Glia maturation factor

Overview
NameGlia maturation factor
Smed IDSMED30022205
Length (bp)834
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glia maturation factor (SMED30022205) t-SNE clustered cells

Violin plots show distribution of expression levels for Glia maturation factor (SMED30022205) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glia maturation factor (SMED30022205) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glia maturation factor (SMED30022205) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022205

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30022205SMESG000071026.1 Contig3584GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30022205SMESG000079306.1 PL04020B1G08ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30022205SMESG000079306.1 Contig3584GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
parenchymal cellSMED30022205SMESG000079306.1 dd_Smed_v4_2804_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glia maturation factor vs. Ensembl Human
Match: GMFB (glia maturation factor beta [Source:HGNC Symbol;Acc:HGNC:4373])

HSP 1 Score: 150.214 bits (378), Expect = 4.481e-45
Identity = 66/129 (51.16%), Postives = 95/129 (73.64%), Query Frame = 2
Query:  110 LIICNVSESLKEILNQFKFNKCKTNSALIVKVNKTLMELELDQKLEDVDVDELCNELPSHEPRFVVLSYVFKQVDGRISYPYCLIFSTPIGCKPELQMMYAGSFNNLVSIGQITKSFEVRNPEEISVEW 496
            L++C+V+E L E L +F+F K   N+A+I+K++K    + LD++LE +  DEL +ELP  +PRF+V SY ++  DGR+SYP C IFS+P+GCKPE QMMYAGS N LV   ++TK FE+RN E+++ EW
Sbjct:    5 LVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEW 133          
BLAST of Glia maturation factor vs. Ensembl Human
Match: GMFB (glia maturation factor beta [Source:HGNC Symbol;Acc:HGNC:4373])

HSP 1 Score: 150.214 bits (378), Expect = 4.481e-45
Identity = 66/129 (51.16%), Postives = 95/129 (73.64%), Query Frame = 2
Query:  110 LIICNVSESLKEILNQFKFNKCKTNSALIVKVNKTLMELELDQKLEDVDVDELCNELPSHEPRFVVLSYVFKQVDGRISYPYCLIFSTPIGCKPELQMMYAGSFNNLVSIGQITKSFEVRNPEEISVEW 496
            L++C+V+E L E L +F+F K   N+A+I+K++K    + LD++LE +  DEL +ELP  +PRF+V SY ++  DGR+SYP C IFS+P+GCKPE QMMYAGS N LV   ++TK FE+RN E+++ EW
Sbjct:    5 LVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEW 133          
BLAST of Glia maturation factor vs. Ensembl Human
Match: GMFB (glia maturation factor beta [Source:HGNC Symbol;Acc:HGNC:4373])

HSP 1 Score: 145.976 bits (367), Expect = 3.435e-43
Identity = 66/130 (50.77%), Postives = 95/130 (73.08%), Query Frame = 2
Query:  110 LIICNVSESLKEILNQFKFNKCKTNSALIVKVNKTLMELELDQKLEDVDVDELCNELPSHEPR-FVVLSYVFKQVDGRISYPYCLIFSTPIGCKPELQMMYAGSFNNLVSIGQITKSFEVRNPEEISVEW 496
            L++C+V+E L E L +F+F K   N+A+I+K++K    + LD++LE +  DEL +ELP  +PR F+V SY ++  DGR+SYP C IFS+P+GCKPE QMMYAGS N LV   ++TK FE+RN E+++ EW
Sbjct:   17 LVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRTFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEW 146          
BLAST of Glia maturation factor vs. Ensembl Human
Match: GMFG (glia maturation factor gamma [Source:HGNC Symbol;Acc:HGNC:4374])

HSP 1 Score: 134.806 bits (338), Expect = 4.698e-39
Identity = 60/129 (46.51%), Postives = 88/129 (68.22%), Query Frame = 2
Query:  110 LIICNVSESLKEILNQFKFNKCKTNSALIVKVNKTLMELELDQKLEDVDVDELCNELPSHEPRFVVLSYVFKQVDGRISYPYCLIFSTPIGCKPELQMMYAGSFNNLVSIGQITKSFEVRNPEEISVEW 496
            L++C V   L E L +F+F K   N+A+I+KV+K    + L+++ +++  +EL  ELP  +PRFVV SY +   DGR+SYP C IFS+P+GCKPE QMMYAGS N LV   ++TK FE+R  ++++  W
Sbjct:    5 LVVCEVDPELTEKLRKFRFRKETDNAAIIMKVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKVFEIRTTDDLTEAW 133          
BLAST of Glia maturation factor vs. Ensembl Human
Match: GMFG (glia maturation factor gamma [Source:HGNC Symbol;Acc:HGNC:4374])

HSP 1 Score: 122.479 bits (306), Expect = 2.552e-34
Identity = 56/115 (48.70%), Postives = 79/115 (68.70%), Query Frame = 2
Query:  110 LIICNVSESLKEILNQFKFNKCKTNSALIVKVNKTLMELELDQKLEDVDVDELCNELPSHEPRFVVLSYVFKQVDGRISYPYCLIFSTPIGCKPELQMMYAGSFNNLVSIGQITK 454
            L++C V   L E L +F+F K   N+A+I+KV+K    + L+++ +++  +EL  ELP  +PRFVV SY +   DGR+SYP C IFS+P+GCKPE QMMYAGS N LV   ++TK
Sbjct:    5 LVVCEVDPELTEKLRKFRFRKETDNAAIIMKVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTK 119          
BLAST of Glia maturation factor vs. Ensembl Celegans
Match: Y50D7A.10 (pep chromosome:WBcel235:III:315460:321721:1 gene:WBGene00021758.1 transcript:Y50D7A.10.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y50D7A.10)

