SMED30022195

Overview
NameSMED30022195
Smed IDSMED30022195
Length (bp)3500
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30022195 (SMED30022195) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30022195 (SMED30022195) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022195

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30022195h1SMcG0019908 SmedASXL_007689SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30022195 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.002391:50366..56080 +17028
Homology
BLAST of SMED30022195 vs. TrEMBL
Match: A0A087TB62 (Uncharacterized protein (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_12308 PE=4 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 9.449e-12
Identity = 36/83 (43.37%), Postives = 53/83 (63.86%), Query Frame = 1
Query:  865 KKLLNLGLV-IFRTCSSSNLVV---LVTNHLKCFGVKFETDIVSSTSDAWSMIMKYGREYPVIYQPYLNHGLQLGVCGTLYKK 1101
            +K ++LGLV IF +C++        LV  HL+ FG+ F+ DIVS+T D  S+++K+G+E P  YQ  L H L L V  T+YK+
Sbjct:   47 QKSIDLGLVRIFGSCNAKKKKKKRELVEEHLESFGLSFKHDIVSNTGDGASVMIKFGKESPAFYQTCLAHALHLAVTKTVYKE 129          

HSP 2 Score: 33.4982 bits (75), Expect = 9.449e-12
Identity = 13/28 (46.43%), Postives = 21/28 (75.00%), Query Frame = 2
Query:  773 VTQNNKFIFTLDECTSIRKKRFLDINLH 856
            + ++ +F  T+DE TSI  +RFL+I+LH
Sbjct:   16 IAESKEFSITMDEWTSIGNRRFLNISLH 43          
BLAST of SMED30022195 vs. TrEMBL
Match: A0A0J7KNG8 (Dimer_Tnp_hAT domain-containing protein OS=Lasius niger OX=67767 GN=RF55_8155 PE=4 SV=1)

HSP 1 Score: 53.5286 bits (127), Expect = 3.800e-11
Identity = 30/79 (37.97%), Postives = 44/79 (55.70%), Query Frame = 1
Query:  865 KKLLNLGLVIFRTCSSSNLVV-LVTNHLKCFGVKFETDIVSSTSDAWSMIMKYGREYPVIYQPYLNHGLQLGVCGTLYK 1098
            K+  NLGL+  +  SS+   V LV  HLK F +  + DIV+ T+D  ++++K G   P   Q    HG+QL +   LYK
Sbjct:   96 KQHRNLGLIRIQGSSSAEHCVNLVEEHLKIFNINIKDDIVAITADGPNVMIKVGNLMPCFQQRCFAHGIQLAIIDILYK 174          

HSP 2 Score: 46.2098 bits (108), Expect = 3.800e-11
Identity = 22/43 (51.16%), Postives = 30/43 (69.77%), Query Frame = 2
Query:  740 KKEVIEQLQPLVTQNNKFIFTLDECTSIRKKRFLDINLHSDKK 868
            K  +I ++Q L  QN KF  T DE TS + +R+L+INLHSDK+
Sbjct:   55 KANMINEIQKLQMQNQKFSLTFDEWTSRKNRRYLNINLHSDKQ 97          
BLAST of SMED30022195 vs. TrEMBL
Match: A0A4C1U3K8 (Uncharacterized protein OS=Eumeta variegata OX=151549 GN=EVAR_16560_1 PE=4 SV=1)

HSP 1 Score: 44.669 bits (104), Expect = 9.464e-10
Identity = 17/37 (45.95%), Postives = 29/37 (78.38%), Query Frame = 2
Query:  752 IEQLQPLVTQNNKFIFTLDECTSIRKKRFLDINLHSD 862
            + +LQ +++ + KF  TLD+ TS++ +R+L+INLHSD
Sbjct:   51 VSKLQAIISSDGKFSLTLDDWTSLKNRRYLNINLHSD 87          

HSP 2 Score: 42.3578 bits (98), Expect = 9.464e-10
Identity = 29/92 (31.52%), Postives = 47/92 (51.09%), Query Frame = 1
Query:  871 LLNLGLVIFR-TCSSSNLVVLVTNHLKCFGVKFETDIVSSTSDAWSMIMKYGREYPVIYQPYLNHGLQLGVCGTLYKK*YYIIMQ-KTMKSI 1140
            + NL LV     CS+  +  +V   L  FG+  E  IV+ T+D  +++ K+G+E P      +NH L L V   + K+   I+ + KT + I
Sbjct:   91 VFNLELVFMPGKCSAVGMRDMVLKQLDKFGLNLECYIVACTTDGAAVMQKFGKESPTKMMLCINHALHLTVIDVICKRKTTIVDEDKTYEDI 182          

