Protein transport protein Sec61 subunit beta

Overview
NameProtein transport protein Sec61 subunit beta
Smed IDSMED30022184
Length (bp)398
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein transport protein Sec61 subunit beta (SMED30022184) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein transport protein Sec61 subunit beta (SMED30022184) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein transport protein Sec61 subunit beta (SMED30022184) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein transport protein Sec61 subunit beta (SMED30022184) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022184

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30022184 dd_Smed_v4_418_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30022184 dd_Smed_v4_418_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022184 dd_Smed_v4_418_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30022184 dd_Smed_v4_418_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30022184 dd_Smed_v4_418_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30022184 dd_Smed_v4_418_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30022184 dd_Smed_v4_418_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30022184 dd_Smed_v4_418_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30022184 dd_Smed_v4_418_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein transport protein Sec61 subunit beta vs. Ensembl Human
Match: SEC61B (SEC61 translocon beta subunit [Source:HGNC Symbol;Acc:HGNC:16993])

HSP 1 Score: 100.138 bits (248), Expect = 4.548e-28
Identity = 63/101 (62.38%), Postives = 69/101 (68.32%), Query Frame = 3
Query:   69 MAGPA-SSTTVGG-GRAPSNRVTPAPRTAGSTTGARQRKATGSAPKRXXXXXXXXXXXXMWRFYTEDSPGIKVDPVPVLVMSVLFIASVFLLHIWGKYTRS 365
            M GP  S T VG  GR+PS  V  A R AGST   RQRK   S   R+      +   GMWRFYTEDSPG+KV PVPVLVMS+LFIASVF+LHIWGKYTRS
Sbjct:    1 MPGPTPSGTNVGSSGRSPSKAV--AARAAGSTV--RQRK-NASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS 96          
BLAST of Protein transport protein Sec61 subunit beta vs. Ensembl Human
Match: SEC61B (SEC61 translocon beta subunit [Source:HGNC Symbol;Acc:HGNC:16993])

HSP 1 Score: 84.3445 bits (207), Expect = 2.260e-22
Identity = 38/42 (90.48%), Postives = 41/42 (97.62%), Query Frame = 3
Query:  240 MWRFYTEDSPGIKVDPVPVLVMSVLFIASVFLLHIWGKYTRS 365
            MWRFYTEDSPG+KV PVPVLVMS+LFIASVF+LHIWGKYTRS
Sbjct:    1 MWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS 42          
BLAST of Protein transport protein Sec61 subunit beta vs. Ensembl Celegans
Match: Y38F2AR.9 (Protein transport protein Sec61 subunit beta [Source:UniProtKB/TrEMBL;Acc:Q95XS2])

HSP 1 Score: 78.1814 bits (191), Expect = 5.634e-20
Identity = 42/71 (59.15%), Postives = 51/71 (71.83%), Query Frame = 3
Query:  153 STTGARQRKATGSAPKRXXXXXXXXXXXXMWRFYTEDSPGIKVDPVPVLVMSVLFIASVFLLHIWGKYTRS 365
            +T G RQRK    A         G +  G+WRFYTEDS G+K+ PVPVLVMS++FIASVF+LHIWGK+TRS
Sbjct:   11 TTGGVRQRKGG--AAAAPARARAGGNNGGLWRFYTEDSTGLKIGPVPVLVMSLVFIASVFVLHIWGKFTRS 79          
BLAST of Protein transport protein Sec61 subunit beta vs. Ensembl Fly
Match: Sec61beta (gene:FBgn0010638 transcript:FBtr0087498)