HSP 1 Score: 114.775 bits (286), Expect = 1.065e-31
Identity = 57/128 (44.53%), Postives = 87/128 (67.97%), Query Frame = 2
Query:  110 LIICNVSESLKEILNQFKFNKCKTNSALIVKVNKTLMELELDQKLEDVDVDELCNELPSHEPRFVVLSYVFKQVDGRISYPYCLIFSTPIGCKPELQMMYAGSFNNLVSIGQITKSFEVRNPEEISVE 493
            L IC++ + +KE L +F+F+K  T +ALI+K+++   EL+ +Q L D  ++E   ELPS +PRF++LS+  K  D RISYP  LI+  P G  PELQM+YAGS N +V+   ++K+ E+R+ +EI  E
Sbjct:    5 LTICSIPDGVKEDLKKFRFSKSTTMNALILKIDRESHELQSEQLLNDCSIEEFKEELPSQQPRFILLSWCKKHSDERISYPMLLIYYCPNGSSPELQMLYAGSRNFIVNECHVSKNTEIRDIDEIDDE 132          
BLAST of Glia maturation factor vs. Ensembl Fly
Match: GMF (gene:FBgn0028894 transcript:FBtr0080851)

HSP 1 Score: 115.161 bits (287), Expect = 1.035e-31
Identity = 54/127 (42.52%), Postives = 84/127 (66.14%), Query Frame = 2
Query:  116 ICNVSESLKEILNQFKFNKCKTNSALIVKVNKTLMELELDQKLEDVDVDELCNELPSHEPRFVVLSYVFKQVDGRISYPYCLIFSTPIGCKPELQMMYAGSFNNLVSIGQITKSFEVRNPEEISVEW 496
            IC++S  + E L +F+F+K K N+ALI+KV++    + LD+ ++D+ VDEL + LP H+PR+V+ +Y     D RISYP C IF TP   + ELQMMYA + + L     +T+ +E+R  +E++ EW
Sbjct:    6 ICDISNEVLEELKKFRFSKSKNNAALILKVDREKQTVVLDEFIDDISVDELQDTLPGHQPRYVIYTYKMVHDDQRISYPMCFIFYTPRDSQIELQMMYACTKSALQREVDLTRVYEIRELDELTEEW 132          
BLAST of Glia maturation factor vs. Ensembl Zebrafish
Match: gmfb (glia maturation factor, beta [Source:ZFIN;Acc:ZDB-GENE-040426-2114])

HSP 1 Score: 142.124 bits (357), Expect = 4.855e-42
Identity = 64/129 (49.61%), Postives = 92/129 (71.32%), Query Frame = 2
Query:  110 LIICNVSESLKEILNQFKFNKCKTNSALIVKVNKTLMELELDQKLEDVDVDELCNELPSHEPRFVVLSYVFKQVDGRISYPYCLIFSTPIGCKPELQMMYAGSFNNLVSIGQITKSFEVRNPEEISVEW 496
            L++C V E L + L  F+F K   N+A+I+K++K    + L+++ ED+  ++L NELP  +PRFVV SY ++  DGR+SYP C IFS+P+GCKPE QMMYAGS N LV   ++TK FE+RN E+++ EW
Sbjct:    5 LVVCEVDEDLVKKLRDFRFRKETNNAAIIMKIDKDKQLVILEEEHEDISPEDLKNELPERQPRFVVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTVELTKVFEIRNTEDLTEEW 133          
BLAST of Glia maturation factor vs. Ensembl Xenopus
Match: gmfb (glia maturation factor, beta [Source:NCBI gene;Acc:549756])

HSP 1 Score: 142.895 bits (359), Expect = 3.469e-42
Identity = 63/129 (48.84%), Postives = 92/129 (71.32%), Query Frame = 2
Query:  110 LIICNVSESLKEILNQFKFNKCKTNSALIVKVNKTLMELELDQKLEDVDVDELCNELPSHEPRFVVLSYVFKQVDGRISYPYCLIFSTPIGCKPELQMMYAGSFNNLVSIGQITKSFEVRNPEEISVEW 496
            L++C+V   L E L +F+F K   N+A+I+K++K    + L+++ E +  DEL +ELP  +PRF+V SY ++  DGR+SYP C IFS+P+GCKPE QMMYAGS N LV   ++TK FE+RN E+++ EW
Sbjct:    5 LVVCDVDAELVEKLKKFRFRKETNNAAIIMKIDKDRRLVVLEEEHEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPLGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEW 133          
BLAST of Glia maturation factor vs. Ensembl Xenopus
Match: gmfb (glia maturation factor, beta [Source:NCBI gene;Acc:549756])

HSP 1 Score: 135.191 bits (339), Expect = 2.915e-39
Identity = 60/129 (46.51%), Postives = 90/129 (69.77%), Query Frame = 2
Query:  110 LIICNVSESLKEILNQFKFNKCKTNSALIVKVNKTLMELELDQKLEDVDVDELCNELPSHEPRFVVLSYVFKQVDGRISYPYCLIFSTPIGCKPELQMMYAGSFNNLVSIGQITKSFEVRNPEEISVEW 496
            L++C+V   L E L +F+F K   N+A+I+K++K    + L+++ E +  DEL +ELP  +PR+  + Y ++  DGR+SYP C IFS+P+GCKPE QMMYAGS N LV   ++TK FE+RN E+++ EW
Sbjct:    6 LVVCDVDAELVEKLKKFRFRKETNNAAIIMKIDKDRRLVVLEEEHEGISPDELKDELPERQPRYPFIFYKYQHDDGRVSYPLCFIFSSPLGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEW 134          
BLAST of Glia maturation factor vs. Ensembl Xenopus
Match: gmfg (glia maturation factor, gamma [Source:NCBI gene;Acc:595039])

HSP 1 Score: 54.6842 bits (130), Expect = 1.329e-9
Identity = 25/52 (48.08%), Postives = 33/52 (63.46%), Query Frame = 2
Query:  350 PYCLIFSTPI---GCKPELQMMYAGSFNNLVSIGQITKSFEVRNPEEISVEW 496
            P   IF   +   GCKPE QMMYAGS N LV   ++TK FE+RN  +++ +W
Sbjct:    1 PLAFIFHLVLFFAGCKPEQQMMYAGSKNRLVQTAELTKVFEIRNTSDLTEDW 52          
BLAST of Glia maturation factor vs. Ensembl Mouse
Match: Gmfb (glia maturation factor, beta [Source:MGI Symbol;Acc:MGI:1927133])