HSP 3 Score: 27.335 bits (59), Expect = 9.464e-10
Identity = 14/41 (34.15%), Postives = 24/41 (58.54%), Query Frame = 3
Query: 1200 SNDNGNEFQESLNA----NESLEKVRKIVKFFKYSTIKNGF 1310
            S+DN     E++      ++++E VRKIVK F+ + + NG 
Sbjct:  197 SDDNLARVPETVTTRPYISQAIEDVRKIVKLFRKNPMYNGI 237          
BLAST of SMED30022195 vs. TrEMBL
Match: A0A2A4J235 (BED-type domain-containing protein OS=Heliothis virescens OX=7102 GN=B5V51_8278 PE=4 SV=1)

HSP 1 Score: 53.9138 bits (128), Expect = 4.084e-9
Identity = 29/79 (36.71%), Postives = 42/79 (53.16%), Query Frame = 1
Query:  868 KLLNLGLV-IFRTCSSSNLVVLVTNHLKCFGVKFETDIVSSTSDAWSMIMKYGREYPVIYQPYLNHGLQLGVCGTLYKK 1101
            K  NLGL+ I+ +  +   V  +   L  FGV  E DIV+ T+D  SM+ K+G+     +Q  + H LQL +    YKK
Sbjct:  206 KFKNLGLIRIYGSLPAKKCVEEIKRKLDEFGVSLEKDIVAETTDGCSMMTKFGKFLSSYHQKCIAHALQLAIADVFYKK 284          

HSP 2 Score: 38.891 bits (89), Expect = 4.084e-9
Identity = 16/34 (47.06%), Postives = 26/34 (76.47%), Query Frame = 2
Query:  758 QLQPLVTQNNKFIFTLDECTSIRKKRFLDINLHS 859
            ++Q L+ +++KF  + DE TSIR +R+L +NLHS
Sbjct:  165 EIQNLLKEHHKFSISFDEWTSIRNRRYLSLNLHS 198          
BLAST of SMED30022195 vs. TrEMBL
Match: A0A2A4J3N7 (BED-type domain-containing protein OS=Heliothis virescens OX=7102 GN=B5V51_8277 PE=4 SV=1)

HSP 1 Score: 53.1434 bits (126), Expect = 8.809e-9
Identity = 29/79 (36.71%), Postives = 42/79 (53.16%), Query Frame = 1
Query:  868 KLLNLGLV-IFRTCSSSNLVVLVTNHLKCFGVKFETDIVSSTSDAWSMIMKYGREYPVIYQPYLNHGLQLGVCGTLYKK 1101
            K  NLGL+ I+ +  +   V  +   L  FGV  E DIV+ T+D  SM+ K+G+     +Q  + H LQL +    YKK
Sbjct:  936 KFKNLGLIRIYGSLPAKKCVEEIKRKLDEFGVSLEKDIVAETTDGCSMMTKFGKFLSSYHQKCIAHALQLAIADVFYKK 1014          

HSP 2 Score: 38.5058 bits (88), Expect = 8.809e-9
Identity = 16/34 (47.06%), Postives = 26/34 (76.47%), Query Frame = 2
Query:  758 QLQPLVTQNNKFIFTLDECTSIRKKRFLDINLHS 859
            ++Q L+ +++KF  + DE TSIR +R+L +NLHS
Sbjct:  895 EIQNLLKEHHKFSISFDEWTSIRNRRYLSLNLHS 928          
BLAST of SMED30022195 vs. Planmine SMEST
Match: SMESG000072294.1 (SMESG000072294.1)