HSP 1 Score: 102.064 bits (253), Expect = 4.700e-29
Identity = 64/102 (62.75%), Postives = 74/102 (72.55%), Query Frame = 3
Query:   69 MAGPASSTTVGGG-RAPSNRVTPAPRTAGSTTGA--RQRKATGSAPKRXXXXXXXXXXXXMWRFYTEDSPGIKVDPVPVLVMSVLFIASVFLLHIWGKYTRS 365
            M  PASST+VG G R+PS     APR+AGS  G+  +QRK T S     +   GG+   GMWRFYT+DSPGIKV PVPVLVMS+LFIASVF+LHIWGKY RS
Sbjct:    1 MPAPASSTSVGSGSRSPSK--LSAPRSAGSGGGSTLKQRKTTTSTTAARSRAPGGAGTGGMWRFYTDDSPGIKVGPVPVLVMSLLFIASVFMLHIWGKYNRS 100          
BLAST of Protein transport protein Sec61 subunit beta vs. Ensembl Zebrafish
Match: sec61b (SEC61 translocon beta subunit [Source:ZFIN;Acc:ZDB-GENE-040718-260])

HSP 1 Score: 109.383 bits (272), Expect = 7.025e-32
Identity = 63/99 (63.64%), Postives = 71/99 (71.72%), Query Frame = 3
Query:   69 MAGPASSTTVGGGRAPSNRVTPAPRTAGSTTGARQRKATGSAPKRXXXXXXXXXXXXMWRFYTEDSPGIKVDPVPVLVMSVLFIASVFLLHIWGKYTRS 365
            M GPA+S T  G  + S   T APRTAG  T ARQRKAT S+ +        +   GMWRFYTEDSPG+KV PVPVLVMS+LFIASVF+LHIWGKYTRS
Sbjct:    1 MPGPAASATNVGASSRSPSKTVAPRTAG--TSARQRKATSSSARSGGRSTASAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS 97          
BLAST of Protein transport protein Sec61 subunit beta vs. Ensembl Zebrafish
Match: sec61b (SEC61 translocon beta subunit [Source:ZFIN;Acc:ZDB-GENE-040718-260])

HSP 1 Score: 62.7734 bits (151), Expect = 8.732e-14
Identity = 46/99 (46.46%), Postives = 53/99 (53.54%), Query Frame = 3
Query:   69 MAGPASSTTVGGGRAPSNRVTPAPRTAGSTTGARQRKATGSAPKRXXXXXXXXXXXXMWRFYTEDSPGIKVDPVPVLVMSVLFIASVFLLHIWGKYTRS 365
            M GPA+S T  G  + S   T APRTAG  T ARQRKAT S+ +        +                      VLVMS+LFIASVF+LHIWGKYTRS
Sbjct:    1 MPGPAASATNVGASSRSPSKTVAPRTAG--TSARQRKATSSSARSGGRSTASA----------------------VLVMSLLFIASVFMLHIWGKYTRS 75          
BLAST of Protein transport protein Sec61 subunit beta vs. Ensembl Xenopus
Match: sec61b (SEC61 translocon beta subunit [Source:NCBI gene;Acc:100038128])

HSP 1 Score: 106.301 bits (264), Expect = 1.559e-30
Identity = 64/101 (63.37%), Postives = 72/101 (71.29%), Query Frame = 3
Query:   69 MAGPASSTTVGGG--RAPSNRVTPAPRTAGSTTGARQRKATGSAPKRXXXXXXXXXXXXMWRFYTEDSPGIKVDPVPVLVMSVLFIASVFLLHIWGKYTRS 365
            M GPA+S T  G   R+PS  V  APRTAGST   RQRK   S+  R+      +   GMWRFYTEDSPG+KV PVPVLVMS+LFIASVF+LHIWGKYTRS
Sbjct:    1 MPGPAASATNVGASSRSPSKAV--APRTAGSTV--RQRK-NASSSTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS 96          
BLAST of Protein transport protein Sec61 subunit beta vs. Ensembl Mouse
Match: Sec61b (Sec61 beta subunit [Source:MGI Symbol;Acc:MGI:1913462])

