYLESVPNRTFNE--LGHDEQDLIIYCQVTYMNGSSPHYKVCSDIGKWRVIIHAQYINCYSYNLYENYSRNTNTMELYFYLDQGIPDSMCLDCFSSDVKSQLSGALVLIHRRLTFPNFNHDIINLQPGTLTEIKLKIFNNVHKEPPYGRCSYKSPKTMKIYNDLYSYSEHACKLLTIQHDINKQCGCNAIEYPIDNFNLSFCSNLPRFIEGKLCHDDQSDMKC------------KHQLDA-----VVKKIICKSNVSSQYQKDIVKSCSLPCDIYSYESDRSTSSWPTKTWQMPWIKSNAA---RRLRKKPEL-------------KGYIDAYREYLNGSVNKSFRILNQQNILEQNLLAVMINRPNYNVHLVEEKEVLSLTSFLSQAGGLCSIWIGLTMI 518          
The following BLAST results are available for this feature:
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
del-41.378e-1120.53DEgenerin Like [Source:UniProtKB/TrEMBL;Acc:P9183... [more]
unc-1052.264e-1021.59Degenerin-like protein unc-105 [Source:UniProtKB/... [more]
unc-1052.264e-1021.59Degenerin-like protein unc-105 [Source:UniProtKB/... [more]
unc-1052.527e-1021.59Degenerin-like protein unc-105 [Source:UniProtKB/... [more]
unc-1052.527e-1021.59Degenerin-like protein unc-105 [Source:UniProtKB/... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ASIC13.593e-620.00acid sensing ion channel subunit 1 [Source:NCBI ge... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q09274|UN105_CAEEL2.880e-921.59Degenerin-like protein unc-105 OS=Caenorhabditis e... [more]
sp|Q25011|FANA_CORAP8.122e-921.48FMRFamide-activated amiloride-sensitive sodium cha... [more]
sp|Q60NC0|MEC10_CAEBR5.823e-728.09Degenerin mec-10 OS=Caenorhabditis briggsae OX=623... [more]
sp|P34886|MEC10_CAEEL9.015e-728.09Degenerin mec-10 OS=Caenorhabditis elegans OX=6239... [more]
sp|P24612|MEC4_CAEEL1.194e-631.37Degenerin mec-4 OS=Caenorhabditis elegans OX=6239 ... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3SU471.092e-9935.80Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A4S2KXN92.922e-9935.46Uncharacterized protein OS=Opisthorchis felineus O... [more]
G7YD976.034e-9835.07FMRFamide-activated amiloride-sensitive sodium cha... [more]
G4V8Q72.480e-9536.38Putative amiloride-sensitive sodium channel OS=Sch... [more]
A0A3Q0KJ874.799e-9536.53Putative amiloride-sensitive sodium channel OS=Sch... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
asic1c1.937e-821.65acid-sensing ion channel 1C-like [Source:NCBI gene... [more]
asic1c1.126e-721.33acid-sensing ion channel 1C-like [Source:NCBI gene... [more]
asic1c4.771e-620.36acid-sensing ion channel 1C-like [Source:NCBI gene... [more]
asic1c5.045e-620.36acid-sensing ion channel 1C-like [Source:NCBI gene... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