HSP 1 Score: 290.812 bits (743), Expect = 2.139e-158
Identity = 141/143 (98.60%), Postives = 142/143 (99.30%), Query Frame = 2
Query: 2030 AFPKVVITPSSFKFNTVMVCSSDNFQNYKYIWKCNYNKNMYNLEKLKNSLNIPVELKYFVSSLQVSGNKLTFSPFWLAFDVHCNCTLYTAKDNIELPEVASFVVPKSDLPLFSYIGINCSFPCTYYSKFSYVLTISMTLNYEG 2458
            AFPKVVITPSSFKFNTVMVCSSDNFQNYKYIWKCNYNKNMYNLEKLKNSLNIPVELKYFVSSLQVSGNKLTFSPFWLAFDVHCNCTLYTAKDNIELPEVASFVVPKSDLPLFSYIGINCSFPCTY+SKFSYVLTISMTLNYE 
Sbjct:  150 AFPKVVITPSSFKFNTVMVCSSDNFQNYKYIWKCNYNKNMYNLEKLKNSLNIPVELKYFVSSLQVSGNKLTFSPFWLAFDVHCNCTLYTAKDNIELPEVASFVVPKSDLPLFSYIGINCSFPCTYFSKFSYVLTISMTLNYED 292          

HSP 2 Score: 290.041 bits (741), Expect = 2.139e-158
Identity = 143/165 (86.67%), Postives = 147/165 (89.09%), Query Frame = 3
Query: 2454 KVGRSFSFYPLRHFTVISPSMCISLNWILYWKYTYSIITAGYWPIMIMNYHLKYAVNSSIFTENLAIGSFVEFKCLSDSNVSGAFMAVYVFSLHPLSEINSFYIKDKALKLLPNTHFQQEVHIKCAIFFIVKNLFLWCRFINLGDITRRLIINKMRLNSVEFLKQ 2948
            +VGRSFSFYPLRHFTVISPSMCISLNWILYWKYTYSIITAGYWPIMIMNYHLKYAVNSSIFTENLAIGSFVEFKCLS+SNV               SEINSFYIKDKALKLLPNTHFQQEVHIKCAIFFIVKNLFLWCRFINLGDITRRLIINKMRLNS+  +K 
Sbjct:  314 QVGRSFSFYPLRHFTVISPSMCISLNWILYWKYTYSIITAGYWPIMIMNYHLKYAVNSSIFTENLAIGSFVEFKCLSNSNV---------------SEINSFYIKDKALKLLPNTHFQQEVHIKCAIFFIVKNLFLWCRFINLGDITRRLIINKMRLNSLAIIKS 463          
BLAST of SMED30022195 vs. Planmine SMEST
Match: SMESG000072294.1 (SMESG000072294.1)

HSP 1 Score: 290.812 bits (743), Expect = 2.139e-158
Identity = 141/143 (98.60%), Postives = 142/143 (99.30%), Query Frame = 2
Query: 2030 AFPKVVITPSSFKFNTVMVCSSDNFQNYKYIWKCNYNKNMYNLEKLKNSLNIPVELKYFVSSLQVSGNKLTFSPFWLAFDVHCNCTLYTAKDNIELPEVASFVVPKSDLPLFSYIGINCSFPCTYYSKFSYVLTISMTLNYEG 2458
            AFPKVVITPSSFKFNTVMVCSSDNFQNYKYIWKCNYNKNMYNLEKLKNSLNIPVELKYFVSSLQVSGNKLTFSPFWLAFDVHCNCTLYTAKDNIELPEVASFVVPKSDLPLFSYIGINCSFPCTY+SKFSYVLTISMTLNYE 
Sbjct:  149 AFPKVVITPSSFKFNTVMVCSSDNFQNYKYIWKCNYNKNMYNLEKLKNSLNIPVELKYFVSSLQVSGNKLTFSPFWLAFDVHCNCTLYTAKDNIELPEVASFVVPKSDLPLFSYIGINCSFPCTYFSKFSYVLTISMTLNYED 291          

