SMED30022193

Overview
NameSMED30022193
Smed IDSMED30022193
Length (bp)2625
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30022193 (SMED30022193) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30022193 (SMED30022193) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30022193 (SMED30022193) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30022193 (SMED30022193) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022193

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 31

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30022193h1SMcG0016190 SmedASXL_017962SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30022193h1SMcG0016190 SmedASXL_007249SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30022193h1SMcG0016190 dd_9493dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
cephalic gangliaSMED30022193h1SMcG0016190 dd_9493dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
pharynxSMED30022193h1SMcG0016190 dd_Smed_v4_9493_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30022193h1SMcG0016190 dd_Smed_v4_9493_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30022193h1SMcG0016190 dd_Smed_v4_9493_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30022193h1SMcG0016190 dd_Smed_v4_9493_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30022193h1SMcG0016190 dd_Smed_v4_9493_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30022193h1SMcG0016190 dd_Smed_v4_9493_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30022193h1SMcG0016190 dd_Smed_v4_9493_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30022193h1SMcG0016190 dd_Smed_v4_10646_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30022193h1SMcG0016190 dd_Smed_v4_10646_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30022193h1SMcG0016190 dd_Smed_v4_10646_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30022193h1SMcG0016190 dd_Smed_v4_10646_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30022193h1SMcG0016190 dd_Smed_v4_10646_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30022193h1SMcG0016190 dd_Smed_v4_10646_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022193h1SMcG0016190 Contig50481newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022193h1SMcG0016190 Contig50481uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022193h1SMcG0016190 Contig32589uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022193h1SMcG0016190 Contig32589newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022193h1SMcG0016190 Contig40776uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022193h1SMcG0016190 Contig40776newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022193h1SMcG0016190 Contig36839newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022193h1SMcG0016190 Contig36839uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30022193h1SMcG0016190 dd_Smed_v6_9493_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30022193h1SMcG0016190 dd_Smed_v6_10646_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30022193h1SMcG0016190 dd_Smed_v6_9493_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30022193h1SMcG0016190 dd_Smed_v6_9493_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30022193h1SMcG0016190 dd_Smed_v6_9493_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30022193h1SMcG0016190 dd_Smed_v6_10646_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30022193 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000926:94782..108567 +12558
Homology
BLAST of SMED30022193 vs. Ensembl Human
Match: LAMA2 (laminin subunit alpha 2 [Source:HGNC Symbol;Acc:HGNC:6482])

HSP 1 Score: 55.4546 bits (132), Expect = 5.733e-7
Identity = 57/231 (24.68%), Postives = 102/231 (44.16%), Query Frame = 3
Query: 1857 DAQAKSYLAENLVNQTKLMNDPEFQSRA--ENIKELVKHNLENAQQMYSQIRENLQAYNGLINNCRNMDSW--LNEAEKKMTRLGETSGYSPDDLAKNLSLLEKLAEDVKEKRNYIEKINNQGRDLTDSSPSKGKETNALLDKINNKHKKL---MENLEDKNQEVRRNIEDQKEFDESIHKAQQ---WMNDATQKLLKYSD-IKQCSPTQIDSFSRNFENIVDSVPYGEEI 2516
            D   K    +NL  Q ++  D    + A  + +K+L   +    ++M   +RE L  Y   ++     D+W  L EA  K+         +     KN++ LEK  E V+  +  IE    +G D+ D +     E N+++D + +   KL    E L DK  ++ + I+D+K   E + +A+     +ND++  L    D  K  S     +F + + NI D +   E++
Sbjct: 1722 DQMIKELRRKNLETQKEIAEDELVAAEALLKKVKKLFGESRGENEEMEKDLREKLADYKNKVD-----DAWDLLREATDKIREANRLFAVN----QKNMTALEKKKEAVESGKRQIENTLKEGNDILDEANRLADEINSIIDYVEDIQTKLPPMSEELNDKIDDLSQEIKDRK-LAEKVSQAESHAAQLNDSSAVLDGILDEAKNISFNATAAF-KAYSNIKDYIDEAEKV 1941          
BLAST of SMED30022193 vs. Ensembl Human
Match: LAMA2 (laminin subunit alpha 2 [Source:HGNC Symbol;Acc:HGNC:6482])

HSP 1 Score: 55.4546 bits (132), Expect = 5.734e-7
Identity = 57/231 (24.68%), Postives = 102/231 (44.16%), Query Frame = 3
Query: 1857 DAQAKSYLAENLVNQTKLMNDPEFQSRA--ENIKELVKHNLENAQQMYSQIRENLQAYNGLINNCRNMDSW--LNEAEKKMTRLGETSGYSPDDLAKNLSLLEKLAEDVKEKRNYIEKINNQGRDLTDSSPSKGKETNALLDKINNKHKKL---MENLEDKNQEVRRNIEDQKEFDESIHKAQQ---WMNDATQKLLKYSD-IKQCSPTQIDSFSRNFENIVDSVPYGEEI 2516
            D   K    +NL  Q ++  D    + A  + +K+L   +    ++M   +RE L  Y   ++     D+W  L EA  K+         +     KN++ LEK  E V+  +  IE    +G D+ D +     E N+++D + +   KL    E L DK  ++ + I+D+K   E + +A+     +ND++  L    D  K  S     +F + + NI D +   E++
Sbjct: 1722 DQMIKELRRKNLETQKEIAEDELVAAEALLKKVKKLFGESRGENEEMEKDLREKLADYKNKVD-----DAWDLLREATDKIREANRLFAVN----QKNMTALEKKKEAVESGKRQIENTLKEGNDILDEANRLADEINSIIDYVEDIQTKLPPMSEELNDKIDDLSQEIKDRK-LAEKVSQAESHAAQLNDSSAVLDGILDEAKNISFNATAAF-KAYSNIKDYIDEAEKV 1941          
BLAST of SMED30022193 vs. Ensembl Human
Match: LAMA2 (laminin subunit alpha 2 [Source:HGNC Symbol;Acc:HGNC:6482])

HSP 1 Score: 55.4546 bits (132), Expect = 5.782e-7
Identity = 57/231 (24.68%), Postives = 102/231 (44.16%), Query Frame = 3
Query: 1857 DAQAKSYLAENLVNQTKLMNDPEFQSRA--ENIKELVKHNLENAQQMYSQIRENLQAYNGLINNCRNMDSW--LNEAEKKMTRLGETSGYSPDDLAKNLSLLEKLAEDVKEKRNYIEKINNQGRDLTDSSPSKGKETNALLDKINNKHKKL---MENLEDKNQEVRRNIEDQKEFDESIHKAQQ---WMNDATQKLLKYSD-IKQCSPTQIDSFSRNFENIVDSVPYGEEI 2516
            D   K    +NL  Q ++  D    + A  + +K+L   +    ++M   +RE L  Y   ++     D+W  L EA  K+         +     KN++ LEK  E V+  +  IE    +G D+ D +     E N+++D + +   KL    E L DK  ++ + I+D+K   E + +A+     +ND++  L    D  K  S     +F + + NI D +   E++
Sbjct: 1722 DQMIKELRRKNLETQKEIAEDELVAAEALLKKVKKLFGESRGENEEMEKDLREKLADYKNKVD-----DAWDLLREATDKIREANRLFAVN----QKNMTALEKKKEAVESGKRQIENTLKEGNDILDEANRLADEINSIIDYVEDIQTKLPPMSEELNDKIDDLSQEIKDRK-LAEKVSQAESHAAQLNDSSAVLDGILDEAKNISFNATAAF-KAYSNIKDYIDEAEKV 1941          
BLAST of SMED30022193 vs. Ensembl Fly
Match: Msp300 (gene:FBgn0261836 transcript:FBtr0303383)

