Tubulin polyglutamylase TTLL7

Overview
NameTubulin polyglutamylase TTLL7
Smed IDSMED30022163
Length (bp)3003
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tubulin polyglutamylase TTLL7 (SMED30022163) t-SNE clustered cells

Violin plots show distribution of expression levels for Tubulin polyglutamylase TTLL7 (SMED30022163) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tubulin polyglutamylase TTLL7 (SMED30022163) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tubulin polyglutamylase TTLL7 (SMED30022163) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022163

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30022163SMESG000055128.1 SmedASXL_016251SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30022163SMESG000055128.1 dd_Smed_v4_13600_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30022163SMESG000055128.1 dd_Smed_v4_13600_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022163SMESG000055128.1 dd_Smed_v4_13600_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30022163SMESG000055128.1 dd_Smed_v4_13600_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30022163SMESG000055128.1 dd_Smed_v4_13600_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
Smed sexual biotypeSMED30022163SMESG000055128.1 Contig41401newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022163SMESG000055128.1 Contig41401uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022163SMESG000081654.1 SMESG000076991.1 SMESG000072322.1 SMESG000065118.1 SMESG000062986.1 SMESG000061717.1 SMESG000055128.1 SMESG000053897.1 SMESG000051051.1 SMESG000041215.1 SMESG000034628.1 SMESG000019218.1 SMESG000017667.1 SMESG000011728.1 SMESG000009672.1 SMESG000002766.1 SMESG000002063.1 SMESG000001508.1 Contig30966newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022163SMESG000081654.1 SMESG000076991.1 SMESG000072322.1 SMESG000065118.1 SMESG000062986.1 SMESG000061717.1 SMESG000055128.1 SMESG000053897.1 SMESG000051051.1 SMESG000041215.1 SMESG000034628.1 SMESG000019218.1 SMESG000017667.1 SMESG000011728.1 SMESG000009672.1 SMESG000002766.1 SMESG000002063.1 SMESG000001508.1 Contig30966uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30022163SMESG000055128.1 dd_Smed_v6_13600_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30022163SMESG000055128.1 dd_Smed_v4_13600_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Human
Match: TTLL7 (tubulin tyrosine ligase like 7 [Source:HGNC Symbol;Acc:HGNC:26242])

HSP 1 Score: 398.667 bits (1023), Expect = 2.506e-127
Identity = 223/493 (45.23%), Postives = 324/493 (65.72%), Query Frame = 3
Query:  297 MTANVNGTRFEIVKKILESVGFTLRDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXXXLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRKDIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDDKTVYDYYAELLVDSFTLFNQLNYQNCSTDSTQATQQMLQSFMPNQFREEDIMEQIKQCEAEENALLEK 1775
            +TANV GT+FEIV+ +++ +GF    DE  +T  LIW DS + QE+I+EL++YQRINHF GM EI RKDFL +  +KM K RP DY + P+TW+FP E      Y+KE KK  K+K FI+KPANGAMG GI L    D + S +  IVQEYI+KP L++GYK D RIY+L+T CDPL+ F+Y +GLVR+ TEKY   ++  +  ++ HLTNYSVNK N ++ R   E+ GSK+S+      F      +    W  I ++VVKTL++ +PH++H YRMCR GQ    +SV FE+LGFDILLD  L PWLLE+NR+PSFG D+ +D  VK  +L++  +LLNI+ S+K+++L  QK +AQRRL       ++ P   ++  ++R  +E+RK++L + L +V+   SRE  ENRH+GN+ R++PP+DK + + Y  LL  +F  F         +    + Q+ L + +  + +EEDI++ ++QCE ++  L+ K
Sbjct:   41 ITANVAGTKFEIVRLVIDEMGFMKTPDED-ETSNLIWCDSAVQQEKISELQNYQRINHFPGMGEICRKDFLARNMTKMIKSRPLDYTFVPRTWIFPAEYTQFQNYVKELKKKRKQKTFIVKPANGAMGHGISLIRNGDKLPSQDHLIVQEYIEKPFLMEGYKFDLRIYILVTSCDPLKIFLYHDGLVRMGTEKYIPPNESNLTQLYMHLTNYSVNKHNEHFERDETENKGSKRSIK-WFTEFLQANQHDVAKFWSDISELVVKTLIVAEPHVLHAYRMCRPGQPPGSESVCFEVLGFDILLDRKLKPWLLEINRAPSFGTDQKIDYDVKRGVLLNALKLLNIRTSDKRRNLAKQKAEAQRRLYGQNSIKRLLPG-SSDWEQQRHQLERRKEELKERLAQVRKQISREEHENRHMGNYRRIYPPEDKALLEKYENLLAVAFQTF--------LSGRAASFQRELNNPL-KRMKEEDILDLLEQCEIDDEKLMGK 521          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Human
Match: TTLL7 (tubulin tyrosine ligase like 7 [Source:HGNC Symbol;Acc:HGNC:26242])