asic1b6.351e-619.23acid-sensing (proton-gated) ion channel 1b [Source... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO345324.694e-628.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSORLT00000031246.12.539e-920.43acid sensing ion channel subunit 1 [Source:NCBI ge... [more]
asic1a4.009e-820.05acid-sensing ion channel 1 [Source:NCBI gene;Acc:1... [more]
ENSORLT00000031708.11.684e-721.18acid sensing ion channel subunit 1 [Source:NCBI ge... [more]
ENSORLT00000021925.23.598e-620.51acid-sensing ion channel 1C [Source:NCBI gene;Acc:... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000013147.10.000e+0100.00SMESG000013147.1[more]
SMESG000013147.10.000e+0100.00SMESG000013147.1[more]
SMESG000072389.11.277e-12740.34SMESG000072389.1[more]
SMESG000081650.14.492e-12239.16SMESG000081650.1[more]
SMESG000044381.17.535e-6829.64SMESG000044381.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022207 ID=SMED30022207|Name=FMRFamide-activated amiloride-sensitive sodium channel|organism=Schmidtea mediterranea sexual|type=transcript|length=2213bp
TCCGATCTATTTATTATTCGCGGAATAATTTAATTGATTTTAATTTTCCG
CATGATTGAAATGGAGCAATTGTCAAGTGGGATGGATTCGCAAAATCTAA
CAGGGACTGACACTCTCTGTTTCCCACTTACAAAGGACGATGCAGATAAA
TTGTCAAGAAAAGTTTCCCTAGAGCGTAATGATTTATCAAGTACCGAATG
TCAAGATAATCAACATTTTCATGACAAGGCCTTGAATAACGGAGCGTTTT
ATGAATGGAATTGTGTCAATCATAATTATAATAATTTATCTGCTGATCCG
TGGATTCCAAGATCCAAAAGCTTAAAGTCTAAATATTTTTGTGTAAAAAA
TGAGTCTTCATTAGATTCAAGTCCAAAAAATGAACTCAATTTTTGTTCCA
AATGTAATTTAGTCTTTGAACGAAAATTCCCAGTTGTTGATTCGAAACAT
CAAGATAAAATTCAAAGCAAAACGGCCATTATTCTTTTTCATTTTAAGAA
ATTCTGTGAAACGACTTCCTTAAGAGGCGTACCGAAAATAGTTCACAGTC
AAAAGAAGCAATTTCGAATGTTGTGGGTGATTTTTGTCCTTGTATTCTTC
ATTGCATGTATGACATGTACAATTTTGCTTATTAAACAATATCTCGCGTA
TGATGTAATTCATCAACCAAAAACCTCTTACAATGATCCGTCAAATTTCC
CCTCAGTAACATTTTGCAATCTCAGACCTTTCTCTAGTCGAACCGTAGAA
CTTTTGAAAAGATCGAATATTAAGTCTTTAGTTGATTTTCTCCACGGATT
CGGAAGGTCTGTAGTAATGAACTCTTCTATCATGTTGAACTTGACCTCTG
AAGATAAGCAATTACTTACCTCAACTTTATTTTTAGAGTTGTTTCTCATG
AATTTACCATTGTCTATCAGTAAAGAATCTATTGGGCATTCACAAAACTC
TATGATAATAGACTGTTCCATTCAATATGCCAATGGCTCAGAAATATCAT
CTACAAAATGTGAGCTTGGTGGTAAATGGATTTTGACGAAAAATGAGCTT
TTCCTCAATTGTTATACTTATACAATGGATGAAAAATATCTCCAAACCGC
AACCGCAGTGGATTTGATACTTCATGTTGATGACAGGCTGGAATTTGAGT
GTCCAGATTGCAATCAGTTTTTTACGGCTTCTCAAATGACTGGAATTCGT
TTCAGTTTGCATACAGCTCACACATATCCTGATGTTATTCTTGAAGGGCA
AAATTTGTCACCTGGAACATTCACTGATGCCGTATTCTACACTAAGCAAT
GGAACATGATGCAACCACCATATGGTAAATGTAGCAAGACCTTAGTGGAA
AAGTACGCTTTTGAAGAAGGAGATTTTCTTTATTCTTTAAAAGGTTGTCA
AAAGTACACAATTCAAAATCTTCTTTATGATAATTGCGGTTGCATAAAAT
ACACTAATATCCCAAAACGATTTGCTCATTTAAACAAAAGCCAAGATATT