HSP 1 Score: 56.225 bits (134), Expect = 1.620e-7
Identity = 61/306 (19.93%), Postives = 136/306 (44.44%), Query Frame = 3
Query: 1542 EKLIESKSNGENLVKAAVTSGEIVAKETSLKGKEEILNGVRGLNKGFXXXXXXXXXXKQSLEMKLAKASNINRDLDALVNWAEEFE----NKLFNITDSDLDKIKLLCDDAQAKSYLAE----------NLVNQTKLMNDPEFQSRAENIKELVKHNLENAQQMYSQIRENLQAYNGLINNCRNMDSWLNEAEKKMTRLGETSGYSPDDLAKNLSLLEKLAEDVKEKRNYIEKINNQGRDLTDSSPSKGKET-NALLDKINNKHKKLMENLEDKNQEVRRNIEDQKEFDESIHKAQQWMNDATQKL 2414
            E L+  ++ GE LV+  V +GE+V   TS +G+E I N +R L   F  L   +   K++LE+ + +      + + L+ W ++ +    N   N+  +  +K K + D  +  S L +          +  +  K   D    ++  ++  + +  +  A+ +  ++  N   +     N ++   W+  A+  +   GE +G S + L + L  ++ L  + +  +N +    N G  +  ++ S G++  N  + ++  +  +L++ +     ++  N+    ++  S  + QQW+ D   KL
Sbjct: 5183 EALLNKQAQGELLVEHLVHTGEVVLASTSAQGQEIIRNDIRALRDSFEGLFREINQQKENLEVTMVQWRAYKEEYERLMEWLQQIDILVKNHKLNLCPNLPEKEKQVADMKEVMSRLEKGKDDIDKFNASAASLLKSHLDTYVNNQLRHLSSVYQVQVNLAKDVLKKVETNRDQHREYDANMKSAKDWIANAKATIQSAGEGAG-SKEALQRRLEQIQDLIRNRELGQNLVHTAINNGEKIIRNTRSDGRDAINTEMKELQTEWDRLVKKMSTAKVQLETNLLQWADYSSSYSQLQQWITDREAKL 5487          
BLAST of SMED30022193 vs. Ensembl Fly
Match: Msp300 (gene:FBgn0261836 transcript:FBtr0303389)

HSP 1 Score: 56.225 bits (134), Expect = 1.807e-7
Identity = 63/314 (20.06%), Postives = 136/314 (43.31%), Query Frame = 3
Query: 1542 EKLIESKSNGENLVKAAVTSGEIVAKETSLKGKEEILNGVRGLNKGFXXXXXXXXXXKQSLEMKLAKASNINRDLDALVNWAEEFE----NKLFNITDSDLDKIKLLCD------------------DAQAKSYLAENLVNQTKLMNDPEFQSRAENIKELVKHNLENAQQMYSQIRENLQAYNGLINNCRNMDSWLNEAEKKMTRLGETSGYSPDDLAKNLSLLEKLAEDVKEKRNYIEKINNQGRDLTDSSPSKGKET-NALLDKINNKHKKLMENLEDKNQEVRRNIEDQKEFDESIHKAQQWMNDATQKL 2414
            E L+  ++ GE LV+  V +GE+V   TS +G+E I N +R L   F  L   +   K++LE+ + +      + + L+ W ++ +    N   N+  +  +K K + D                  +A A S L  +L        D    ++  ++  + +  +  A+ +  ++  N   +     N ++   W+  A+  +   GE +G S + L + L  ++ L  + +  +N +    N G  +  ++ S G++  N  + ++  +  +L++ +     ++  N+    ++  S  + QQW+ D   KL
Sbjct: 4824 EALLNKQAQGELLVEHLVHTGEVVLASTSAQGQEIIRNDIRALRDSFEGLFREINQQKENLEVTMVQWRAYKEEYERLMEWLQQIDILVKNHKLNLCPNLPEKEKQVADMKEVMSRLEKGKDDIDKFNASAASLLKSHL--------DTYVNNQLRHLSSVYQVQVNLAKDVLKKVETNRDQHREYDANMKSAKDWIANAKATIQSAGEGAG-SKEALQRRLEQIQDLIRNRELGQNLVHTAINNGEKIIRNTRSDGRDAINTEMKELQTEWDRLVKKMSTAKVQLETNLLQWADYSSSYSQLQQWITDREAKL 5128          
BLAST of SMED30022193 vs. Ensembl Fly
Match: Msp300 (gene:FBgn0261836 transcript:FBtr0303388)

HSP 1 Score: 56.225 bits (134), Expect = 1.917e-7
Identity = 63/314 (20.06%), Postives = 136/314 (43.31%), Query Frame = 3
Query: 1542 EKLIESKSNGENLVKAAVTSGEIVAKETSLKGKEEILNGVRGLNKGFXXXXXXXXXXKQSLEMKLAKASNINRDLDALVNWAEEFE----NKLFNITDSDLDKIKLLCD------------------DAQAKSYLAENLVNQTKLMNDPEFQSRAENIKELVKHNLENAQQMYSQIRENLQAYNGLINNCRNMDSWLNEAEKKMTRLGETSGYSPDDLAKNLSLLEKLAEDVKEKRNYIEKINNQGRDLTDSSPSKGKET-NALLDKINNKHKKLMENLEDKNQEVRRNIEDQKEFDESIHKAQQWMNDATQKL 2414
            E L+  ++ GE LV+  V +GE+V   TS +G+E I N +R L   F  L   +   K++LE+ + +      + + L+ W ++ +    N   N+  +  +K K + D                  +A A S L  +L        D    ++  ++  + +  +  A+ +  ++  N   +     N ++   W+  A+  +   GE +G S + L + L  ++ L  + +  +N +    N G  +  ++ S G++  N  + ++  +  +L++ +     ++  N+    ++  S  + QQW+ D   KL
Sbjct: 4824 EALLNKQAQGELLVEHLVHTGEVVLASTSAQGQEIIRNDIRALRDSFEGLFREINQQKENLEVTMVQWRAYKEEYERLMEWLQQIDILVKNHKLNLCPNLPEKEKQVADMKEVMSRLEKGKDDIDKFNASAASLLKSHL--------DTYVNNQLRHLSSVYQVQVNLAKDVLKKVETNRDQHREYDANMKSAKDWIANAKATIQSAGEGAG-SKEALQRRLEQIQDLIRNRELGQNLVHTAINNGEKIIRNTRSDGRDAINTEMKELQTEWDRLVKKMSTAKVQLETNLLQWADYSSSYSQLQQWITDREAKL 5128          
BLAST of SMED30022193 vs. Ensembl Fly
Match: Msp300 (gene:FBgn0261836 transcript:FBtr0332405)

HSP 1 Score: 55.8398 bits (133), Expect = 1.984e-7
Identity = 63/314 (20.06%), Postives = 136/314 (43.31%), Query Frame = 3
Query: 1542 EKLIESKSNGENLVKAAVTSGEIVAKETSLKGKEEILNGVRGLNKGFXXXXXXXXXXKQSLEMKLAKASNINRDLDALVNWAEEFE----NKLFNITDSDLDKIKLLCD------------------DAQAKSYLAENLVNQTKLMNDPEFQSRAENIKELVKHNLENAQQMYSQIRENLQAYNGLINNCRNMDSWLNEAEKKMTRLGETSGYSPDDLAKNLSLLEKLAEDVKEKRNYIEKINNQGRDLTDSSPSKGKET-NALLDKINNKHKKLMENLEDKNQEVRRNIEDQKEFDESIHKAQQWMNDATQKL 2414
            E L+  ++ GE LV+  V +GE+V   TS +G+E I N +R L   F  L   +   K++LE+ + +      + + L+ W ++ +    N   N+  +  +K K + D                  +A A S L  +L        D    ++  ++  + +  +  A+ +  ++  N   +     N ++   W+  A+  +   GE +G S + L + L  ++ L  + +  +N +    N G  +  ++ S G++  N  + ++  +  +L++ +     ++  N+    ++  S  + QQW+ D   KL
Sbjct: 5183 EALLNKQAQGELLVEHLVHTGEVVLASTSAQGQEIIRNDIRALRDSFEGLFREINQQKENLEVTMVQWRAYKEEYERLMEWLQQIDILVKNHKLNLCPNLPEKEKQVADMKEVMSRLEKGKDDIDKFNASAASLLKSHL--------DTYVNNQLRHLSSVYQVQVNLAKDVLKKVETNRDQHREYDANMKSAKDWIANAKATIQSAGEGAG-SKEALQRRLEQIQDLIRNRELGQNLVHTAINNGEKIIRNTRSDGRDAINTEMKELQTEWDRLVKKMSTAKVQLETNLLQWADYSSSYSQLQQWITDREAKL 5487          
BLAST of SMED30022193 vs. Ensembl Fly
Match: Msp300 (gene:FBgn0261836 transcript:FBtr0332404)