HSP 1 Score: 99.3673 bits (246), Expect = 8.156e-28
Identity = 62/101 (61.39%), Postives = 69/101 (68.32%), Query Frame = 3
Query:   69 MAGPA-SSTTVGG-GRAPSNRVTPAPRTAGSTTGARQRKATGSAPKRXXXXXXXXXXXXMWRFYTEDSPGIKVDPVPVLVMSVLFIASVFLLHIWGKYTRS 365
            M GP  S T VG  GR+PS  V  A R AGST   RQRK   S   R+      +   GMWRFYTEDSPG+KV PVPVLVMS+LFIA+VF+LHIWGKYTRS
Sbjct:    1 MPGPTPSGTNVGSSGRSPSKAV--AARAAGSTV--RQRK-NASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIAAVFMLHIWGKYTRS 96          
BLAST of Protein transport protein Sec61 subunit beta vs. Ensembl Mouse
Match: Gm10320 (predicted pseudogene 10320 [Source:MGI Symbol;Acc:MGI:3642323])

HSP 1 Score: 99.7525 bits (247), Expect = 8.437e-28
Identity = 61/95 (64.21%), Postives = 67/95 (70.53%), Query Frame = 3
Query:   84 SSTTVGG-GRAPSNRVTPAPRTAGSTTGARQRKATGSAPKRXXXXXXXXXXXXMWRFYTEDSPGIKVDPVPVLVMSVLFIASVFLLHIWGKYTRS 365
            S T VG  GR+PS  V  A R AGST   RQRK   S   R+T     +   GMWRFYTEDSPG+KV PVPVLVMS+LFIASVF+LHIWGKYTRS
Sbjct:   24 SGTNVGSSGRSPSKAV--AARAAGST--VRQRK-NASCGTRSTGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS 113          
BLAST of Protein transport protein Sec61 subunit beta vs. UniProt/SwissProt
Match: sp|Q5RB31|SC61B_PONAB (Protein transport protein Sec61 subunit beta OS=Pongo abelii OX=9601 GN=SEC61B PE=3 SV=3)

HSP 1 Score: 100.138 bits (248), Expect = 2.184e-27
Identity = 63/101 (62.38%), Postives = 69/101 (68.32%), Query Frame = 3
Query:   69 MAGPA-SSTTVGG-GRAPSNRVTPAPRTAGSTTGARQRKATGSAPKRXXXXXXXXXXXXMWRFYTEDSPGIKVDPVPVLVMSVLFIASVFLLHIWGKYTRS 365
            M GP  S T VG  GR+PS  V  A R AGST   RQRK   S   R+      +   GMWRFYTEDSPG+KV PVPVLVMS+LFIASVF+LHIWGKYTRS
Sbjct:    1 MPGPTPSGTNVGSSGRSPSKAV--AARAAGSTV--RQRK-NASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS 96          
BLAST of Protein transport protein Sec61 subunit beta vs. UniProt/SwissProt
Match: sp|P60468|SC61B_HUMAN (Protein transport protein Sec61 subunit beta OS=Homo sapiens OX=9606 GN=SEC61B PE=1 SV=2)

HSP 1 Score: 100.138 bits (248), Expect = 2.184e-27
Identity = 63/101 (62.38%), Postives = 69/101 (68.32%), Query Frame = 3
Query:   69 MAGPA-SSTTVGG-GRAPSNRVTPAPRTAGSTTGARQRKATGSAPKRXXXXXXXXXXXXMWRFYTEDSPGIKVDPVPVLVMSVLFIASVFLLHIWGKYTRS 365
            M GP  S T VG  GR+PS  V  A R AGST   RQRK   S   R+      +   GMWRFYTEDSPG+KV PVPVLVMS+LFIASVF+LHIWGKYTRS
Sbjct:    1 MPGPTPSGTNVGSSGRSPSKAV--AARAAGSTV--RQRK-NASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS 96          
BLAST of Protein transport protein Sec61 subunit beta vs. UniProt/SwissProt
Match: sp|P60467|SC61B_CANLF (Protein transport protein Sec61 subunit beta OS=Canis lupus familiaris OX=9615 GN=SEC61B PE=1 SV=2)