HSP 1 Score: 150.599 bits (379), Expect = 3.010e-45
Identity = 67/129 (51.94%), Postives = 95/129 (73.64%), Query Frame = 2
Query:  110 LIICNVSESLKEILNQFKFNKCKTNSALIVKVNKTLMELELDQKLEDVDVDELCNELPSHEPRFVVLSYVFKQVDGRISYPYCLIFSTPIGCKPELQMMYAGSFNNLVSIGQITKSFEVRNPEEISVEW 496
            L++C+V+E L E L +F+F K   N+A+I+K++K    + LD++LE V  DEL +ELP  +PRF+V SY ++  DGR+SYP C IFS+P+GCKPE QMMYAGS N LV   ++TK FE+RN E+++ EW
Sbjct:    5 LVVCDVAEDLVEKLRKFRFRKETHNAAIIMKIDKDERLVVLDEELEGVSPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEW 133          
BLAST of Glia maturation factor vs. Ensembl Mouse
Match: Gmfb (glia maturation factor, beta [Source:MGI Symbol;Acc:MGI:1927133])

HSP 1 Score: 150.599 bits (379), Expect = 3.010e-45
Identity = 67/129 (51.94%), Postives = 95/129 (73.64%), Query Frame = 2
Query:  110 LIICNVSESLKEILNQFKFNKCKTNSALIVKVNKTLMELELDQKLEDVDVDELCNELPSHEPRFVVLSYVFKQVDGRISYPYCLIFSTPIGCKPELQMMYAGSFNNLVSIGQITKSFEVRNPEEISVEW 496
            L++C+V+E L E L +F+F K   N+A+I+K++K    + LD++LE V  DEL +ELP  +PRF+V SY ++  DGR+SYP C IFS+P+GCKPE QMMYAGS N LV   ++TK FE+RN E+++ EW
Sbjct:    5 LVVCDVAEDLVEKLRKFRFRKETHNAAIIMKIDKDERLVVLDEELEGVSPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEW 133          
BLAST of Glia maturation factor vs. Ensembl Mouse
Match: Gmfg (glia maturation factor, gamma [Source:MGI Symbol;Acc:MGI:1927135])

HSP 1 Score: 137.502 bits (345), Expect = 2.769e-40
Identity = 62/129 (48.06%), Postives = 89/129 (68.99%), Query Frame = 2
Query:  110 LIICNVSESLKEILNQFKFNKCKTNSALIVKVNKTLMELELDQKLEDVDVDELCNELPSHEPRFVVLSYVFKQVDGRISYPYCLIFSTPIGCKPELQMMYAGSFNNLVSIGQITKSFEVRNPEEISVEW 496
            L++C V   LKE L +F+F K   N+A+I+KV+K    + L+ +L+++  +EL  ELP  +PRFVV SY +   DGR+SYP C IFS+P+GCKPE QMMYAGS N LV   ++TK FE+R  ++++  W
Sbjct:    5 LVVCEVDPELKETLRKFRFRKETNNAAIIMKVDKDRQMVVLEDELQNISPEELKLELPERQPRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKVFEIRTTDDLTETW 133          
BLAST of Glia maturation factor vs. Ensembl Mouse
Match: Gmfg (glia maturation factor, gamma [Source:MGI Symbol;Acc:MGI:1927135])

HSP 1 Score: 137.502 bits (345), Expect = 2.769e-40
Identity = 62/129 (48.06%), Postives = 89/129 (68.99%), Query Frame = 2
Query:  110 LIICNVSESLKEILNQFKFNKCKTNSALIVKVNKTLMELELDQKLEDVDVDELCNELPSHEPRFVVLSYVFKQVDGRISYPYCLIFSTPIGCKPELQMMYAGSFNNLVSIGQITKSFEVRNPEEISVEW 496
            L++C V   LKE L +F+F K   N+A+I+KV+K    + L+ +L+++  +EL  ELP  +PRFVV SY +   DGR+SYP C IFS+P+GCKPE QMMYAGS N LV   ++TK FE+R  ++++  W
Sbjct:    5 LVVCEVDPELKETLRKFRFRKETNNAAIIMKVDKDRQMVVLEDELQNISPEELKLELPERQPRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKVFEIRTTDDLTETW 133          
BLAST of Glia maturation factor vs. Ensembl Mouse
Match: Gmfb (glia maturation factor, beta [Source:MGI Symbol;Acc:MGI:1927133])

HSP 1 Score: 137.887 bits (346), Expect = 3.409e-40
Identity = 66/141 (46.81%), Postives = 94/141 (66.67%), Query Frame = 2
Query:  110 LIICNVSESLKEILNQFKFNKCKTNSALIVKVNKTLMELELDQKLEDVDVDELCNELPSHEPRFVVLS------------YVFKQVDGRISYPYCLIFSTPIGCKPELQMMYAGSFNNLVSIGQITKSFEVRNPEEISVEW 496
            L++C+V+E L E L +F+F K   N+A+I+K++K    + LD++LE V  DEL +ELP  +PR+  LS            Y ++  DGR+SYP C IFS+P+GCKPE QMMYAGS N LV   ++TK FE+RN E+++ EW
Sbjct:    6 LVVCDVAEDLVEKLRKFRFRKETHNAAIIMKIDKDERLVVLDEELEGVSPDELKDELPERQPRYPFLSGLEIFVRYQDFIYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEW 146          
BLAST of Glia maturation factor vs. UniProt/SwissProt
Match: sp|Q9CQI3|GMFB_MOUSE (Glia maturation factor beta OS=Mus musculus OX=10090 GN=Gmfb PE=1 SV=3)