HSP 1 Score: 55.8398 bits (133), Expect = 2.016e-7
Identity = 63/314 (20.06%), Postives = 136/314 (43.31%), Query Frame = 3
Query: 1542 EKLIESKSNGENLVKAAVTSGEIVAKETSLKGKEEILNGVRGLNKGFXXXXXXXXXXKQSLEMKLAKASNINRDLDALVNWAEEFE----NKLFNITDSDLDKIKLLCD------------------DAQAKSYLAENLVNQTKLMNDPEFQSRAENIKELVKHNLENAQQMYSQIRENLQAYNGLINNCRNMDSWLNEAEKKMTRLGETSGYSPDDLAKNLSLLEKLAEDVKEKRNYIEKINNQGRDLTDSSPSKGKET-NALLDKINNKHKKLMENLEDKNQEVRRNIEDQKEFDESIHKAQQWMNDATQKL 2414
            E L+  ++ GE LV+  V +GE+V   TS +G+E I N +R L   F  L   +   K++LE+ + +      + + L+ W ++ +    N   N+  +  +K K + D                  +A A S L  +L        D    ++  ++  + +  +  A+ +  ++  N   +     N ++   W+  A+  +   GE +G S + L + L  ++ L  + +  +N +    N G  +  ++ S G++  N  + ++  +  +L++ +     ++  N+    ++  S  + QQW+ D   KL
Sbjct: 4824 EALLNKQAQGELLVEHLVHTGEVVLASTSAQGQEIIRNDIRALRDSFEGLFREINQQKENLEVTMVQWRAYKEEYERLMEWLQQIDILVKNHKLNLCPNLPEKEKQVADMKEVMSRLEKGKDDIDKFNASAASLLKSHL--------DTYVNNQLRHLSSVYQVQVNLAKDVLKKVETNRDQHREYDANMKSAKDWIANAKATIQSAGEGAG-SKEALQRRLEQIQDLIRNRELGQNLVHTAINNGEKIIRNTRSDGRDAINTEMKELQTEWDRLVKKMSTAKVQLETNLLQWADYSSSYSQLQQWITDREAKL 5128          
BLAST of SMED30022193 vs. UniProt/SwissProt
Match: sp|P24043|LAMA2_HUMAN (Laminin subunit alpha-2 OS=Homo sapiens OX=9606 GN=LAMA2 PE=1 SV=4)

HSP 1 Score: 55.4546 bits (132), Expect = 2.754e-6
Identity = 57/231 (24.68%), Postives = 102/231 (44.16%), Query Frame = 3
Query: 1857 DAQAKSYLAENLVNQTKLMNDPEFQSRA--ENIKELVKHNLENAQQMYSQIRENLQAYNGLINNCRNMDSW--LNEAEKKMTRLGETSGYSPDDLAKNLSLLEKLAEDVKEKRNYIEKINNQGRDLTDSSPSKGKETNALLDKINNKHKKL---MENLEDKNQEVRRNIEDQKEFDESIHKAQQ---WMNDATQKLLKYSD-IKQCSPTQIDSFSRNFENIVDSVPYGEEI 2516
            D   K    +NL  Q ++  D    + A  + +K+L   +    ++M   +RE L  Y   ++     D+W  L EA  K+         +     KN++ LEK  E V+  +  IE    +G D+ D +     E N+++D + +   KL    E L DK  ++ + I+D+K   E + +A+     +ND++  L    D  K  S     +F + + NI D +   E++
Sbjct: 1722 DQMIKELRRKNLETQKEIAEDELVAAEALLKKVKKLFGESRGENEEMEKDLREKLADYKNKVD-----DAWDLLREATDKIREANRLFAVN----QKNMTALEKKKEAVESGKRQIENTLKEGNDILDEANRLADEINSIIDYVEDIQTKLPPMSEELNDKIDDLSQEIKDRK-LAEKVSQAESHAAQLNDSSAVLDGILDEAKNISFNATAAF-KAYSNIKDYIDEAEKV 1941          
BLAST of SMED30022193 vs. TrEMBL
Match: A0A2T7NYB1 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_13836 PE=4 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 8.363e-9
Identity = 67/316 (21.20%), Postives = 134/316 (42.41%), Query Frame = 3
Query: 1536 IIEKLIESKSNGENLVKAAVTSGEIVAKETSLKGKEEILNGVRGLNKGFXXXXXXXXXXKQSLEMKLAKASNINRDLDALVNWAEEFENKLFNITDSD---------LDKIKLLCDDAQAKSYLAENLVNQTKLMNDPEFQSRAENIKELVKHNLENAQQMYSQIR------ENLQAYNGLINNCRNMDSWLNEAEKKMTRLGETSGYSPDDLAKNLSLLEKLAEDVKEKRNYIEKINNQG-RDLTDSSPSKGKETNALLDKINNKHKKLMENLEDKNQEVRRNIEDQKEFDESIHKAQQWMNDATQKLLKYSDIK 2435
            I++ L+  K  G  L  AA+  GE +   TS +G+EE+   +R L   +    D L   ++SLE    + S+ +   + L+NW  + E+++    D+          L  +K  C D  +   + +++ ++   ++  + Q R + +          AQ   +Q+R      +  Q Y   I  CR+   W++ +  ++    ET G     L   L  L++L   +++    ++     G + L+++SP         LD +  +   L   ++D  Q +   I   + +D S     +W+ +   +L  Y D+K
Sbjct: 2674 IVKDLLADKEQGLALFNAAIEVGEKLYPNTSNEGREEVRRELRNLRDSWEGFTDSLNETQRSLESSRMQWSSFDDSFEQLMNWVHDMESQVIAEPDAKSTLQEKKAVLQNLKTRCQDILSHQTMMDSISDKGTALSSSQVQDRLKKLNTRYNTLCSKAQ---AQVRQAETYVQQHQTYQDSIQACRD---WMSASRDRLAVCTETGG-DRQSLQNRLDRLQELMNTLRDGEVKLKTAEANGDKALSNTSPQGQATVRRDLDTLKQEWDVLCSKMKDTQQNLMHAIRALETYDVSCESLNRWLRETESQLKDY-DLK 2981          

HSP 2 Score: 30.4166 bits (67), Expect = 8.363e-9
Identity = 9/34 (26.47%), Postives = 23/34 (67.65%), Query Frame = 2
Query: 1355 LQTNIKDAIKDAENNVKNHQNFDNKMNGASEWLE 1456
            L + +++ ++ +E N+++H+NF ++     +WLE
Sbjct: 2616 LASFVREQVEQSEKNIEDHENFVHRHRACVDWLE 2649          

HSP 3 Score: 47.7506 bits (112), Expect = 2.572e-7
Identity = 49/222 (22.07%), Postives = 104/222 (46.85%), Query Frame = 2
Query:  794 ANDWQKDYEKKISNIGPLSNDISKLKQQLEKIENLKKLQKDGENIIQDAIEKGQVALTCSSEFEPIQAKINSNLENAENKWLQNTDAIENLKDEIMERLSKVEGVMQSGSKVDSWLKEKEADLKASKGPCDSLTQXXXXXXXXXXXXNEIESEWPIIEDYLNELQEIAQTDPNA--LRKLNQTKQQLSNLQTNIKDAIKDAENNVKNHQNFDNKMNGASEWL 1453
            A+ W    ++K +     S   ++L+++L+K++ L + +  G + +   +E G+     SS     +  I   L   + +W    D +  ++  +   L +     +S ++V+SWL+E E  L+       +L +K  ++ + K +L +++S   +IE   ++   + QT  +A   R ++QT  +   L +  +D ++  E  V  HQ + +  N   EWL
Sbjct: 3925 ASQWLLKAKEKFAVCSDTSGSRAELEERLDKVQELVRERDAGLSKLNQCVEAGERLY--SSTAPDGREVIRQELRKLKMEWDSLYDDLSTVQRRLEVSLVQWTSFDESYNQVESWLREMETQLEGQTALRSTLEEKKTQLQNYKVMLQDVQSYQRVIESIGDKAHNLTQTSSDAELARFISQTATRYKKLCSIAQDRVQQCEKFVSEHQEYSDSYNTCVEWL 4144          