HSP 2 Score: 290.041 bits (741), Expect = 2.139e-158
Identity = 143/165 (86.67%), Postives = 147/165 (89.09%), Query Frame = 3
Query: 2454 KVGRSFSFYPLRHFTVISPSMCISLNWILYWKYTYSIITAGYWPIMIMNYHLKYAVNSSIFTENLAIGSFVEFKCLSDSNVSGAFMAVYVFSLHPLSEINSFYIKDKALKLLPNTHFQQEVHIKCAIFFIVKNLFLWCRFINLGDITRRLIINKMRLNSVEFLKQ 2948
            +VGRSFSFYPLRHFTVISPSMCISLNWILYWKYTYSIITAGYWPIMIMNYHLKYAVNSSIFTENLAIGSFVEFKCLS+SNV               SEINSFYIKDKALKLLPNTHFQQEVHIKCAIFFIVKNLFLWCRFINLGDITRRLIINKMRLNS+  +K 
Sbjct:  313 QVGRSFSFYPLRHFTVISPSMCISLNWILYWKYTYSIITAGYWPIMIMNYHLKYAVNSSIFTENLAIGSFVEFKCLSNSNV---------------SEINSFYIKDKALKLLPNTHFQQEVHIKCAIFFIVKNLFLWCRFINLGDITRRLIINKMRLNSLAIIKS 462          
BLAST of SMED30022195 vs. Planmine SMEST
Match: SMESG000072294.1 (SMESG000072294.1)

HSP 1 Score: 178.718 bits (452), Expect = 4.514e-50
Identity = 91/123 (73.98%), Postives = 99/123 (80.49%), Query Frame = 3
Query: 2571 AGYWPIMIMNYHLKYAVNSSIFTENLAIGSFVEFKCLSDSNVSGAFMAVYVFSLHPLSEINSFYIKDKALKLLPNTHFQQEVHIKCAIFFIVKNLFLWCRFINLGDITRRLIINKMRLNSVEF 2939
            + Y  ++  +YHLKYAVNSSIFTENLAIGSFVEFKCLS+SNVS               EINSFYIKDKALKLLPNTHFQQEVHIKCAIFFIVKNLFLWCRFINLGDITRRLIIN    +++EF
Sbjct:  141 SAYQMLLKHDYHLKYAVNSSIFTENLAIGSFVEFKCLSNSNVS---------------EINSFYIKDKALKLLPNTHFQQEVHIKCAIFFIVKNLFLWCRFINLGDITRRLIINSNVRDALEF 248          
BLAST of SMED30022195 vs. Planmine SMEST
Match: SMESG000072317.1 (SMESG000072317.1)

HSP 1 Score: 75.0998 bits (183), Expect = 1.979e-24
Identity = 53/141 (37.59%), Postives = 69/141 (48.94%), Query Frame = 2
Query: 2033 FPKVVITPSSFKFNTVMVCSSDNFQNYKYIWKCNYNKNMYNLEKLKNSL-NIPVELKYFVSSLQVSGNKLTFSPFWLAFDVHCNCTLYTAKDNIELPEVASFVVPKSDLPLFSYIGINCSFPCTYYSKFSYVLTISMTLNY 2452
            +P   I P   KFN    C+S   Q +KY++KC Y    Y L   +N L  I  +LKYF+ S+ +S N       WL  ++ C C       N  + +  SF +P S  PLF  I INCS PC Y SK  Y L  +  LNY
Sbjct:  411 YPDPYIYPIPVKFNVGTKCTSFFSQFFKYLFKCQYKN--YTLYLNQNPLFTIEEDLKYFLKSIYISNNVFYIYEMWLKINITCECYYKFKWGNDIINKTVSFKLPISTNPLFQSISINCSEPCDYNSKTRYALEQTSKLNY 549          

HSP 2 Score: 58.5362 bits (140), Expect = 1.979e-24
Identity = 37/143 (25.87%), Postives = 62/143 (43.36%), Query Frame = 3
Query: 2475 FYPLRHFTVISPSMCISLNWILYWKYTYSIITAGYWPIMIMNYHLKYAVNSSIFTENLAIGSFVEFKCLSDSNVSGAFMAVYVFSLHPLSEINSFYIKDKALKLLPNTHFQQEVHIKCAIFFIVKNLFLWCRFINLGDITRRL 2903
            F+PL + T +    C+ L W+++W  T  +I+ G+W + +        + S+    N+AI       C            V  FS+  +  IN FYI ++ L    N      ++I C I+ I     + CR   +GDI + L
Sbjct:  579 FFPLENDTDVISFKCVKLQWMMFWYNTDDVISQGFWSLKVYTAFGNTKIMSNFLPRNVAIVKKFFLLCYMVDYQGPNATLVKTFSITSVKYINYFYIFNETLHSFANISITDYINITCGIYMINIPKPVLCRLFKIGDIYKNL 721          
BLAST of SMED30022195 vs. Planmine SMEST
Match: SMESG000072317.1 (SMESG000072317.1)