HSP 1 Score: 400.593 bits (1028), Expect = 1.888e-126
Identity = 223/493 (45.23%), Postives = 324/493 (65.72%), Query Frame = 3
Query:  297 MTANVNGTRFEIVKKILESVGFTLRDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXXXLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRKDIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDDKTVYDYYAELLVDSFTLFNQLNYQNCSTDSTQATQQMLQSFMPNQFREEDIMEQIKQCEAEENALLEK 1775
            +TANV GT+FEIV+ +++ +GF    DE  +T  LIW DS + QE+I+EL++YQRINHF GM EI RKDFL +  +KM K RP DY + P+TW+FP E      Y+KE KK  K+K FI+KPANGAMG GI L    D + S +  IVQEYI+KP L++GYK D RIY+L+T CDPL+ F+Y +GLVR+ TEKY   ++  +  ++ HLTNYSVNK N ++ R   E+ GSK+S+      F      +    W  I ++VVKTL++ +PH++H YRMCR GQ    +SV FE+LGFDILLD  L PWLLE+NR+PSFG D+ +D  VK  +L++  +LLNI+ S+K+++L  QK +AQRRL       ++ P   ++  ++R  +E+RK++L + L +V+   SRE  ENRH+GN+ R++PP+DK + + Y  LL  +F  F         +    + Q+ L + +  + +EEDI++ ++QCE ++  L+ K
Sbjct:   41 ITANVAGTKFEIVRLVIDEMGFMKTPDED-ETSNLIWCDSAVQQEKISELQNYQRINHFPGMGEICRKDFLARNMTKMIKSRPLDYTFVPRTWIFPAEYTQFQNYVKELKKKRKQKTFIVKPANGAMGHGISLIRNGDKLPSQDHLIVQEYIEKPFLMEGYKFDLRIYILVTSCDPLKIFLYHDGLVRMGTEKYIPPNESNLTQLYMHLTNYSVNKHNEHFERDETENKGSKRSIK-WFTEFLQANQHDVAKFWSDISELVVKTLIVAEPHVLHAYRMCRPGQPPGSESVCFEVLGFDILLDRKLKPWLLEINRAPSFGTDQKIDYDVKRGVLLNALKLLNIRTSDKRRNLAKQKAEAQRRLYGQNSIKRLLPG-SSDWEQQRHQLERRKEELKERLAQVRKQISREEHENRHMGNYRRIYPPEDKALLEKYENLLAVAFQTF--------LSGRAASFQRELNNPL-KRMKEEDILDLLEQCEIDDEKLMGK 521          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Human
Match: TTLL7 (tubulin tyrosine ligase like 7 [Source:HGNC Symbol;Acc:HGNC:26242])