HSP 4 Score: 38.5058 bits (88), Expect = 2.572e-7
Identity = 51/220 (23.18%), Postives = 87/220 (39.55%), Query Frame = 3
Query: 1533 DIIEKLIESKSNGENLVKAAVTSGEIVAKETSLKGKEEILNGVRGLNKGFXXXXXXXXXXKQSLEMKLAKASNINRDLDALVNWAEEFENKL-------------------------FNITDSDLDKIKLLCDDAQAKSYLAEN--LVNQTKLMNDPEFQSRAENIKELVKHNLENAQQMYSQIRENLQAYNGLINNCRNMDSWLNEAEKKMTRLGETSG 2111
            D I+ ++ +K  GE  VK  +T  + +   T+ +G+E I+     L   +   +  L   K  LE  + +        +    W +E E +L                          N   SDLD    L D AQ    ++ +  +V+Q   +    +Q+ + N KEL +         + Q  ++ Q Y      CR   +WLNE E K++ + +TSG
Sbjct: 4169 DKIQDILATKMEGEPKVKNVITLAQKILPNTAPQGREVIMRDADALRVDWEAFIMALAKTKSDLESCMDQWREFETWQERCGGWLKEVETRLREVDLKSSLSEKQTQFDRLKSLQNEINQHQSDLDS---LSDSAQDLMQVSTDNRVVSQASQLA-TRYQTASLNSKELCRR--------WEQYVQDHQTYIETFEQCR---TWLNEMEAKVSDVLDTSG 4373          
BLAST of SMED30022193 vs. TrEMBL
Match: A0A2R2MQV4 (nesprin-1 OS=Lingula unguis OX=7574 GN=LOC106170507 PE=4 SV=1)

HSP 1 Score: 47.3654 bits (111), Expect = 2.011e-8
Identity = 50/214 (23.36%), Postives = 93/214 (43.46%), Query Frame = 3
Query: 1539 IEKLIESKSNGENLVKAAVTSGEIVAKETSLKGKEEILNGVRGLNKGFXXXXXXXXXXKQSLEMKLAKASNINRDLDALVNWAEEFENKLF-------------------NITDSDLDKIKLLCDDAQAKSYL----AENLVNQTKLMNDPEFQSRAENIKELVKHNLENAQQMYSQIRENLQAYNGLINNCRNMDSWLNEAEKKMTRLGETSG 2111
            +++L+  K    N++   + SGE +   T+  G+E +   +R L  G+  L D L   +  LE  L +  +   + +    W  E ENK+                     I   D++  + L D+ + K+Y        L +Q      PE +S+    ++L++H  EN  +    +R++ Q Y+   ++ + + SWLN  E K+ R  + SG
Sbjct: 1788 VQELMLEKDQSSNILHQTLESGERLQLSTAPVGREVVRQELRTLRDGWDTLSDKLSETQHQLETSLGQWFSFIENYEDTQKWLTETENKVRKENELKATLQEKKVQVQNQKILQQDIESHRRLLDNLEDKAYRLSQSGHQLTHQV-----PELKSQ---YQKLMQHCTENLHKFEQHLRDH-QVYS---DSFQELQSWLNSMEDKLARCSDLSG 1989          

HSP 2 Score: 42.743 bits (99), Expect = 2.011e-8
Identity = 38/166 (22.89%), Postives = 79/166 (47.59%), Query Frame = 2
Query:  992 QAKINSNLENAENKWLQNTDAIENLKDEIMERLSKVEGVMQSGSKVDSWLKEKEA-----DLKASKGPCDSLTQXXXXXXXXXXXXNEIESEWPIIEDYLNELQEIAQTDPNALRKLNQTKQQLSNLQTNIKDAIKDAENNVKNHQNFDNKMNGASEWL-EMAKAL 1471
            QA I + L+  ++ W Q      ++K  +   +   E      + +  W++E E      DLKA+      L  K   +++LK L  E+  +   I++  ++ Q++A +DP       Q   +   L++++KD +   E++V+ HQ +  K +  ++W+ E+ + L
Sbjct: 1609 QAVIQAELQTLQDTWDQTNSKAADIKANLQTAIHSWEDYEHVFNSLSKWVRETELKLKDNDLKAT------LPDKTVYLENLKALNKEVSDKQTSIDNLGHKAQKLASSDPKVSSVTTQLTTRYQALKSHVKDLVVQWEDHVREHQQYSEKFSSCTQWMGELRRGL 1768          

HSP 3 Score: 49.6766 bits (117), Expect = 7.304e-6
Identity = 45/203 (22.17%), Postives = 91/203 (44.83%), Query Frame = 3
Query: 1539 IEKLIESKSNGENLVKAAVTSGEIVAKETSLKGKEEILNGVRGLNKGFXXXXXXXXXXKQSLEMKLAKASNINRDLDALVNWAEEFENKLFNITD--SDLDKIKLL-------CDDAQAKSYLAENLVNQTKLMNDPEFQSRAENIKELVKHNLENAQQMY---SQIRENLQAYNGLINNCRNMDSWLNEAEKKMTRLGETSG 2111
            +++L  SK  G +   + +T+G+ +   T+++G+E I + VR L + +    + L  A+ SLEM+L +  + +   D L  W  E E ++    +  S L + K L       C +  +   L EN+  + +++  P    + + +K   ++    A++      Q  E  Q +      C     WL   ++K+    +T+G
Sbjct: 1365 VKELANSKEEGADKFNSCLTAGDKLHPHTAVEGREVIRHEVRALREMWEKYCNNLTHAQNSLEMRLMQWQSYDESHDHLKEWVAEMEQQVGEDVELKSTLQEKKALAQHYKGVCQEVMSHQGLLENVGERAQVLASPSVHGKMDKLKSRYRNLCLTAKEHVMKSGQFSEEHQQFQEAYQQCLE---WLQVTQEKLKVCSDTTG 1564          

HSP 4 Score: 31.5722 bits (70), Expect = 7.304e-6
Identity = 21/60 (35.00%), Postives = 33/60 (55.00%), Query Frame = 2
Query: 1340 QQLSNLQTNIKDAIKDAENNVKNHQNFDNKMNGASEWLEMAKALKLDATSKETPGSIEEM 1519
            QQL  L   IKD ++  E +V++H++F  K + +  WLE A     D +  +T G  EE+
Sbjct: 1304 QQLVEL---IKDQVETCETSVQDHEDFQKKYSLSVGWLEAASKRLQDVS--DTAGDKEEI 1358          
BLAST of SMED30022193 vs. TrEMBL
Match: A0A210QXB7 (Nesprin-1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT09398 PE=4 SV=1)

HSP 1 Score: 52.373 bits (124), Expect = 2.028e-8
Identity = 69/376 (18.35%), Postives = 169/376 (44.95%), Query Frame = 2
Query:  341 GAEYSKPLSNEVNEFEKKLKDSLSKANNIKNALNQNRDQLKICEKNMEQVADWINNLDKAMEDIND-TRSPETFEQSLNKFKT---NLYTEPTAVNSLKEVQEIFTKIKNSAPKNLKETQMQNXXXXXXXXXXXXXXXXXAIXXXXXXXXXXXXXANDWQKDYEKKISNIGPLSNDISKLKQQLEKIENLKKLQKDGENIIQDAIEKGQVALTCSSEFEPIQAKINSNLENAENKWLQNTDAIENLKDEIMERLSKVEGVMQSGSKVDSWLKEKEADLKASKGPCDSLTQXXXXXXXXXXXXNEIESEWPIIEDYLNELQEIAQTDPNALRKLNQTKQQLSNLQTNIKDAIKDAENNVKNHQNFDNKMNGASEWLE 1456
            G E  +     + E  +   DSL   N+ +  L  +R Q    + N +Q++ W+++++  +ED  D   S +  +  L  ++T   ++ +  T ++S+ +     +  +  +  N    Q+ N+ + L    +++ +  +      + +  S  +  D     + K++     + D   L+ +L+++++L     DGE  ++D   +G+ ++  + +  P QA I + LE+   +W      + + +  +   +  ++    S   ++ WL++ E  +K  +    SL +K A+++  K L  E++S+ P  ++  N   ++  +D   +    Q   +    +TN++D I   + + + H+ +       SEW++
Sbjct: 2699 GREGVRRELRSLREMWESFNDSL---NDTQRQLESSRMQWSTFDDNYDQLSKWVSDMEGQIEDDQDLCNSLQEKKAMLQHYRTRCQDIMSHQTMIDSIGDKGTALSSTQAKSKLN----QLNNRYRTLCGGAQDQVKTAEGFVDQHQLYQDSYQQCRDAMAMTKDKLAVCSETTGDRQALQNRLDRVQDLTTALHDGEKKVKDTHVQGEKSIPQTGK--PGQATIQAELESLTTEWEGVVSRLGDTQQSLTHAVQAIQSYDSSCESLNRWLRDVEIQIKEHELKS-SLKEKHAQVEKFKTLQAEVQSKQPQFDELSNMASQVQGSDTRLVNFSTQLGTRFQTAKTNLRDVISRQQEHAREHEAYQENFAECSEWVD 3064          