HSP 1 Score: 75.0998 bits (183), Expect = 2.148e-24
Identity = 53/141 (37.59%), Postives = 69/141 (48.94%), Query Frame = 2
Query: 2033 FPKVVITPSSFKFNTVMVCSSDNFQNYKYIWKCNYNKNMYNLEKLKNSL-NIPVELKYFVSSLQVSGNKLTFSPFWLAFDVHCNCTLYTAKDNIELPEVASFVVPKSDLPLFSYIGINCSFPCTYYSKFSYVLTISMTLNY 2452
            +P   I P   KFN    C+S   Q +KY++KC Y    Y L   +N L  I  +LKYF+ S+ +S N       WL  ++ C C       N  + +  SF +P S  PLF  I INCS PC Y SK  Y L  +  LNY
Sbjct:  408 YPDPYIYPIPVKFNVGTKCTSFFSQFFKYLFKCQYKN--YTLYLNQNPLFTIEEDLKYFLKSIYISNNVFYIYEMWLKINITCECYYKFKWGNDIINKTVSFKLPISTNPLFQSISINCSEPCDYNSKTRYALEQTSKLNY 546          

HSP 2 Score: 58.151 bits (139), Expect = 2.148e-24
Identity = 37/143 (25.87%), Postives = 62/143 (43.36%), Query Frame = 3
Query: 2475 FYPLRHFTVISPSMCISLNWILYWKYTYSIITAGYWPIMIMNYHLKYAVNSSIFTENLAIGSFVEFKCLSDSNVSGAFMAVYVFSLHPLSEINSFYIKDKALKLLPNTHFQQEVHIKCAIFFIVKNLFLWCRFINLGDITRRL 2903
            F+PL + T +    C+ L W+++W  T  +I+ G+W + +        + S+    N+AI       C            V  FS+  +  IN FYI ++ L    N      ++I C I+ I     + CR   +GDI + L
Sbjct:  576 FFPLENDTDVISFKCVKLQWMMFWYNTDDVISQGFWSLKVYTAFGNTKIMSNFLPRNVAIVKKFFLLCYMVDYQGPNATLVKTFSITSVKYINYFYIFNETLHSFANISITDYINITCGIYMINIPKPVLCRLFKIGDIYKNL 718          
The following BLAST results are available for this feature:
BLAST of SMED30022195 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022195 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022195 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022195 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022195 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022195 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022195 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022195 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A087TB629.449e-1243.37Uncharacterized protein (Fragment) OS=Stegodyphus ... [more]
A0A0J7KNG83.800e-1137.97Dimer_Tnp_hAT domain-containing protein OS=Lasius ... [more]
A0A4C1U3K89.464e-1045.95Uncharacterized protein OS=Eumeta variegata OX=151... [more]
A0A2A4J2354.084e-936.71BED-type domain-containing protein OS=Heliothis vi... [more]
A0A2A4J3N78.809e-936.71BED-type domain-containing protein OS=Heliothis vi... [more]
back to top
BLAST of SMED30022195 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022195 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022195 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022195 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022195 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022195 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000072294.12.139e-15898.60SMESG000072294.1[more]
SMESG000072294.12.139e-15898.60SMESG000072294.1[more]
SMESG000072294.14.514e-5073.98SMESG000072294.1[more]
SMESG000072317.11.979e-2437.59SMESG000072317.1[more]
SMESG000072317.12.148e-2437.59SMESG000072317.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022195 ID=SMED30022195|Name=SMED30022195|organism=Schmidtea mediterranea sexual|type=transcript|length=3500bp
AAATTATCATTTTAACACAATTGACTGTAGTATTTTATGAATTCTTTCAA
TTTTAATCAAATAAGTAAATAAATATTATTTATTTATTAAATAAATTATA
ATTATTAAATAAATATTTTGGTAAATTATTAATTATTTTTGAATAAGTTT
AAAGATTTAAGTAAGTATCTTTTCGAATTATTTGTGCTAAAGGCTAACAA
TAAATTTAAACAAATAATTAAAATAAATCATTTAAAACAATAATTAAAGA
TAAATCATTAAAACAAATAAATTCACTTAATTTACACAAAATTTAAATAT