HSP 1 Score: 150.599 bits (379), Expect = 2.106e-44
Identity = 67/129 (51.94%), Postives = 95/129 (73.64%), Query Frame = 2
Query:  110 LIICNVSESLKEILNQFKFNKCKTNSALIVKVNKTLMELELDQKLEDVDVDELCNELPSHEPRFVVLSYVFKQVDGRISYPYCLIFSTPIGCKPELQMMYAGSFNNLVSIGQITKSFEVRNPEEISVEW 496
            L++C+V+E L E L +F+F K   N+A+I+K++K    + LD++LE V  DEL +ELP  +PRF+V SY ++  DGR+SYP C IFS+P+GCKPE QMMYAGS N LV   ++TK FE+RN E+++ EW
Sbjct:    5 LVVCDVAEDLVEKLRKFRFRKETHNAAIIMKIDKDERLVVLDEELEGVSPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEW 133          
BLAST of Glia maturation factor vs. UniProt/SwissProt
Match: sp|Q5R6P6|GMFB_PONAB (Glia maturation factor beta OS=Pongo abelii OX=9601 GN=GMFB PE=2 SV=3)

HSP 1 Score: 150.214 bits (378), Expect = 2.152e-44
Identity = 66/129 (51.16%), Postives = 95/129 (73.64%), Query Frame = 2
Query:  110 LIICNVSESLKEILNQFKFNKCKTNSALIVKVNKTLMELELDQKLEDVDVDELCNELPSHEPRFVVLSYVFKQVDGRISYPYCLIFSTPIGCKPELQMMYAGSFNNLVSIGQITKSFEVRNPEEISVEW 496
            L++C+V+E L E L +F+F K   N+A+I+K++K    + LD++LE +  DEL +ELP  +PRF+V SY ++  DGR+SYP C IFS+P+GCKPE QMMYAGS N LV   ++TK FE+RN E+++ EW
Sbjct:    5 LVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEW 133          
BLAST of Glia maturation factor vs. UniProt/SwissProt
Match: sp|P60983|GMFB_HUMAN (Glia maturation factor beta OS=Homo sapiens OX=9606 GN=GMFB PE=1 SV=2)

HSP 1 Score: 150.214 bits (378), Expect = 2.152e-44
Identity = 66/129 (51.16%), Postives = 95/129 (73.64%), Query Frame = 2
Query:  110 LIICNVSESLKEILNQFKFNKCKTNSALIVKVNKTLMELELDQKLEDVDVDELCNELPSHEPRFVVLSYVFKQVDGRISYPYCLIFSTPIGCKPELQMMYAGSFNNLVSIGQITKSFEVRNPEEISVEW 496
            L++C+V+E L E L +F+F K   N+A+I+K++K    + LD++LE +  DEL +ELP  +PRF+V SY ++  DGR+SYP C IFS+P+GCKPE QMMYAGS N LV   ++TK FE+RN E+++ EW
Sbjct:    5 LVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEW 133          
BLAST of Glia maturation factor vs. UniProt/SwissProt
Match: sp|P60984|GMFB_BOVIN (Glia maturation factor beta OS=Bos taurus OX=9913 GN=GMFB PE=1 SV=2)

HSP 1 Score: 150.214 bits (378), Expect = 2.152e-44
Identity = 66/129 (51.16%), Postives = 95/129 (73.64%), Query Frame = 2
Query:  110 LIICNVSESLKEILNQFKFNKCKTNSALIVKVNKTLMELELDQKLEDVDVDELCNELPSHEPRFVVLSYVFKQVDGRISYPYCLIFSTPIGCKPELQMMYAGSFNNLVSIGQITKSFEVRNPEEISVEW 496
            L++C+V+E L E L +F+F K   N+A+I+K++K    + LD++LE +  DEL +ELP  +PRF+V SY ++  DGR+SYP C IFS+P+GCKPE QMMYAGS N LV   ++TK FE+RN E+++ EW
Sbjct:    5 LVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEW 133          
BLAST of Glia maturation factor vs. UniProt/SwissProt
Match: sp|Q63228|GMFB_RAT (Glia maturation factor beta OS=Rattus norvegicus OX=10116 GN=Gmfb PE=1 SV=2)

HSP 1 Score: 150.214 bits (378), Expect = 2.247e-44
Identity = 67/129 (51.94%), Postives = 95/129 (73.64%), Query Frame = 2
Query:  110 LIICNVSESLKEILNQFKFNKCKTNSALIVKVNKTLMELELDQKLEDVDVDELCNELPSHEPRFVVLSYVFKQVDGRISYPYCLIFSTPIGCKPELQMMYAGSFNNLVSIGQITKSFEVRNPEEISVEW 496
            L++C+V+E L E L +F+F K   N+A+I+K++K    + LD++LE V  DEL +ELP  +PRF+V SY ++  DGR+SYP C IFS+P+GCKPE QMMYAGS N LV   ++TK FE+RN E+++ EW
Sbjct:    5 LVVCDVAEDLVEKLRKFRFRKETHNAAIIMKIDKDKRLVVLDEELEGVSPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPLGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEW 133          
BLAST of Glia maturation factor vs. TrEMBL
Match: G1SLX0 (Glia maturation factor OS=Oryctolagus cuniculus OX=9986 GN=GMFB PE=3 SV=3)