HSP 2 Score: 37.3502 bits (85), Expect = 2.028e-8
Identity = 42/208 (20.19%), Postives = 95/208 (45.67%), Query Frame = 3
Query: 1539 IEKLIESKSNGENLVKAAVTSGEIVAKETSLKGKEEILNGVRGLNKGFXXXXXXXXXXKQSLEMKLAKASNINRDLDALVNWAEEFENKLFNITD---------SDLDKIKLLCDDAQAKSYLAENLVNQ-TKLMNDPEFQSRAENIKELVK-------HNLENAQQMYSQIRENLQAYNGLINNCRNMDSWLNEAEKKMTRLGETSG 2111
            +++L+  K  G   +   V  GE +   T+ +G++ I   +RGL   +  + D L   ++ L+  L + S+ + + +    W  + E +L   TD         + L   ++L  D  ++ ++ +NL  + +KL +        + + EL +        + E+ +++   ++++ Q Y     +C++   WLN + +K+    +TSG
Sbjct: 3090 LQELMAEKDQGATKIHYTVECGEKLYPSTASEGRDVIRQELRGLRDQWEQVCDTLSDTQRKLDTCLLQWSSYDENFEQFQKWLLDTEIQLREDTDLRATLPDKRAQLQNHRVLHQDIMSRQHVMDNLSEKASKLSHSSPVTKAGKFVDELHRKYNKLCGESKEHLEELEGGVKDH-QMYQDTYQDCQD---WLNSSREKVEACSDTSG 3293          

HSP 3 Score: 50.0618 bits (118), Expect = 6.321e-8
Identity = 56/244 (22.95%), Postives = 112/244 (45.90%), Query Frame = 2
Query:  794 ANDWQKDYEKKISNIGPLSNDISKLKQQLEKIENLKKLQKDGENIIQDAIEKGQVALTCSSEFEPIQAKINSNLENAENKWLQNTDAIENLKDEIMERLSKVEGVMQSGSKVDSWLKEKEADLKASKGPCDSLTQXXXXXXXXXXXXNEIESEWPIIEDYLNELQEIAQ--TDPNALRKLNQTKQQLSNLQTNIKDAIKDAENNVKNHQNFDNKMNGASEWLEMAKALKLDATSKETPGSIEEM 1519
            A DW    + ++S     S D   L  +L++++ L     +G   I +  E    A T  +     +  ++  ++  +  W   T  I+ L+D +   + +     +   ++  W+K+ E  +K S  P  +L  K  ++   + L+ E+ +    ++ + +E Q + Q   +      ++Q   +   LQ N+KD +K  E NV +H+++ ++    S+WL  AK+ K  +TS ET GS  E+
Sbjct: 3703 AVDWLTLMKDRVSMCSDTSGDRHTLSNKLDRVQELLASIPEGTAKIAECEELA--ATTVETTALKGRQGVHQEMDMLKMDWDNYTSQIKGLRDGLERAVQQWGKYEEQYDRISHWVKDMEKKVKESP-PKSTLDDKQLQLQKFQALMTEVRAHQREMDHFSDEAQTLQQLTGEVRVGTSVSQLMSRYQTLQQNLKDQLKKCEQNVTDHKHYKDRHADCSQWLNKAKS-KF-STSAETTGSRNEL 3941          

HSP 4 Score: 38.1206 bits (87), Expect = 6.321e-8
Identity = 71/315 (22.54%), Postives = 131/315 (41.59%), Query Frame = 3
Query: 1539 IEKLIESKSNGENLVKAAVTSGEIVAKETSLKGKEEILNGVRGLNKGFXXXXXXXXXXKQSLEMKLAKASNINRDLDALVNWAEEFENKLFNITD---------SDLDKIKLLCDDAQAKSYL-------AENLVNQTKLMNDPE---FQSRAENIKELVKHNLENAQQMYSQIRENLQAYNGLINNCRNMDSWLNEAEKKMTRLGETSGYSPDDLAKNLSLLEKLAEDVKEKRNYIEKINN----QGRDLTDSSPSKGK-----ETNALLDKINNKHKKLMENLEDKNQEVRRNIEDQKEFDESIHKAQQWMND 2399
            I++L   +  G   +   V +GE +   T+  G+E +   +R +   +  L D L AA++ +E+ L + ++ +     + +W  E E++L              S L   K+L  D  +   +       A++LV  +   +DP+   F ++A      +    +   Q Y     + Q YN   NNC     WLN   +K++   + SG    D     + L+K+ + V  K     K+ N      + L +++P +GK     ET+AL D      +  +  L+    ++   ++  KEFD    K   W+ D
Sbjct: 3948 IQELAMERDAGFTKLNQVVEAGEKLYPNTAPDGREVVRQELRQVKLTWESLFDDLSAAQRKMEVALVQWTSFDDSFGQVEHWLREMESQLDGTVPLRSTLEEKKSQLQNYKVLHQDVLSYQRVMDSVNDKAQSLVQSS---SDPQLTKFVTQARTRYHKITATAKERVQQYEAFVADHQQYNDAYNNCIE---WLNGIREKLSMCADVSG----DRHTIQNRLDKIQDIVATKMEGEPKVKNVVSLSEKVLPNTAP-QGKDIVMRETDALKDDW----EAFVNALQKTKSDLESCMDQWKEFDAWQEKVSAWLKD 4247          
BLAST of SMED30022193 vs. TrEMBL
Match: A0A2R2MSB1 (nesprin-1-like OS=Lingula unguis OX=7574 GN=LOC106156515 PE=4 SV=1)

HSP 1 Score: 46.9802 bits (110), Expect = 4.450e-8
Identity = 50/214 (23.36%), Postives = 93/214 (43.46%), Query Frame = 3
Query: 1539 IEKLIESKSNGENLVKAAVTSGEIVAKETSLKGKEEILNGVRGLNKGFXXXXXXXXXXKQSLEMKLAKASNINRDLDALVNWAEEFENKLF-------------------NITDSDLDKIKLLCDDAQAKSYL----AENLVNQTKLMNDPEFQSRAENIKELVKHNLENAQQMYSQIRENLQAYNGLINNCRNMDSWLNEAEKKMTRLGETSG 2111
            +++L+  K    N++   + SGE +   T+  G+E +   +R L  G+  L D L   +  LE  L +  +   + +    W  E ENK+                     I   D++  + L D+ + K+Y        L +Q      PE +S+    ++L++H  EN  +    +R++ Q Y+   ++ + + SWLN  E K+ R  + SG
Sbjct: 3362 VQELMLEKDQSSNILHQTLESGERLQLSTAPVGREVVRQELRTLRDGWDTLSDKLSETQHQLETSLGQWFSFIENYEDTQKWLTETENKVRKENELKATLQEKKVQVQNQKILQQDIESHRRLLDNLEDKAYRLSQSGHQLTHQV-----PELKSQ---YQKLMQHCTENLHKFEQHLRDH-QVYS---DSFQELQSWLNSMEDKLARCSDLSG 3563          

HSP 2 Score: 41.5874 bits (96), Expect = 4.450e-8
Identity = 36/159 (22.64%), Postives = 75/159 (47.17%), Query Frame = 2
Query:  992 QAKINSNLENAENKWLQNTDAIENLKDEIMERLSKVEGVMQSGSKVDSWLKEKEA-----DLKASKGPCDSLTQXXXXXXXXXXXXNEIESEWPIIEDYLNELQEIAQTDPNALRKLNQTKQQLSNLQTNIKDAIKDAENNVKNHQNFDNKMNGASEWL 1453
            QA I + L+  ++ W Q      ++K  +   +   E      + +  W++E E      DLKA+      L  K   +++LK L  E+  +   I++  ++ Q++A +DP       Q   +   L++++KD +   E++V+ HQ +  K +  ++W+
Sbjct: 3183 QAVIQAELQTLQDTWDQTHSKAADIKANLQTAIHSWEDYEHVFNSLSKWVRETELKLKDNDLKAT------LPDKTVYLENLKALNKEVSDKQTSIDNLGHKAQKLASSDPKVSSVTTQLTTRYQALKSHVKDLVVQWEDHVREHQQYSEKFSSCTQWM 3335          