TTTAACCCCCCGTTTAAAAAGATTTTAATTATTTTAATAACTAAGAACTC
TTAATTATTTTACTCCACAACAAAATATTAATTCGAAGCAAGCAAAACGT
AATGAATGTGGTGCAAGGTTATCCAATACGGATGGATGTACATCGCCGAT
GACCAAACATTTAAATGTTCAGTATGGAATAAGTGTAAAAAATAAAGATA
CCGAAAAATAACAAGATGAACCTATAGTTAAAAAATTTAAAACTATATTA
GATTACACCACAATATCTAAAAAACCCTAGAAGAACTTGTTACTCAGTTA
GCAATTGTCGATGGAATATCAATTAGGGCCTTAACAACACCCCAATTTAT
TCGAGAGTCAATTCTAAAATCAGTTTGTAAATATTTACCTAAAATGAAAC
CGATGTAATCAAGCTTATCCGCAACAAATTTTTTAATAAAAAAAAGAAGT
GATTGAACAACTTCAACCATTAGTAACACAAAATAATAAATTTATTTTTA
CTTTGGATGAATGTACGAGTATTCGTAAAAAGCGATTTCTAGACATTAAC
TTACATTCAGATAAAAAAAGCTTTTAAATTTAGGTTTGGTAATATTTAGA
ACATGCTCATCATCTAATTTAGTCGTTTTGGTCACAAATCATCTAAAATG
TTTTGGTGTAAAGTTTGAAACTGATATAGTATCATCAACTAGTGATGCGT
GGTCAATGATTATGAAATATGGACGAGAATATCCAGTAATATATCAGCCT
TATCTAAATCACGGTCTTCAGCTTGGAGTGTGTGGTACCCTTTATAAAAA
ATGATATTATATAATAATGCAGAAAACAATGAAATCGATAATATTTCTGA
TAACGAAGATATTTTTAAAGATGATATCGATGTAGTAAATTTAATCTGGA
GTAATGATAATGGTAATGAATTCCAAGAATCATTAAATGCAAATGAAAGT
CTTGAGAAAGTTAGAAAAATAGTGAAGTTTTTCAAATATTCAACAATTAA
AAATGGATTTGAACTTGCACAAACAATAAATTTCAACAAATTGAAGCAAA
ATTCACCTTGTTTAAAAATACCGGCAAAAGAACATCAATTTGCAGAAACT
TTATAATGCGCTTTTGACCATTTTCGTTGTCTGGCAGCTTTTGTACAAAA
ATTCGTTCTCGTTTGTCAAACAAATCCATAAATTAATTATTTTTTTAAAG
CTTTTCATTTAAACCAAAATAATTAATGTTTGTTCTTTTTATACATATAT
ACTATTTTATACTAAAAATAAATTACCATAGTCATAATTTGTTTCTTTAT
TAAAATTTTCAAATGCCCTTAATAAAATCATAATAATTTAAAATATAAAA
TCAAAATATGTTTTTGTATTTGGAATAGGATTCGGATTCGGCGGTTATCG
ATATTCAGAAACTTTAATCTGGGAAGGGGGCGCGTCTATCTACTATTAAC
GTTTTCTAAGAGAGTTATGATCAAGTTTTTCTAAAACCGTAATCAACATC
TAACTTTCAGAAAAATAATATTATAAACTATATTTTCTTTTAATTTATAG
ATGAAGATTTTCAAAATTCATATTGTTTTCGCAAATAAACCATAATTCTT
TATTTCAAAGTTTTGTTTTAATGAATAATTTGCTGTTTATTGATAAATCA
AAATATCTGTAATAAATACACGGTTTATGTAATCAGAAACGTCTTGTTTT
CAAAATTTATTAATATTAATTTTATTTAAGCATTTCCGAAAGTAGTTATC
ACACCTAGCTCATTTAAATTCAACACGGTCATGGTTTGTTCATCTGATAA
TTTTCAAAATTACAAATATATATGGAAATGCAACTATAATAAGAATATGT
ATAATTTGGAAAAACTGAAAAATTCTTTAAATATTCCTGTTGAATTAAAA
TATTTTGTTAGCTCTTTGCAAGTAAGTGGGAATAAATTGACATTTTCCCC
ATTTTGGCTTGCATTTGATGTACATTGTAATTGTACTTTATACACTGCGA
AGGATAATATTGAATTGCCCGAAGTTGCTTCATTTGTAGTTCCAAAATCT
GATTTGCCTTTATTTTCTTATATTGGTATCAATTGTTCGTTTCCTTGTAC
TTATTATTCCAAATTTTCATATGTTTTAACCATATCTATGACTTTAAATT
ACGAAGGTTGGGAGATCTTTTAGCTTTTACCCATTAAGACACTTCACTGT
TATTTCGCCTAGCATGTGCATTAGCTTGAATTGGATTTTATATTGGAAAT
ACACCTATTCCATAATTACAGCTGGATATTGGCCAATAATGATCATGAAT
TATCATCTAAAGTATGCAGTTAATTCGAGTATCTTTACTGAAAATTTAGC
AATTGGAAGTTTTGTTGAATTTAAATGTTTATCAGACTCTAATGTATCAG
GTGCTTTTATGGCTGTCTATGTTTTTTCTCTACATCCATTATCAGAAATA
AATTCCTTCTATATCAAAGACAAAGCACTCAAATTATTACCAAATACACA
TTTTCAACAGGAAGTTCATATAAAATGTGCCATATTTTTCATTGTCAAAA
ATTTATTTTTATGGTGTCGATTTATAAATCTTGGAGATATTACGAGGCGA
TTAATAATCAATAAGATGCGCTTGAATTCCGTGGAATTTCTGAAGCAAAT
TTTAATTTGAATTTAGCAGTAATTGGATAATGTGTTCAGTTGGCTATTAT
TAAAAGTTATCGTGCAAGTGAGTTATGATACAAGACTGCTTTTGTTATAA
TGTGAACTTATTTTTGTCATAAAAATATTTGGTAGTATTTTTAAAGTTTT
AAAATGCTTGGTTATTATATTTGCAATTTTGCACTCAAAAAATCAATATT
AATACATTGCTAGGGTGCATAAGGAGCATTCTATTTACAAGTGCCTCTGA
CTATAGTCATAGTTACAACTGCACTCAAAAATCGATATTGTACTTTAAAA
TATTTTGGGTGGAATTTACTACTATTTAAATTTTATTTTATTTTACAACG
GGTGTTATTTGAAAATACCGTCAACCCTGTTCAATATGAACACTAACGTT
CCGATTTTTTCAAATGTTAATATTTAAAAATAATTTGAACAGTAATTAAC
ATAACAATATAAAATATTTCACAAAAAATGTATTTATAATACTTATTTAT
TAGAATTTTTATTTCTTTGACGCATCATATAGTCTGTGATTTTCAATTGT
back to top