HSP 1 Score: 150.984 bits (380), Expect = 4.139e-42
Identity = 67/129 (51.94%), Postives = 95/129 (73.64%), Query Frame = 2
Query:  110 LIICNVSESLKEILNQFKFNKCKTNSALIVKVNKTLMELELDQKLEDVDVDELCNELPSHEPRFVVLSYVFKQVDGRISYPYCLIFSTPIGCKPELQMMYAGSFNNLVSIGQITKSFEVRNPEEISVEW 496
            L++C+V+E L E L +F+F K   N+A+I+K++K    + LD++LE V  DEL +ELP  +PRF+V SY ++  DGR+SYP C IFS+P+GCKPE QMMYAGS N LV   ++TK FE+RN E+++ EW
Sbjct:    5 LVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGVSPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEW 133          
BLAST of Glia maturation factor vs. TrEMBL
Match: A0A2Y9S0H4 (Glia maturation factor OS=Physeter macrocephalus OX=9755 GN=GMFB PE=3 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 4.139e-42
Identity = 67/129 (51.94%), Postives = 95/129 (73.64%), Query Frame = 2
Query:  110 LIICNVSESLKEILNQFKFNKCKTNSALIVKVNKTLMELELDQKLEDVDVDELCNELPSHEPRFVVLSYVFKQVDGRISYPYCLIFSTPIGCKPELQMMYAGSFNNLVSIGQITKSFEVRNPEEISVEW 496
            L++C+V+E L E L +F+F K   N+A+I+K++K    + LD++LE V  DEL +ELP  +PRF+V SY ++  DGR+SYP C IFS+P+GCKPE QMMYAGS N LV   ++TK FE+RN E+++ EW
Sbjct:    5 LVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGVSPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEW 133          
BLAST of Glia maturation factor vs. TrEMBL
Match: A7VJ98 (Glia maturation factor OS=Mus musculus OX=10090 GN=Gmfb PE=2 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 4.369e-42
Identity = 67/129 (51.94%), Postives = 95/129 (73.64%), Query Frame = 2
Query:  110 LIICNVSESLKEILNQFKFNKCKTNSALIVKVNKTLMELELDQKLEDVDVDELCNELPSHEPRFVVLSYVFKQVDGRISYPYCLIFSTPIGCKPELQMMYAGSFNNLVSIGQITKSFEVRNPEEISVEW 496
            L++C+V+E L E L +F+F K   N+A+I+K++K    + LD++LE V  DEL +ELP  +PRF+V SY ++  DGR+SYP C IFS+P+GCKPE QMMYAGS N LV   ++TK FE+RN E+++ EW
Sbjct:    5 LVVCDVAEDLVEKLRKFRFRKETHNAAIIMKIDKDKRLVVLDEELEGVSPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEW 133          
BLAST of Glia maturation factor vs. TrEMBL
Match: A0A1S3I3D4 (glia maturation factor gamma isoform X1 OS=Lingula unguis OX=7574 GN=LOC106160664 PE=3 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 6.042e-42
Identity = 69/127 (54.33%), Postives = 92/127 (72.44%), Query Frame = 2
Query:  116 ICNVSESLKEILNQFKFNKCKTNSALIVKVNKTLMELELDQKLEDVDVDELCNELPSHEPRFVVLSYVFKQVDGRISYPYCLIFSTPIGCKPELQMMYAGSFNNLVSIGQITKSFEVRNPEEISVEW 496
            +C V   +KE + +FKF K K N+A+I+K++   M + LD+++ED  +D+L NELP H+PRFVV SY +   DGR+SYP C IF +PIGCKPE+QMMYAGS N LV    +TK FEVRN EE++ EW
Sbjct:    7 VCEVEPKIKETMRKFKFRKEKNNAAVILKIDMENMTVVLDEEIEDCTMDDLQNELPDHQPRFVVYSYCYNHDDGRVSYPLCFIFVSPIGCKPEMQMMYAGSKNGLVQELDVTKIFEVRNTEELTEEW 133          
BLAST of Glia maturation factor vs. TrEMBL
Match: A0A5E4BNL1 (Glia maturation factor OS=Marmota monax OX=9995 GN=MONAX_5E045418 PE=3 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 6.378e-42
Identity = 66/129 (51.16%), Postives = 95/129 (73.64%), Query Frame = 2
Query:  110 LIICNVSESLKEILNQFKFNKCKTNSALIVKVNKTLMELELDQKLEDVDVDELCNELPSHEPRFVVLSYVFKQVDGRISYPYCLIFSTPIGCKPELQMMYAGSFNNLVSIGQITKSFEVRNPEEISVEW 496
            L++C+V+E L E L +F+F K   N+A+I+K++K    + LD++LE +  DEL +ELP  +PRF+V SY ++  DGR+SYP C IFS+P+GCKPE QMMYAGS N LV   ++TK FE+RN E+++ EW
Sbjct:    5 LVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKVFEIRNTEDLTEEW 133          
BLAST of Glia maturation factor vs. Ensembl Cavefish
Match: GMFG (glia maturation factor gamma [Source:NCBI gene;Acc:103032687])

HSP 1 Score: 140.198 bits (352), Expect = 2.166e-41
Identity = 61/129 (47.29%), Postives = 91/129 (70.54%), Query Frame = 2
Query:  110 LIICNVSESLKEILNQFKFNKCKTNSALIVKVNKTLMELELDQKLEDVDVDELCNELPSHEPRFVVLSYVFKQVDGRISYPYCLIFSTPIGCKPELQMMYAGSFNNLVSIGQITKSFEVRNPEEISVEW 496
            L++C V  SL+E L +F+F K   N+A+++K++     + L+++ ED+ +D+L  ELP  +PR++V SY     DGR+SYP C IFS+P+GCKPE QMMYAGS N LV   ++TK FE+RN +++S EW
Sbjct:    5 LVVCEVDPSLQEKLKKFRFRKETNNAAILMKIDMEKQLVILEEEYEDISLDDLREELPERQPRYIVYSYKLTHGDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQSAELTKVFEIRNADDLSEEW 133          
BLAST of Glia maturation factor vs. Ensembl Cavefish
Match: gmfb (glia maturation factor, beta [Source:ZFIN;Acc:ZDB-GENE-040426-2114])