TGTAATTTTTTCGAATATTCAGTGTTTAAAAACGTATCAAAATACAAATT
AGATTTAAATAATGTGAAATTTTTTCTAAATCGAACAAAATGTAAAAAGA
TAATTTCTCATAGATTTCTCAATGATTTTAGTACTTGTACAAATCCTTGC
CAATACTACACGTTCGACGTGAAAGTCAGTTCCGGTATTTATCCGACAAA
ATCTTTTCATTTGTATTTCACAAAGAACATTCAAAAGATATTGATTAGAA
AAATTAGAAATTCCTCGAAAATTGAAGACATGAATGAATTAAAGTCGATT
TTGCATAAATTTAAGATCTACGATGAAATCTCTAGAAAAATCAAAAACGG
AAGCATTGCGGAAGCGGAGAAATTGTTGAAAAATACTGATGTAATTGAAA
AGAATTTCCTCACGATTCAAATTAATCGGCAGGATTTTTCTATAATAAAG
GTCGAAGAGAAAGAAGTGATTTCAATAACGAGTTTTCTCAGTCAGACCGG
TGGAATGTTTAGCATTTGGAGCGGGATAACGTTTTTTGTTTAGTTGAATT
CATTGAATTGATGATGAATATATATAACTCACTTTTTTCTTTCCAAGCTT
GACAGCCGTAAATTGCTTGTTTAATTGAGAGATGGTTGACTACCATTTTG
AAAAGATTAATTATACTTTTCCTAACAGTTTTTATTTATTCATTGATATG
TGTTTAAATTAAT
back to top

protein sequence of SMED30022207-orf-1

>SMED30022207-orf-1 ID=SMED30022207-orf-1|Name=SMED30022207-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=664bp
MIEMEQLSSGMDSQNLTGTDTLCFPLTKDDADKLSRKVSLERNDLSSTEC
QDNQHFHDKALNNGAFYEWNCVNHNYNNLSADPWIPRSKSLKSKYFCVKN
ESSLDSSPKNELNFCSKCNLVFERKFPVVDSKHQDKIQSKTAIILFHFKK
FCETTSLRGVPKIVHSQKKQFRMLWVIFVLVFFIACMTCTILLIKQYLAY
DVIHQPKTSYNDPSNFPSVTFCNLRPFSSRTVELLKRSNIKSLVDFLHGF
GRSVVMNSSIMLNLTSEDKQLLTSTLFLELFLMNLPLSISKESIGHSQNS
MIIDCSIQYANGSEISSTKCELGGKWILTKNELFLNCYTYTMDEKYLQTA
TAVDLILHVDDRLEFECPDCNQFFTASQMTGIRFSLHTAHTYPDVILEGQ
NLSPGTFTDAVFYTKQWNMMQPPYGKCSKTLVEKYAFEEGDFLYSLKGCQ
KYTIQNLLYDNCGCIKYTNIPKRFAHLNKSQDICNFFEYSVFKNVSKYKL
DLNNVKFFLNRTKCKKIISHRFLNDFSTCTNPCQYYTFDVKVSSGIYPTK
SFHLYFTKNIQKILIRKIRNSSKIEDMNELKSILHKFKIYDEISRKIKNG
SIAEAEKLLKNTDVIEKNFLTIQINRQDFSIIKVEEKEVISITSFLSQTG
GMFSIWSGITFFV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: biological process
TermDefinition
GO:0006814sodium ion transport
GO:0006810transport
GO:0006811ion transport
GO:0035725sodium ion transmembrane transport
Vocabulary: INTERPRO
TermDefinition
IPR001873ENaC
Vocabulary: molecular function
TermDefinition
GO:0005272sodium channel activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001873Epithelial sodium channelPRINTSPR01078AMINACHANNELcoord: 212..228
score: 44.24
coord: 411..427
score: 23.53
coord: 444..455
score: 33.33
coord: 325..341
score: 23.76
coord: 381..399
score: 27.58
IPR001873Epithelial sodium channelPFAMPF00858ASCcoord: 151..663
e-value: 1.5E-55
score: 189.0
IPR001873Epithelial sodium channelPANTHERPTHR11690AMILORIDE-SENSITIVE SODIUM CHANNEL-RELATEDcoord: 145..661
NoneNo IPR availablePANTHERPTHR11690:SF222PICKPOCKET 6-RELATEDcoord: 145..661
NoneNo IPR availableTMHMMTMhelixcoord: 172..194