HSP 1 Score: 100.138 bits (248), Expect = 2.184e-27
Identity = 63/101 (62.38%), Postives = 69/101 (68.32%), Query Frame = 3
Query:   69 MAGPA-SSTTVGG-GRAPSNRVTPAPRTAGSTTGARQRKATGSAPKRXXXXXXXXXXXXMWRFYTEDSPGIKVDPVPVLVMSVLFIASVFLLHIWGKYTRS 365
            M GP  S T VG  GR+PS  V  A R AGST   RQRK   S   R+      +   GMWRFYTEDSPG+KV PVPVLVMS+LFIASVF+LHIWGKYTRS
Sbjct:    1 MPGPTPSGTNVGSSGRSPSKAV--AARAAGSTV--RQRK-NASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS 96          
BLAST of Protein transport protein Sec61 subunit beta vs. UniProt/SwissProt
Match: sp|Q9CQS8|SC61B_MOUSE (Protein transport protein Sec61 subunit beta OS=Mus musculus OX=10090 GN=Sec61b PE=1 SV=3)

HSP 1 Score: 99.3673 bits (246), Expect = 5.705e-27
Identity = 62/101 (61.39%), Postives = 69/101 (68.32%), Query Frame = 3
Query:   69 MAGPA-SSTTVGG-GRAPSNRVTPAPRTAGSTTGARQRKATGSAPKRXXXXXXXXXXXXMWRFYTEDSPGIKVDPVPVLVMSVLFIASVFLLHIWGKYTRS 365
            M GP  S T VG  GR+PS  V  A R AGST   RQRK   S   R+      +   GMWRFYTEDSPG+KV PVPVLVMS+LFIA+VF+LHIWGKYTRS
Sbjct:    1 MPGPTPSGTNVGSSGRSPSKAV--AARAAGSTV--RQRK-NASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIAAVFMLHIWGKYTRS 96          
BLAST of Protein transport protein Sec61 subunit beta vs. UniProt/SwissProt
Match: sp|Q54YR4|SC61B_DICDI (Protein transport protein Sec61 subunit beta OS=Dictyostelium discoideum OX=44689 GN=sec61b PE=3 SV=1)