HSP 1 Score: 126.331 bits (316), Expect = 4.843e-36
Identity = 63/129 (48.84%), Postives = 90/129 (69.77%), Query Frame = 2
Query:  110 LIICNVSESLKEILNQFKFNKCKTNSALIVKVNKTLMELELDQKLEDVDVDELCNELPSHEPRFVVLSYVFKQVDGRISYPYCLIFSTPIGCKPELQMMYAGSFNNLVSIGQITKSFEVRNPEEISVEW 496
            L++C V   L + L  F+F K +TN+A I+K++K    + LD++ ED+  D+L +ELP  +P FVV SY ++  DGR+SYP C IFS+P+ CKPE QMMYAGS N LV   ++TK FE+RN E+++ EW
Sbjct:    4 LVVCEVDGDLVKKLRDFRFRK-ETNNAAIIKIDKDRQLVILDEEHEDISPDDLKDELPERQP-FVVYSYKYQHDDGRVSYPLCFIFSSPV-CKPEQQMMYAGSKNKLVQTVELTKVFEIRNTEDLTEEW 129          
BLAST of Glia maturation factor vs. Ensembl Cavefish
Match: GMFG (glia maturation factor gamma [Source:NCBI gene;Acc:103032687])

HSP 1 Score: 121.324 bits (303), Expect = 4.966e-33
Identity = 54/115 (46.96%), Postives = 80/115 (69.57%), Query Frame = 2
Query:  110 LIICNVSESLKEILNQFKFNKCKTNSALIVKVNKTLMELELDQKLEDVDVDELCNELPSHEPRFVVLSYVFKQVDGRISYPYCLIFSTPIGCKPELQMMYAGSFNNLVSIGQITK 454
            L++C V  SL+E L +F+F K   N+A+++K++     + L+++ ED+ +D+L  ELP  +PR++V SY     DGR+SYP C IFS+P+GCKPE QMMYAGS N LV   ++TK
Sbjct:    5 LVVCEVDPSLQEKLKKFRFRKETNNAAILMKIDMEKQLVILEEEYEDISLDDLREELPERQPRYIVYSYKLTHGDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQSAELTK 119          
BLAST of Glia maturation factor vs. Ensembl Cavefish
Match: GMFG (glia maturation factor gamma [Source:NCBI gene;Acc:103032687])

HSP 1 Score: 113.62 bits (283), Expect = 4.769e-31
Identity = 57/131 (43.51%), Postives = 83/131 (63.36%), Query Frame = 2
Query:  110 LIICNVSESLKEILNQFKFNKCKTNSALIVKVN--KTLMELELDQKLEDVDVDELCNELPSHEPRFVVLSYVFKQVDGRISYPYCLIFSTPIGCKPELQMMYAGSFNNLVSIGQITKSFEVRNPEEISVEW 496
            L++C V  SL+E L +F+F K   N+A+++K++  K L+ LE + ++   D    C         ++V SY     DGR+SYP C IFS+P+GCKPE QMMYAGS N LV   ++TK FE+RN +++S EW
Sbjct:   10 LVVCEVDPSLQEKLKKFRFRKETNNAAILMKIDMEKQLVILEEEYEVGSRDPSVCCT--------YIVYSYKLTHGDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQSAELTKVFEIRNADDLSEEW 132          
BLAST of Glia maturation factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009361.1 (pep scaffold:Pmarinus_7.0:GL479248:6603:17236:1 gene:ENSPMAG00000008467.1 transcript:ENSPMAT00000009361.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 142.51 bits (358), Expect = 6.238e-43
Identity = 61/129 (47.29%), Postives = 92/129 (71.32%), Query Frame = 2
Query:  110 LIICNVSESLKEILNQFKFNKCKTNSALIVKVNKTLMELELDQKLEDVDVDELCNELPSHEPRFVVLSYVFKQVDGRISYPYCLIFSTPIGCKPELQMMYAGSFNNLVSIGQITKSFEVRNPEEISVEW 496
            L++C V + LK+ L +F+F K  TN+A+I+K++K    + ++++ ED+  ++L  ELP  +PRF++ SY +   DGRISYP C IF +P+GCKPE QMMYAGS N LV   ++TK FE+R+ EE++ EW
Sbjct:    5 LVVCEVDQGLKDKLKKFRFRKETTNAAIIMKIDKDRQVVVMEEEYEDISPEDLKEELPERQPRFILYSYKYHHTDGRISYPLCFIFCSPLGCKPEQQMMYAGSKNTLVQTAELTKVFEIRSVEELTEEW 133          
BLAST of Glia maturation factor vs. Ensembl Nematostella
Match: EDO33005 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STG9])

HSP 1 Score: 125.946 bits (315), Expect = 3.124e-36
Identity = 60/127 (47.24%), Postives = 86/127 (67.72%), Query Frame = 2
Query:  116 ICNVSESLKEILNQFKFNKCKTNSALIVKVNKTLMELELDQKLEDVDVDELCNELPSHEPRFVVLSYVFKQVDGRISYPYCLIFSTPIGCKPELQMMYAGSFNNLVSIGQITKSFEVRNPEEISVEW 496
            IC+V   L +   +F+  K KTN+ALI+K++     ++ D+  ED+ +D+L +ELP H P +V+ SY +K  DGR+SYP C IF +P GCKPELQMMYAGS  NL+     TK FE+R+ EE++ +W
Sbjct:    7 ICDVDPELVKNAKKFRLRKEKTNAALIMKIDVEKQVIKEDELHEDISIDDLRDELPEHLPSYVLFSYCYKHDDGRVSYPLCFIFISPQGCKPELQMMYAGSKLNLIKELDATKIFELRSLEELTEDW 133          
BLAST of Glia maturation factor vs. Ensembl Medaka
Match: ENSORLT00000006312.2 (glia maturation factor gamma [Source:NCBI gene;Acc:101165330])

HSP 1 Score: 144.821 bits (364), Expect = 3.068e-43
Identity = 64/129 (49.61%), Postives = 92/129 (71.32%), Query Frame = 2
Query:  110 LIICNVSESLKEILNQFKFNKCKTNSALIVKVNKTLMELELDQKLEDVDVDELCNELPSHEPRFVVLSYVFKQVDGRISYPYCLIFSTPIGCKPELQMMYAGSFNNLVSIGQITKSFEVRNPEEISVEW 496
            L++C V ESLKE L +F+F K   N+A+++K++     + L+++ ED+ ++EL NELP  +PRF+V SY +   DGR+SYP C IFS+P+GCKPE QMMYAGS N LV    +TK FE RN ++++ EW
Sbjct:    5 LVVCEVDESLKEKLKKFRFRKETNNAAILMKIDMKKQLVILEEEYEDISMEELRNELPERQPRFIVYSYKYVHADGRVSYPLCFIFSSPMGCKPEQQMMYAGSKNRLVQSADLTKVFETRNVDDLTEEW 133          
BLAST of Glia maturation factor vs. Ensembl Medaka
Match: gmfb (glia maturation factor beta [Source:NCBI gene;Acc:105356882])