protein sequence of SMED30022195-orf-1

>SMED30022195-orf-1 ID=SMED30022195-orf-1|Name=SMED30022195-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=102bp
MILYNNAENNEIDNISDNEDIFKDDIDVVNLIWSNDNGNEFQESLNANES
LEKVRKIVKFFKYSTIKNGFELAQTINFNKLKQNSPCLKIPAKEHQFAET
L*
back to top

protein sequence of SMED30022195-orf-2

>SMED30022195-orf-2 ID=SMED30022195-orf-2|Name=SMED30022195-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=131bp
MVCSSDNFQNYKYIWKCNYNKNMYNLEKLKNSLNIPVELKYFVSSLQVSG
NKLTFSPFWLAFDVHCNCTLYTAKDNIELPEVASFVVPKSDLPLFSYIGI
NCSFPCTYYSKFSYVLTISMTLNYEGWEIF*
back to top

protein sequence of SMED30022195-orf-3

>SMED30022195-orf-3 ID=SMED30022195-orf-3|Name=SMED30022195-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=149bp
MCISLNWILYWKYTYSIITAGYWPIMIMNYHLKYAVNSSIFTENLAIGSF
VEFKCLSDSNVSGAFMAVYVFSLHPLSEINSFYIKDKALKLLPNTHFQQE
VHIKCAIFFIVKNLFLWCRFINLGDITRRLIINKMRLNSVEFLKQILI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 7..26