HSP 1 Score: 60.077 bits (144), Expect = 4.718e-12
Identity = 26/42 (61.90%), Postives = 33/42 (78.57%), Query Frame = 3
Query:  240 MWRFYTEDSPGIKVDPVPVLVMSVLFIASVFLLHIWGKYTRS 365
            M +FY+ED+ G+KV P  VL MS++FIA V +LHI GKYTRS
Sbjct:   20 MMKFYSEDAIGLKVGPTAVLFMSLIFIAFVIILHIMGKYTRS 61          
BLAST of Protein transport protein Sec61 subunit beta vs. TrEMBL
Match: A0A3B4EIR8 (Protein transport protein Sec61 subunit beta OS=Pygocentrus nattereri OX=42514 PE=3 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 3.625e-30
Identity = 65/101 (64.36%), Postives = 73/101 (72.28%), Query Frame = 3
Query:   69 MAGPASSTTVGG--GRAPSNRVTPAPRTAGSTTGARQRKATGSAPKRXXXXXXXXXXXXMWRFYTEDSPGIKVDPVPVLVMSVLFIASVFLLHIWGKYTRS 365
            M GPA+S +  G  GR+PS  V  APR AGST   RQRKATGS  +        +   GMWRFYTEDSPG+KV PVPVLVMS+LFIASVF+LHIWGKYTRS
Sbjct:    1 MPGPAASASNVGASGRSPSKTV--APRAAGSTV--RQRKATGSGTRSAGRATASAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS 97          
BLAST of Protein transport protein Sec61 subunit beta vs. TrEMBL
Match: D6WLZ4 (Protein transport protein Sec61 subunit beta OS=Tribolium castaneum OX=7070 GN=TcasGA2_TC013365 PE=3 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 4.089e-30
Identity = 67/100 (67.00%), Postives = 73/100 (73.00%), Query Frame = 3
Query:   69 MAGPASSTTVG-GGRAPSNRVTPAPRTAGSTTGARQRKATGSAPKRXXXXXXXXXXXXMWRFYTEDSPGIKVDPVPVLVMSVLFIASVFLLHIWGKYTRS 365
            M  PASSTTVG GGR+PS  V  APR+ G  T  RQRK T +AP R     G      MWRFYT+DSPGIKV PVPVLVMS+LFIASVF+LHIWGKYTRS
Sbjct:    1 MPAPASSTTVGSGGRSPSKTV--APRSGGGGT-VRQRKTTSAAPARRNTGAGSGG---MWRFYTDDSPGIKVGPVPVLVMSLLFIASVFMLHIWGKYTRS 94          
BLAST of Protein transport protein Sec61 subunit beta vs. TrEMBL
Match: W5MDH0 (Protein transport protein Sec61 subunit beta OS=Lepisosteus oculatus OX=7918 PE=3 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 5.142e-30
Identity = 64/96 (66.67%), Postives = 72/96 (75.00%), Query Frame = 3
Query:   81 ASSTTVGG-GRAPSNRVTPAPRTAGSTTGARQRKATGSAPKRXXXXXXXXXXXXMWRFYTEDSPGIKVDPVPVLVMSVLFIASVFLLHIWGKYTRS 365
            AS+T+VGG GR+PS  V  APR AGST   RQRKAT S  +        +   GMWRFYTEDSPG+KV PVPVLVMS+LFIASVF+LHIWGKYTRS
Sbjct:    6 ASATSVGGSGRSPSKAV--APRAAGSTV--RQRKATSSGTRSAGRGATSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS 97          
BLAST of Protein transport protein Sec61 subunit beta vs. TrEMBL
Match: A0A3P8RMZ9 (Protein transport protein Sec61 subunit beta OS=Amphiprion percula OX=161767 PE=3 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 3.155e-29
Identity = 66/101 (65.35%), Postives = 73/101 (72.28%), Query Frame = 3
Query:   69 MAGPASSTTVGG--GRAPSNRVTPAPRTAGSTTGARQRKATGSAPKRXXXXXXXXXXXXMWRFYTEDSPGIKVDPVPVLVMSVLFIASVFLLHIWGKYTRS 365
            M GPA+S T  G  GR+PS  V  APR AGST   RQRKAT S  +      G +   GMWRFYTEDSPG+KV PVPVLVMS+LFIASVF+LHIWGKYTRS
Sbjct:    1 MPGPAASATNVGASGRSPSKTV--APRAAGSTV--RQRKATSSGTRSGGRTTGSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS 97          
BLAST of Protein transport protein Sec61 subunit beta vs. TrEMBL
Match: A0A3B4XM60 (Protein transport protein Sec61 subunit beta OS=Seriola lalandi dorsalis OX=1841481 PE=3 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 3.155e-29
Identity = 66/101 (65.35%), Postives = 73/101 (72.28%), Query Frame = 3
Query:   69 MAGPASSTTVGG--GRAPSNRVTPAPRTAGSTTGARQRKATGSAPKRXXXXXXXXXXXXMWRFYTEDSPGIKVDPVPVLVMSVLFIASVFLLHIWGKYTRS 365
            M GPA+S T  G  GR+PS  V  APR AGST   RQRKAT S  +      G +   GMWRFYTEDSPG+KV PVPVLVMS+LFIASVF+LHIWGKYTRS
Sbjct:    1 MPGPAASATNVGASGRSPSKTV--APRAAGSTV--RQRKATSSGTRSGGRTTGSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS 97          
BLAST of Protein transport protein Sec61 subunit beta vs. Ensembl Cavefish
Match: sec61b (SEC61 translocon beta subunit [Source:ZFIN;Acc:ZDB-GENE-040718-260])