HSP 3 Score: 49.6766 bits (117), Expect = 6.604e-6
Identity = 45/203 (22.17%), Postives = 91/203 (44.83%), Query Frame = 3
Query: 1539 IEKLIESKSNGENLVKAAVTSGEIVAKETSLKGKEEILNGVRGLNKGFXXXXXXXXXXKQSLEMKLAKASNINRDLDALVNWAEEFENKLFNITD--SDLDKIKLL-------CDDAQAKSYLAENLVNQTKLMNDPEFQSRAENIKELVKHNLENAQQMY---SQIRENLQAYNGLINNCRNMDSWLNEAEKKMTRLGETSG 2111
            +++L  SK  G +   + +T+G+ +   T+++G+E I + VR L + +    + L  A+ SLEM+L +  + +   D L  W  E E ++    +  S L + K L       C +  +   L EN+  + +++  P    + + +K   ++    A++      Q  E  Q +      C     WL   ++K+    +T+G
Sbjct: 2939 VKELANSKEEGADKFNSCLTAGDKLHPHTAVEGREAIRHEVRALREMWEKYCNNLTHAQNSLEMRLMQWQSYDESHDHLKEWVAEMEQQVGEDVELKSTLQEKKALAQHYKGVCQEVMSHQGLLENVGERAQVLASPSVHGKMDKLKSRYRNLCLTAKEHVMKSGQFSEEHQQFQEAYQQCLE---WLQVTQEKLKVCSDTTG 3138          

HSP 4 Score: 31.5722 bits (70), Expect = 6.604e-6
Identity = 21/60 (35.00%), Postives = 33/60 (55.00%), Query Frame = 2
Query: 1340 QQLSNLQTNIKDAIKDAENNVKNHQNFDNKMNGASEWLEMAKALKLDATSKETPGSIEEM 1519
            QQL  L   IKD ++  E +V++H++F  K + +  WLE A     D +  +T G  EE+
Sbjct: 2878 QQLVEL---IKDQVETCETSVQDHEDFQKKYSLSVGWLEAASKRLQDVS--DTAGDKEEI 2932          
BLAST of SMED30022193 vs. TrEMBL
Match: A0A433TJR4 (Uncharacterized protein (Fragment) OS=Elysia chlorotica OX=188477 GN=EGW08_010510 PE=4 SV=1)

HSP 1 Score: 50.8322 bits (120), Expect = 1.445e-7
Identity = 67/310 (21.61%), Postives = 133/310 (42.90%), Query Frame = 3
Query: 1536 IIEKLIESKSNGENLVKAAVTSGEIVAKETSLKGKEEILNGVRGLNKGFXXXXXXXXXXKQSLEMKLAKASNINRDLDALVNWAEEFENKLFNITD--------SDLDKIKLLCDDAQAKSYLAENLVNQTKLMNDPEFQSRAENIKELVKHNL----ENAQQMYSQIRENLQAYNGLINNCRNMDSWLNEAEKKMTRLGETSGYSP---DDLAKNLSLLEKLAEDVKEKRNYIEKINNQGRDLTDSSPSKGKETNALLDKINNKHKKLMENLEDKNQEVRRNIEDQKEFDESIHKAQQWMNDATQKLLK 2420
             + + +  K  G+ L+ AA+T GE     TS++G+E I   ++ L   +  +L  +   K  LE  L + S+ +   D ++ W ++ E +L +           ++L ++K L  D  +   + E++ ++   +++    SRA      V+       E A+ + S+  +N+  +    ++  +  SWL    +K+T   +T G        + +  SL+  L E   ++ +Y  K       L  +S S   +    L  IN   +     L     E+   +    EF+ES H+   W+ + T+ LL+
Sbjct:  621 FVREFVVIKEEGQILLHAAITWGEKTQASTSVEGREVIREELQKLQADWDLMLSQVTDTKVMLESCLLQWSDYSASHDQVLRWLKDMEKRLRDTQPKADLSEKKAELQRVKGLYQDIVSYEQMVESVGSKALELSEKSPASRATVDTSQVQSRYISVKEQAKDLLSRCEQNVAHHQDFHDSVNSFASWLRTDIEKLTTCSDTYGEKSAIETKIERAKSLVANLTEG-SQRLSYATKAGETT--LPSTSASGQTKIRQQLQAINKDFEDFRVQLVQAQSELETCLRRWDEFEESHHEFGNWLRE-TEVLLR 926          

HSP 2 Score: 36.1946 bits (82), Expect = 1.445e-7
Identity = 47/221 (21.27%), Postives = 90/221 (40.72%), Query Frame = 2
Query:  797 NDWQKDYEKKISNIGPLSNDISKLKQQLEKIENLKKLQKDGENIIQDAIEKGQVALTCSSEFEPIQAKINSNLENAENKWLQNTDAIENLKDEIMERLSKVEGVMQSGSKVDSWLKEKEADLKASKGPCDSLTQXXXXXXXXXXXXNEIESEWPIIEDYLNELQEIAQ--TDPNALRKLNQTKQQLSNLQTNIKDAIKDAENNVKNHQNFDNKMNGASEWL 1453
            +DW      K+     +  D   ++ QL K+E +    + G   +Q   +KG++ +  +S     Q  I+  LE   N +      + +LK  +     +     +   ++  W+K+ E  +K       SL QK+ +++  +    E   +    +    + Q + Q  TD     +L Q   + S L T  KD +K  E  V++HQ++      +  WL
Sbjct:  373 SDWLGAAMDKLGLCSDVRGDRHAIEAQLHKVEEIAVTVEQGRKKLQATQQKGEIVIPQTS--TQGQELIHEELEMLTNDFQGFESDLGDLKHTLTTLKDQWTCYEEFYGELSQWIKDTENAMKVDSDLRASLDQKLQQLNKHRNTHEETVGQQEAFDRLAEQAQVLMQSSTDGRVSTQLTQLSSRYSALITLSKDLLKRYEQTVQDHQHYGEAYGRSRAWL 591          
BLAST of SMED30022193 vs. Planmine SMEST
Match: SMESG000069851.1 (SMESG000069851.1)

HSP 1 Score: 832.017 bits (2148), Expect = 0.000e+0
Identity = 465/471 (98.73%), Postives = 470/471 (99.79%), Query Frame = 2
Query:  107 LARQKKLAEEEKRKKFKDHMDNMKKWVADLNTFLDDGLECDSDSICSYLENLSGLLSDKDLIDEDLTELKDDICSGKCGAEYSKPLSNEVNEFEKKLKDSLSKANNIKNALNQNRDQLKICEKNMEQVADWINNLDKAMEDINDTRSPETFEQSLNKFKTNLYTEPTAVNSLKEVQEIFTKIKNSAPKNLKETQMQNXXXXXXXXXXXXXXXXXAIXXXXXXXXXXXXXANDWQKDYEKKISNIGPLSNDISKLKQQLEKIENLKKLQKDGENIIQDAIEKGQVALTCSSEFEPIQAKINSNLENAENKWLQNTDAIENLKDEIMERLSKVEGVMQSGSKVDSWLKEKEADLKASKGPCDSLTQXXXXXXXXXXXXNEIESEWPIIEDYLNELQEIAQTDPNALRKLNQTKQQLSNLQTNIKDAIKDAENNVKNHQNFDNKMNGASEWLEMAKALKLDATSKETPGSIEEM 1519
            LARQKKLAEEEKRKKFKDHMDNMKKWVADLNTFLDDGLECDSDSICSYLENLSGLLSDKDLIDEDLTELKDDICSGKCGAEYSKPLSNE+NEFEKKLKDSLSKANNIKNALNQNRDQLKICEKNM+QVADWINNLDKAMEDINDTRSPETFEQSLNKFKTNLYTEPTAVNSLKEVQEIFTKIKNSAPKNLKETQMQNKIKDLETKLKEKTEKGKAIDKSLKDFDKSLSKANDWQKDYEKKISNIGPLSNDISKLKQQLEKIENLK+LQKDGENIIQDAIEKGQVALTCSSEFEPIQAKINSNLENAENKWLQNTD IENLKDEIMERLSKVEGVMQSGSKVDSWLKEKEADLKASKGPCDSLTQKIAKIDDLKKLLNEIESEWPIIEDYLN+LQEIAQTDPNALRKLNQTKQQLSNLQTNIKDAIKDAENNVKNHQ+FDNKMNGASEWLEMAKALKLDATSKETPGSIEEM
Sbjct:  447 LARQKKLAEEEKRKKFKDHMDNMKKWVADLNTFLDDGLECDSDSICSYLENLSGLLSDKDLIDEDLTELKDDICSGKCGAEYSKPLSNEINEFEKKLKDSLSKANNIKNALNQNRDQLKICEKNMDQVADWINNLDKAMEDINDTRSPETFEQSLNKFKTNLYTEPTAVNSLKEVQEIFTKIKNSAPKNLKETQMQNKIKDLETKLKEKTEKGKAIDKSLKDFDKSLSKANDWQKDYEKKISNIGPLSNDISKLKQQLEKIENLKQLQKDGENIIQDAIEKGQVALTCSSEFEPIQAKINSNLENAENKWLQNTDTIENLKDEIMERLSKVEGVMQSGSKVDSWLKEKEADLKASKGPCDSLTQKIAKIDDLKKLLNEIESEWPIIEDYLNQLQEIAQTDPNALRKLNQTKQQLSNLQTNIKDAIKDAENNVKNHQDFDNKMNGASEWLEMAKALKLDATSKETPGSIEEM 917          