HSP 1 Score: 145.976 bits (367), Expect = 7.280e-43
Identity = 63/129 (48.84%), Postives = 94/129 (72.87%), Query Frame = 2
Query:  110 LIICNVSESLKEILNQFKFNKCKTNSALIVKVNKTLMELELDQKLEDVDVDELCNELPSHEPRFVVLSYVFKQVDGRISYPYCLIFSTPIGCKPELQMMYAGSFNNLVSIGQITKSFEVRNPEEISVEW 496
            L++C+V E L + L QF+F K   N+A+++K++K    + LD++ ED+  D+L +ELP  +PRF+V SY ++  DGR+SYP C IFS+P+GC+PE QMMYAGS N LV   ++TK FE+RN E+++ EW
Sbjct:   62 LVVCDVDEDLVKKLRQFRFRKETNNAAIVMKIDKDRQLVILDEEHEDISPDDLKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCRPEQQMMYAGSKNKLVQTVELTKVFEIRNTEDLTEEW 190          
BLAST of Glia maturation factor vs. Ensembl Medaka
Match: gmfb (glia maturation factor beta [Source:NCBI gene;Acc:105356882])

HSP 1 Score: 127.487 bits (319), Expect = 1.697e-36
Identity = 58/129 (44.96%), Postives = 87/129 (67.44%), Query Frame = 2
Query:  110 LIICNVSESLKEILNQFKFNKCKTNSALIVKVNKTLMELELDQKLEDVDVDELCNELPSHEPRFVVLSYVFKQVDGRISYPYCLIFSTPIGCKPELQMMYAGSFNNLVSIGQITKSFEVRNPEEISVEW 496
            L++C+V E L + L QF+F K   N+A+++K++K    + LD++ ED+  D+L +ELP          Y ++  DGR+SYP C IFS+P+GC+PE QMMYAGS N LV   ++TK FE+RN E+++ EW
Sbjct:    4 LVVCDVDEDLVKKLRQFRFRKETNNAAIVMKIDKDRQLVILDEEHEDISPDDLKDELPER-------HYKYQHDDGRVSYPLCFIFSSPVGCRPEQQMMYAGSKNKLVQTVELTKVFEIRNTEDLTEEW 125          
BLAST of Glia maturation factor vs. Planmine SMEST
Match: SMESG000079306.1 (SMESG000079306.1)