HSP 1 Score: 101.679 bits (252), Expect = 1.190e-28
Identity = 52/76 (68.42%), Postives = 57/76 (75.00%), Query Frame = 3
Query:  138 PRTAGSTTGARQRKATGSAPKRXXXXXXXXXXXXMWRFYTEDSPGIKVDPVPVLVMSVLFIASVFLLHIWGKYTRS 365
            PR AGST   RQRKATG   +        +   GMWRFYTEDSPG+KV PVPVLVMS+LFIASVF+LHIWGKYTRS
Sbjct:   44 PRAAGSTV--RQRKATGGGARSAGRATASAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS 117          
BLAST of Protein transport protein Sec61 subunit beta vs. Ensembl Yeast
Match: SBH1 (Beta subunit of Sec61p ER translocation complex (Sec61p-Sss1p-Sbh1p); involved in protein translocation into the endoplasmic reticulum; interacts with the exocyst complex and also with Rtn1p; cotranslationally N-acetylated by NatA; SBH1 has a paralog, SBH2, that arose from the whole genome duplication [Source:SGD;Acc:S000002128])

HSP 1 Score: 41.5874 bits (96), Expect = 1.759e-6
Identity = 26/80 (32.50%), Postives = 42/80 (52.50%), Query Frame = 3
Query:  114 PSNRVTPAPRTAGSTTGARQRKATGSAPKRXXXXXXXXXXXXMWRFYTEDSPGIKVDPVPVLVMSVLFIASVFLLHIWGK 353
            P  + T   R  GS+     +K   SAPK+ T          + + Y++++ G++VDP+ VL ++V FI SV  LH+  K
Sbjct:    7 PGGQRTLQKRKQGSS-----QKVAASAPKKNTNSNNS-----ILKIYSDEATGLRVDPLVVLFLAVGFIFSVVALHVISK 76          
BLAST of Protein transport protein Sec61 subunit beta vs. Ensembl Nematostella
Match: EDO49392 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGB6])

HSP 1 Score: 102.834 bits (255), Expect = 8.027e-30
Identity = 63/94 (67.02%), Postives = 69/94 (73.40%), Query Frame = 3
Query:   84 SSTTVGGGRAPSNRVTPAPRTAGSTTGA-RQRKATGSAPKRXXXXXXXXXXXXMWRFYTEDSPGIKVDPVPVLVMSVLFIASVFLLHIWGKYTR 362
            SST VG GR+PS  V     + GS+ G  RQRKA GS   RTT P   SS   MWRFYTEDSPG+KV PVPVLVMS+LFIASVF+LHIWGKYTR
Sbjct:    7 SSTAVGAGRSPSKAVA----SRGSSGGQLRQRKAGGSTASRTTRPTAASSSG-MWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTR 95          
BLAST of Protein transport protein Sec61 subunit beta vs. Ensembl Medaka
Match: sec61b (SEC61 translocon beta subunit [Source:NCBI gene;Acc:101167479])

HSP 1 Score: 108.612 bits (270), Expect = 1.547e-31
Identity = 63/96 (65.62%), Postives = 71/96 (73.96%), Query Frame = 3
Query:   81 ASSTTVGGG-RAPSNRVTPAPRTAGSTTGARQRKATGSAPKRXXXXXXXXXXXXMWRFYTEDSPGIKVDPVPVLVMSVLFIASVFLLHIWGKYTRS 365
            AS+T VG   R+PS  V  APR AGST   RQRKAT S+ +      G +   GMWRFYTEDSPG+KV PVPVLVMS+LFIASVF+LHIWGKYTRS
Sbjct:    6 ASATNVGASSRSPSKTV--APRAAGSTV--RQRKATSSSTRSGGRTTGSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS 97          
BLAST of Protein transport protein Sec61 subunit beta vs. Planmine SMEST
Match: SMESG000050010.1 (SMESG000050010.1)