HSP 2 Score: 682.174 bits (1759), Expect = 0.000e+0
Identity = 354/369 (95.93%), Postives = 359/369 (97.29%), Query Frame = 3
Query: 1488 AKKLPVVXXXXXXXXDIIEKLIESKSNGENLVKAAVTSGEIVAKETSLKGKEEILNGVRGLNKGFXXXXXXXXXXKQSLEMKLAKASNINRDLDALVNWAEEFENKLFNITDSDLDKIKLLCDDAQAKSYLAENLVNQTKLMNDPEFQSRAENIKELVKHNLENAQQMYSQIRENLQAYNGLINNCRNMDSWLNEAEKKMTRLGETSGYSPDDLAKNLSLLEKLAEDVKEKRNYIEKINNQGRDLTDSSPSKGKETNALLDKINNKHKKLMENLEDKNQEVRRNIEDQKEFDESIHKAQQWMNDATQKLLKYSDIKQCSPTQIDSFSRNFENIVDSVPYGEEIVSSTIYTGQKHLEHLRQSKRQDSKAF 2594
            +K+ P      K+RKDIIEKLIESKSNGENLVKAAVTSGEIVAKETSLKGKEEILNGVRGLNKGFLDLLDGLGAAKQSLEMKLAKASNINRDLDALVNWAEEFENKLFNITDSDLDKIKLLCDDAQAKSYLAENLVNQTKLMNDPEFQSRAENIKELVKHNLENAQQMYSQIRENLQAYNGLINNC+NMDSWLNEAEKKM RLGETSGYSPDDLAKNLSLLEKLAEDVKEKRNYIEKINNQGRDLTDSSPSKGKETNALLDKINNKHKKLMENLEDKNQEVRRNIEDQKEFDESIHKAQQWMNDATQKLLKYSDIKQCSPTQIDSFSRNFENIVDSVPYGEEIVSSTIYTGQKHLEHLRQSKRQDS  +
Sbjct:  907 SKETPGSIEEMKRRKDIIEKLIESKSNGENLVKAAVTSGEIVAKETSLKGKEEILNGVRGLNKGFLDLLDGLGAAKQSLEMKLAKASNINRDLDALVNWAEEFENKLFNITDSDLDKIKLLCDDAQAKSYLAENLVNQTKLMNDPEFQSRAENIKELVKHNLENAQQMYSQIRENLQAYNGLINNCKNMDSWLNEAEKKMARLGETSGYSPDDLAKNLSLLEKLAEDVKEKRNYIEKINNQGRDLTDSSPSKGKETNALLDKINNKHKKLMENLEDKNQEVRRNIEDQKEFDESIHKAQQWMNDATQKLLKYSDIKQCSPTQIDSFSRNFENIVDSVPYGEEIVSSTIYTGQKHLEHLRQSKRQDSNNY 1275          