HSP 1 Score: 195.282 bits (495), Expect = 1.129e-63
Identity = 93/93 (100.00%), Postives = 93/93 (100.00%), Query Frame = 2
Query:  218 MELELDQKLEDVDVDELCNELPSHEPRFVVLSYVFKQVDGRISYPYCLIFSTPIGCKPELQMMYAGSFNNLVSIGQITKSFEVRNPEEISVEW 496
            MELELDQKLEDVDVDELCNELPSHEPRFVVLSYVFKQVDGRISYPYCLIFSTPIGCKPELQMMYAGSFNNLVSIGQITKSFEVRNPEEISVEW
Sbjct:    1 MELELDQKLEDVDVDELCNELPSHEPRFVVLSYVFKQVDGRISYPYCLIFSTPIGCKPELQMMYAGSFNNLVSIGQITKSFEVRNPEEISVEW 93          
The following BLAST results are available for this feature:
BLAST of Glia maturation factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GMFB4.481e-4551.16glia maturation factor beta [Source:HGNC Symbol;Ac... [more]
GMFB4.481e-4551.16glia maturation factor beta [Source:HGNC Symbol;Ac... [more]
GMFB3.435e-4350.77glia maturation factor beta [Source:HGNC Symbol;Ac... [more]
GMFG4.698e-3946.51glia maturation factor gamma [Source:HGNC Symbol;A... [more]
GMFG2.552e-3448.70glia maturation factor gamma [Source:HGNC Symbol;A... [more]
back to top
BLAST of Glia maturation factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Y50D7A.101.065e-3144.53pep chromosome:WBcel235:III:315460:321721:1 gene:W... [more]
back to top
BLAST of Glia maturation factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
GMF1.035e-3142.52gene:FBgn0028894 transcript:FBtr0080851[more]
back to top
BLAST of Glia maturation factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gmfb4.855e-4249.61glia maturation factor, beta [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Glia maturation factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
gmfb3.469e-4248.84glia maturation factor, beta [Source:NCBI gene;Acc... [more]
gmfb2.915e-3946.51glia maturation factor, beta [Source:NCBI gene;Acc... [more]
gmfg1.329e-948.08glia maturation factor, gamma [Source:NCBI gene;Ac... [more]
back to top
BLAST of Glia maturation factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gmfb3.010e-4551.94glia maturation factor, beta [Source:MGI Symbol;Ac... [more]
Gmfb3.010e-4551.94glia maturation factor, beta [Source:MGI Symbol;Ac... [more]
Gmfg2.769e-4048.06glia maturation factor, gamma [Source:MGI Symbol;A... [more]
Gmfg2.769e-4048.06glia maturation factor, gamma [Source:MGI Symbol;A... [more]
Gmfb3.409e-4046.81glia maturation factor, beta [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Glia maturation factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9CQI3|GMFB_MOUSE2.106e-4451.94Glia maturation factor beta OS=Mus musculus OX=100... [more]
sp|Q5R6P6|GMFB_PONAB2.152e-4451.16Glia maturation factor beta OS=Pongo abelii OX=960... [more]
sp|P60983|GMFB_HUMAN2.152e-4451.16Glia maturation factor beta OS=Homo sapiens OX=960... [more]
sp|P60984|GMFB_BOVIN2.152e-4451.16Glia maturation factor beta OS=Bos taurus OX=9913 ... [more]
sp|Q63228|GMFB_RAT2.247e-4451.94Glia maturation factor beta OS=Rattus norvegicus O... [more]
back to top
BLAST of Glia maturation factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G1SLX04.139e-4251.94Glia maturation factor OS=Oryctolagus cuniculus OX... [more]
A0A2Y9S0H44.139e-4251.94Glia maturation factor OS=Physeter macrocephalus O... [more]
A7VJ984.369e-4251.94Glia maturation factor OS=Mus musculus OX=10090 GN... [more]
A0A1S3I3D46.042e-4254.33glia maturation factor gamma isoform X1 OS=Lingula... [more]
A0A5E4BNL16.378e-4251.16Glia maturation factor OS=Marmota monax OX=9995 GN... [more]
back to top
BLAST of Glia maturation factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
GMFG2.166e-4147.29glia maturation factor gamma [Source:NCBI gene;Acc... [more]
gmfb4.843e-3648.84glia maturation factor, beta [Source:ZFIN;Acc:ZDB-... [more]
GMFG4.966e-3346.96glia maturation factor gamma [Source:NCBI gene;Acc... [more]
GMFG4.769e-3143.51glia maturation factor gamma [Source:NCBI gene;Acc... [more]
back to top
BLAST of Glia maturation factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000009361.16.238e-4347.29pep scaffold:Pmarinus_7.0:GL479248:6603:17236:1 ge... [more]
back to top
BLAST of Glia maturation factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glia maturation factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO330053.124e-3647.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glia maturation factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSORLT00000006312.23.068e-4349.61glia maturation factor gamma [Source:NCBI gene;Acc... [more]
gmfb7.280e-4348.84glia maturation factor beta [Source:NCBI gene;Acc:... [more]
gmfb1.697e-3644.96glia maturation factor beta [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Glia maturation factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000079306.11.129e-63100.00SMESG000079306.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022205 ID=SMED30022205|Name=Glia maturation factor|organism=Schmidtea mediterranea sexual|type=transcript|length=834bp
GAAATATAATATAGTTACAAACTGATAATATTTATTTAATTGTTAATTCT
TAAGAATAACAAATATATTTTTATTAAATTTTAATTAGAATTAAATGGCT
AACACAAATTTGATAATATGCAATGTTTCTGAATCTTTAAAAGAAATTTT
AAATCAATTTAAATTTAATAAATGCAAAACCAACAGTGCTCTAATTGTTA
AAGTTAATAAGACCTTAATGGAACTTGAATTGGATCAAAAACTAGAAGAT
GTAGATGTCGATGAATTGTGTAACGAGCTACCATCCCATGAACCAAGATT
TGTTGTTTTAAGTTATGTATTCAAGCAAGTCGATGGGCGAATTTCATATC
CTTATTGTTTAATATTTTCAACCCCAATAGGCTGTAAACCTGAACTACAA
ATGATGTACGCAGGCAGCTTTAATAATCTCGTATCGATTGGTCAAATTAC
AAAGTCGTTTGAAGTAAGAAATCCCGAGGAAATATCTGTGGAATGGCTTG
AAGAAAAACTTAAATTCTTTCGTTAATTTCGTTGAAATTATTTTTACACA
TCCGTATTCATATTAATATCTGTTGGATATTTTATTGCTTCTTGTTCCTG
ATTATTTCCATCAGAAATAATATTATTTGTTTTTATAATTTTAAGTTTAA
TTGCCGATTTTCACTTTATTTGTATCGATTTTAATTATTAAATTCATTGT
TATTGAAGTTATAATGCTGTGATTGTTGTTTTATTTGTTTTTATCGATCT
GCCTCGGGTGTTTTTTGAATAGGCGTAAGGTGATGGGATACAGACATGTA
TGACTTGCATCGTTTTAGAAGGGGCTCAAAATAT
back to top

protein sequence of SMED30022205-orf-1

>SMED30022205-orf-1 ID=SMED30022205-orf-1|Name=SMED30022205-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=144bp
MANTNLIICNVSESLKEILNQFKFNKCKTNSALIVKVNKTLMELELDQKL
EDVDVDELCNELPSHEPRFVVLSYVFKQVDGRISYPYCLIFSTPIGCKPE
LQMMYAGSFNNLVSIGQITKSFEVRNPEEISVEWLEEKLKFFR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:2000249regulation of actin cytoskeleton reorganization
GO:0034316negative regulation of Arp2/3 complex-mediated actin nucleation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR002108ADF-H
IPR029006ADF-H/Gelsolin-like_dom_sf
IPR011171GMF
Vocabulary: molecular function
TermDefinition
GO:0003779actin binding
GO:0071933Arp2/3 complex binding
GO:0008083growth factor activity
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002108Actin-depolymerising factor homology domainSMARTSM00102adf_2coord: 13..140
e-value: 9.8E-22
score: 88.2
IPR002108Actin-depolymerising factor homology domainPFAMPF00241Cofilin_ADFcoord: 16..138
e-value: 2.0E-25
score: 88.9
IPR002108Actin-depolymerising factor homology domainPROSITEPS51263ADF_Hcoord: 5..140
score: 16.787
IPR029006ADF-H/Gelsolin-like domain superfamilyGENE3DG3DSA:3.40.20.10coord: 1..141
e-value: 1.0E-34
score: 121.0
IPR011171Glia maturation factorPIRSFPIRSF001788GMF-betacoord: 1..142
e-value: 3.9E-49
score: 163.7
IPR011171Glia maturation factorPANTHERPTHR11249GLIAL FACTOR NATURATION FACTORcoord: 4..143
IPR011171Glia maturation factorCDDcd11283ADF_GMF-beta_likecoord: 11..131
e-value: 6.25536E-52
score: 158.939
NoneNo IPR availableSUPERFAMILYSSF55753Actin depolymerizing proteinscoord: 6..140