HSP 1 Score: 171.014 bits (432), Expect = 5.973e-56
Identity = 99/106 (93.40%), Postives = 99/106 (93.40%), Query Frame = 3
Query:   51 LIYYFNMAGPASSTTVGGGRAPSNRVTPAPRTAGSTTGARQRKATGSAPKRXXXXXXXXXXXXMWRFYTEDSPGIKVDPVPVLVMSVLFIASVFLLHIWGKYTRSS 368
            L      AGPASSTTVGGGRAPSNRVTPAPRTAGSTTGARQRKATGSAPKRTTAPGGGSSGAGMWRFYTEDSPGIKV PVPVLVMSVLFIASVFLLHIWGKYTRSS
Sbjct:   28 LAKEVQQAGPASSTTVGGGRAPSNRVTPAPRTAGSTTGARQRKATGSAPKRTTAPGGGSSGAGMWRFYTEDSPGIKVGPVPVLVMSVLFIASVFLLHIWGKYTRSS 133          
BLAST of Protein transport protein Sec61 subunit beta vs. Planmine SMEST
Match: SMESG000013437.1 (SMESG000013437.1)

HSP 1 Score: 171.014 bits (432), Expect = 6.172e-56
Identity = 99/106 (93.40%), Postives = 99/106 (93.40%), Query Frame = 3
Query:   51 LIYYFNMAGPASSTTVGGGRAPSNRVTPAPRTAGSTTGARQRKATGSAPKRXXXXXXXXXXXXMWRFYTEDSPGIKVDPVPVLVMSVLFIASVFLLHIWGKYTRSS 368
            L      AGPASSTTVGGGRAPSNRVTPAPRTAGSTTGARQRKATGSAPKRTTAPGGGSSGAGMWRFYTEDSPGIKV PVPVLVMSVLFIASVFLLHIWGKYTRSS
Sbjct:   28 LTKEVQQAGPASSTTVGGGRAPSNRVTPAPRTAGSTTGARQRKATGSAPKRTTAPGGGSSGAGMWRFYTEDSPGIKVGPVPVLVMSVLFIASVFLLHIWGKYTRSS 133          
The following BLAST results are available for this feature:
BLAST of Protein transport protein Sec61 subunit beta vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
SEC61B4.548e-2862.38SEC61 translocon beta subunit [Source:HGNC Symbol;... [more]
SEC61B2.260e-2290.48SEC61 translocon beta subunit [Source:HGNC Symbol;... [more]
back to top
BLAST of Protein transport protein Sec61 subunit beta vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Y38F2AR.95.634e-2059.15Protein transport protein Sec61 subunit beta [Sou... [more]
back to top
BLAST of Protein transport protein Sec61 subunit beta vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Sec61beta4.700e-2962.75gene:FBgn0010638 transcript:FBtr0087498[more]
back to top
BLAST of Protein transport protein Sec61 subunit beta vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
sec61b7.025e-3263.64SEC61 translocon beta subunit [Source:ZFIN;Acc:ZDB... [more]
sec61b8.732e-1446.46SEC61 translocon beta subunit [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Protein transport protein Sec61 subunit beta vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
sec61b1.559e-3063.37SEC61 translocon beta subunit [Source:NCBI gene;Ac... [more]
back to top
BLAST of Protein transport protein Sec61 subunit beta vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Sec61b8.156e-2861.39Sec61 beta subunit [Source:MGI Symbol;Acc:MGI:1913... [more]
Gm103208.437e-2864.21predicted pseudogene 10320 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Protein transport protein Sec61 subunit beta vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5RB31|SC61B_PONAB2.184e-2762.38Protein transport protein Sec61 subunit beta OS=Po... [more]
sp|P60468|SC61B_HUMAN2.184e-2762.38Protein transport protein Sec61 subunit beta OS=Ho... [more]
sp|P60467|SC61B_CANLF2.184e-2762.38Protein transport protein Sec61 subunit beta OS=Ca... [more]
sp|Q9CQS8|SC61B_MOUSE5.705e-2761.39Protein transport protein Sec61 subunit beta OS=Mu... [more]
sp|Q54YR4|SC61B_DICDI4.718e-1261.90Protein transport protein Sec61 subunit beta OS=Di... [more]
back to top
BLAST of Protein transport protein Sec61 subunit beta vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3B4EIR83.625e-3064.36Protein transport protein Sec61 subunit beta OS=Py... [more]
D6WLZ44.089e-3067.00Protein transport protein Sec61 subunit beta OS=Tr... [more]
W5MDH05.142e-3066.67Protein transport protein Sec61 subunit beta OS=Le... [more]
A0A3P8RMZ93.155e-2965.35Protein transport protein Sec61 subunit beta OS=Am... [more]
A0A3B4XM603.155e-2965.35Protein transport protein Sec61 subunit beta OS=Se... [more]
back to top
BLAST of Protein transport protein Sec61 subunit beta vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
sec61b1.190e-2868.42SEC61 translocon beta subunit [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Protein transport protein Sec61 subunit beta vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein transport protein Sec61 subunit beta vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SBH11.759e-632.50Beta subunit of Sec61p ER translocation complex (S... [more]
back to top
BLAST of Protein transport protein Sec61 subunit beta vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO493928.027e-3067.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein transport protein Sec61 subunit beta vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
sec61b1.547e-3165.63SEC61 translocon beta subunit [Source:NCBI gene;Ac... [more]
back to top
BLAST of Protein transport protein Sec61 subunit beta vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000050010.15.973e-5693.40SMESG000050010.1[more]
SMESG000013437.16.172e-5693.40SMESG000013437.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022184 ID=SMED30022184|Name=Protein transport protein Sec61 subunit beta|organism=Schmidtea mediterranea sexual|type=transcript|length=398bp
AATTTGTTTATCTCAACTAATTTTAATTTATAATTTAAACGTCACCGTAA
TTAATTTATTATTTTAACATGGCAGGCCCTGCAAGTTCAACAACCGTTGG
TGGTGGAAGAGCTCCATCAAATCGAGTAACTCCAGCTCCAAGAACTGCTG
GTTCAACTACTGGAGCTAGGCAAAGGAAAGCTACTGGATCGGCTCCAAAG
CGAACAACTGCACCTGGTGGTGGTAGTTCCGGAGCCGGCATGTGGAGATT
CTATACTGAAGATTCACCAGGAATTAAAGTTGATCCAGTTCCAGTTTTAG
TAATGAGTGTCTTGTTCATTGCTTCTGTCTTTTTACTTCACATATGGGGT
AAATATACAAGAAGCTCTTAATTTCCTATAATATATGGTTTTTGATTG
back to top