HSP 3 Score: 58.151 bits (139), Expect = 2.979e-8
Identity = 68/293 (23.21%), Postives = 135/293 (46.08%), Query Frame = 3
Query: 1749 NINRDLDALVNWAEEFENKLFNI--TDSDLDKIKLLCDDAQAKSYL---AENLV------NQTKLMNDPEFQSRAENIKELVKHNLENAQQMYSQ-----------IRENLQAYNGLINNCRNMDSWLNEAEKKMTRLGETSGYSPDDLAKNLSL---LEKLAEDVKEKRNYIEKINNQGRDLTDSSPSKGKETNALLDKINNKHKKLMENLEDKNQEVRRNIEDQKEFDESIHKAQQWMNDATQKLLKYSDIKQCSPTQIDSFSRN---FENIVDSVPYGEEIVSSTIYTGQ 2543
            + ++ L    +W +++E K+ NI    +D+ K+K   +  +    L    EN++       Q  L    EF    E I+  +  NLENA+  + Q           I E L    G++ +   +DSWL E E  +    + S    D L + ++    L+KL  +++ +   IE   NQ +++  + P+  ++ N    +++N    L  N++D  ++   N+++ ++FD  ++ A +W+  A  K LK     + +P  I+   R     E +++S   GE +V + + +G+
Sbjct:  668 DFDKSLSKANDWQKDYEKKISNIGPLSNDISKLKQQLEKIENLKQLQKDGENIIQDAIEKGQVALTCSSEF----EPIQAKINSNLENAENKWLQNTDTIENLKDEIMERLSKVEGVMQSGSKVDSWLKEKEADL----KASKGPCDSLTQKIAKIDDLKKLLNEIESEWPIIEDYLNQLQEIAQTDPNALRKLNQTKQQLSN----LQTNIKDAIKDAENNVKNHQDFDNKMNGASEWLEMA--KALKLDATSKETPGSIEEMKRRKDIIEKLIESKSNGENLVKAAVTSGE 946          
The following BLAST results are available for this feature:
BLAST of SMED30022193 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
LAMA25.733e-724.68laminin subunit alpha 2 [Source:HGNC Symbol;Acc:HG... [more]
LAMA25.734e-724.68laminin subunit alpha 2 [Source:HGNC Symbol;Acc:HG... [more]
LAMA25.782e-724.68laminin subunit alpha 2 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of SMED30022193 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022193 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Msp3001.620e-719.93gene:FBgn0261836 transcript:FBtr0303383[more]
Msp3001.807e-720.06gene:FBgn0261836 transcript:FBtr0303389[more]
Msp3001.917e-720.06gene:FBgn0261836 transcript:FBtr0303388[more]
Msp3001.984e-720.06gene:FBgn0261836 transcript:FBtr0332405[more]
Msp3002.016e-720.06gene:FBgn0261836 transcript:FBtr0332404[more]
back to top
BLAST of SMED30022193 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022193 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022193 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022193 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|P24043|LAMA2_HUMAN2.754e-624.68Laminin subunit alpha-2 OS=Homo sapiens OX=9606 GN... [more]
back to top
BLAST of SMED30022193 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7NYB18.363e-921.20Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A2R2MQV42.011e-823.36nesprin-1 OS=Lingula unguis OX=7574 GN=LOC10617050... [more]
A0A210QXB72.028e-818.35Nesprin-1 OS=Mizuhopecten yessoensis OX=6573 GN=KP... [more]
A0A2R2MSB14.450e-823.36nesprin-1-like OS=Lingula unguis OX=7574 GN=LOC106... [more]
A0A433TJR41.445e-721.61Uncharacterized protein (Fragment) OS=Elysia chlor... [more]
back to top
BLAST of SMED30022193 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022193 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022193 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022193 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022193 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022193 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000069851.12.979e-898.73SMESG000069851.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022193 ID=SMED30022193|Name=SMED30022193|organism=Schmidtea mediterranea sexual|type=transcript|length=2625bp
AAGAAAGGAGGAAGAAGAGAGAAAAAGACGAGAGGAAGAGGAAAGAAAAA
GAAAAGAGGAAGCAGAACGAAAAAGAAAAGAAGAAGAAAAAATAAAGCAG
GAAGAATTAGCAAGACAAAAGAAATTAGCAGAAGAAGAAAAACGAAAAAA
GTTTAAAGACCATATGGACAATATGAAAAAATGGGTGGCAGATTTAAATA
CCTTTTTAGATGATGGATTAGAATGTGATAGTGACTCAATTTGTAGTTAT
TTAGAAAATTTAAGTGGTCTTTTAAGTGATAAAGATTTGATTGATGAGGA
CCTTACTGAACTCAAAGACGATATTTGTTCCGGCAAATGTGGTGCGGAAT
ATTCAAAGCCTTTGTCAAATGAAGTTAATGAGTTTGAAAAGAAACTGAAA
GATTCCTTATCTAAGGCAAACAATATAAAGAATGCATTGAACCAAAATCG
AGATCAACTTAAAATTTGTGAAAAGAATATGGAGCAAGTTGCTGACTGGA
TTAATAATTTGGACAAGGCAATGGAAGATATCAATGATACTAGGAGTCCA
GAAACCTTTGAACAATCTCTCAATAAATTTAAAACTAATTTATACACGGA
ACCGACAGCAGTTAACAGCCTCAAGGAAGTCCAGGAAATATTTACAAAAA
TAAAAAATTCTGCTCCAAAAAATTTGAAAGAAACTCAAATGCAAAATAAA
ATCAAAGACTTGGAAACAAAATTAAAAGAGAAAACTGAGAAAGGCAAAGC
AATTGATAAATCTTTAAAGGATTTTGACAAAAGTTTATCGAAAGCCAATG
ACTGGCAAAAGGACTATGAGAAGAAGATAAGCAATATAGGACCTTTATCA
AACGATATATCAAAATTGAAGCAGCAATTGGAAAAAATAGAAAATTTAAA
AAAACTACAAAAAGACGGTGAAAACATAATACAAGACGCCATTGAAAAGG
GTCAAGTAGCTCTTACTTGCTCATCTGAATTCGAACCGATCCAAGCGAAA
ATAAATTCCAATTTAGAGAATGCAGAAAACAAATGGCTACAAAATACAGA
CGCAATAGAGAATCTGAAAGACGAAATTATGGAAAGACTGTCAAAAGTCG
AAGGAGTGATGCAAAGTGGTAGCAAAGTCGATAGTTGGCTAAAAGAAAAG
GAAGCGGATTTAAAGGCGTCTAAGGGTCCATGTGATTCCCTCACTCAAAA
AATTGCGAAAATTGATGATCTTAAAAAATTACTCAATGAAATCGAGTCTG
AATGGCCGATCATAGAAGATTATTTGAACGAATTACAAGAGATAGCCCAA
ACTGATCCGAACGCTTTAAGAAAGCTAAATCAAACAAAGCAGCAATTGTC
AAACCTTCAAACAAATATAAAAGATGCGATAAAAGATGCAGAAAACAATG
TGAAAAATCACCAGAATTTTGATAATAAAATGAACGGCGCCAGCGAATGG
CTTGAAATGGCTAAGGCGTTGAAATTGGATGCTACGAGCAAAGAAACTCC
CGGTAGTATAGAGGAGATGAAAAAAACGAAAGGATATTATTGAAAAACTA
ATTGAGTCGAAATCAAACGGAGAAAATTTGGTAAAAGCTGCTGTGACATC
AGGTGAAATAGTGGCCAAAGAAACGTCTTTAAAAGGAAAAGAAGAAATAC
TTAATGGAGTTAGAGGGTTGAATAAAGGTTTTCTGGATTTGCTTGACGGA
CTTGGAGCGGCTAAACAATCATTGGAAATGAAATTAGCAAAAGCTTCAAA
TATTAACAGAGATCTCGATGCTCTTGTCAACTGGGCAGAAGAGTTCGAAA
ATAAATTATTTAACATTACCGACAGTGACCTGGACAAAATTAAACTGCTT
TGCGATGATGCGCAAGCCAAATCGTATTTGGCAGAAAATCTTGTAAATCA
AACCAAATTAATGAATGATCCAGAATTTCAATCTCGAGCAGAAAACATTA
AGGAATTGGTCAAGCACAATTTGGAAAACGCCCAGCAAATGTATTCACAA
ATCCGAGAAAATTTGCAAGCCTATAATGGCCTGATTAATAATTGTAGAAA
TATGGACAGCTGGCTGAATGAAGCGGAAAAGAAAATGACAAGACTTGGAG
AAACTTCCGGATACAGTCCTGATGACTTGGCTAAGAATTTAAGTTTGTTG
GAGAAATTGGCGGAAGATGTAAAAGAAAAGAGAAATTATATTGAAAAAAT
TAATAATCAAGGCAGAGATTTAACTGATTCCAGTCCTTCTAAAGGGAAAG
AAACTAATGCTCTTCTAGACAAAATAAACAATAAACATAAAAAATTAATG
GAAAACCTAGAGGATAAAAATCAAGAAGTTCGAAGAAACATTGAAGACCA
AAAAGAGTTTGATGAGTCCATTCATAAGGCTCAGCAATGGATGAATGATG
CCACACAGAAACTGTTGAAATATTCGGATATCAAACAGTGTTCCCCGACA
CAAATTGATTCCTTCTCTCGGAATTTTGAAAACATTGTCGACAGTGTCCC
ATACGGGGAAGAAATAGTATCATCAACAATTTACACCGGTCAAAAGCATT
TGGAACATCTTAGACAATCGAAAAGACAAGATTCAAAAGCATTTGGAACA
TCTTAGACAATCGAAAAGACAAGAT
back to top

protein sequence of SMED30022193-orf-1

>SMED30022193-orf-1 ID=SMED30022193-orf-1|Name=SMED30022193-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=293bp
MKLAKASNINRDLDALVNWAEEFENKLFNITDSDLDKIKLLCDDAQAKSY
LAENLVNQTKLMNDPEFQSRAENIKELVKHNLENAQQMYSQIRENLQAYN
GLINNCRNMDSWLNEAEKKMTRLGETSGYSPDDLAKNLSLLEKLAEDVKE
KRNYIEKINNQGRDLTDSSPSKGKETNALLDKINNKHKKLMENLEDKNQE
VRRNIEDQKEFDESIHKAQQWMNDATQKLLKYSDIKQCSPTQIDSFSRNF
ENIVDSVPYGEEIVSSTIYTGQKHLEHLRQSKRQDSKAFGTS*
back to top

protein sequence of SMED30022193-orf-2

>SMED30022193-orf-2 ID=SMED30022193-orf-2|Name=SMED30022193-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=514bp
RKEEEERKRREEEERKRKEEAERKRKEEEKIKQEELARQKKLAEEEKRKK
FKDHMDNMKKWVADLNTFLDDGLECDSDSICSYLENLSGLLSDKDLIDED
LTELKDDICSGKCGAEYSKPLSNEVNEFEKKLKDSLSKANNIKNALNQNR
DQLKICEKNMEQVADWINNLDKAMEDINDTRSPETFEQSLNKFKTNLYTE
PTAVNSLKEVQEIFTKIKNSAPKNLKETQMQNKIKDLETKLKEKTEKGKA
IDKSLKDFDKSLSKANDWQKDYEKKISNIGPLSNDISKLKQQLEKIENLK
KLQKDGENIIQDAIEKGQVALTCSSEFEPIQAKINSNLENAENKWLQNTD
AIENLKDEIMERLSKVEGVMQSGSKVDSWLKEKEADLKASKGPCDSLTQK
IAKIDDLKKLLNEIESEWPIIEDYLNELQEIAQTDPNALRKLNQTKQQLS
NLQTNIKDAIKDAENNVKNHQNFDNKMNGASEWLEMAKALKLDATSKETP
GSIEEMKKTKGYY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000044cephalic ganglia
PLANA:0000099neuron
PLANA:0000418head
PLANA:0000420parapharyngeal region
PLANA:0000463cholinergic neuron
Vocabulary: INTERPRO
TermDefinition
IPR018159Spectrin/alpha-actinin
IPR002017Spectrin_repeat
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003779actin binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 125..159
NoneNo IPR availableCOILSCoilCoilcoord: 282..316
NoneNo IPR availableCOILSCoilCoilcoord: 227..247
NoneNo IPR availableCOILSCoilCoilcoord: 1..49
NoneNo IPR availableCOILSCoilCoilcoord: 338..358
NoneNo IPR availableCOILSCoilCoilcoord: 397..417
NoneNo IPR availableCOILSCoilCoilcoord: 442..466
NoneNo IPR availableGENE3DG3DSA:1.20.58.60coord: 252..372
e-value: 1.1E-6
score: 30.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..53
NoneNo IPR availablePANTHERPTHR47535FAMILY NOT NAMEDcoord: 26..489
NoneNo IPR availablePANTHERPTHR47535:SF5SPECTRIN REPEAT-CONTAINING, NUCLEAR ENVELOPE 1Bcoord: 26..489
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 208..324
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 310..464
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 114..195