protein sequence of SMED30022184-orf-1

>SMED30022184-orf-1 ID=SMED30022184-orf-1|Name=SMED30022184-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=101bp
MAGPASSTTVGGGRAPSNRVTPAPRTAGSTTGARQRKATGSAPKRTTAPG
GGSSGAGMWRFYTEDSPGIKVDPVPVLVMSVLFIASVFLLHIWGKYTRSS
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
GO:0016021integral component of membrane
GO:0005784Sec61 translocon complex
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0015031protein transport
GO:0006886intracellular protein transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002032epidermal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR030671Sec61-beta/Sbh
IPR016482SecG/Sec61-beta/Sbh
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR016482Protein transport protein SecG/Sec61-beta/SbhPFAMPF03911Sec61_betacoord: 54..94
e-value: 1.0E-21
score: 76.6
IPR030671Protein transport Sec61-beta/SbhPIRSFPIRSF006398Sec61_betacoord: 5..100
e-value: 3.1E-29
score: 99.0
IPR030671Protein transport Sec61-beta/SbhPANTHERPTHR13509SEC61BETA-PROV PROTEINcoord: 9..98
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..59
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 22..48
NoneNo IPR availablePANTHERPTHR13509:SF3PROTEIN TRANSPORT PROTEIN SEC61 SUBUNIT BETAcoord: 9..98
NoneNo IPR availableTMHMMTMhelixcoord: 71..93