HSP 1 Score: 399.438 bits (1025), Expect = 1.702e-123
Identity = 223/493 (45.23%), Postives = 324/493 (65.72%), Query Frame = 3
Query:  297 MTANVNGTRFEIVKKILESVGFTLRDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXXXLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRKDIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDDKTVYDYYAELLVDSFTLFNQLNYQNCSTDSTQATQQMLQSFMPNQFREEDIMEQIKQCEAEENALLEK 1775
            +TANV GT+FEIV+ +++ +GF    DE  +T  LIW DS + QE+I+EL++YQRINHF GM EI RKDFL +  +KM K RP DY + P+TW+FP E      Y+KE KK  K+K FI+KPANGAMG GI L    D + S +  IVQEYI+KP L++GYK D RIY+L+T CDPL+ F+Y +GLVR+ TEKY   ++  +  ++ HLTNYSVNK N ++ R   E+ GSK+S+      F      +    W  I ++VVKTL++ +PH++H YRMCR GQ    +SV FE+LGFDILLD  L PWLLE+NR+PSFG D+ +D  VK  +L++  +LLNI+ S+K+++L  QK +AQRRL       ++ P   ++  ++R  +E+RK++L + L +V+   SRE  ENRH+GN+ R++PP+DK + + Y  LL  +F  F         +    + Q+ L + +  + +EEDI++ ++QCE ++  L+ K
Sbjct:   41 ITANVAGTKFEIVRLVIDEMGFMKTPDED-ETSNLIWCDSAVQQEKISELQNYQRINHFPGMGEICRKDFLARNMTKMIKSRPLDYTFVPRTWIFPAEYTQFQNYVKELKKKRKQKTFIVKPANGAMGHGISLIRNGDKLPSQDHLIVQEYIEKPFLMEGYKFDLRIYILVTSCDPLKIFLYHDGLVRMGTEKYIPPNESNLTQLYMHLTNYSVNKHNEHFERDETENKGSKRSIK-WFTEFLQANQHDVAKFWSDISELVVKTLIVAEPHVLHAYRMCRPGQPPGSESVCFEVLGFDILLDRKLKPWLLEINRAPSFGTDQKIDYDVKRGVLLNALKLLNIRTSDKRRNLAKQKAEAQRRLYGQNSIKRLLPG-SSDWEQQRHQLERRKEELKERLAQVRKQISREEHENRHMGNYRRIYPPEDKALLEKYENLLAVAFQTF--------LSGRAASFQRELNNPL-KRMKEEDILDLLEQCEIDDEKLMGK 521          

HSP 2 Score: 121.709 bits (304), Expect = 1.788e-27
Identity = 51/139 (36.69%), Postives = 93/139 (66.91%), Query Frame = 3
Query: 2373 IRYPGQTDVETKSMLAKIFSNWEHQRHSVATYWLATLNAKKRDKIIQIVRNNVDKIINDNFKFSADISAARVNRLISKVYNRLLWNRGNGLIQCFS-HFKSWQLIFSHSGDLIKPLELDICSRVVQLCLDCVLIVYQFS 2786
            IR+PG++D E++ ++  I  NW++ +  VA+YWL  L++ K+ K++ IV+ ++  ++   +K   D+    + R+ ++V+NRLLW+RG GL  CF     SW+ IF+ S +++ PL+L  C R+V+LC  C+L+VY+++
Sbjct:  693 IRFPGKSDAESELLIEDIIDNWKYHKTKVASYWLIKLDSVKQRKVLDIVKTSIRTVLPRIWKV-PDVEEVNLYRIFNRVFNRLLWSRGQGLWNCFCDSGSSWESIFNKSPEVVTPLQLQCCQRLVELCKQCLLVVYKYA 830          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Human
Match: TTLL7 (tubulin tyrosine ligase like 7 [Source:HGNC Symbol;Acc:HGNC:26242])

HSP 1 Score: 316.62 bits (810), Expect = 2.906e-96
Identity = 181/416 (43.51%), Postives = 267/416 (64.18%), Query Frame = 3
Query:  528 MQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXXXLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRKDIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDDKTVYDYYAELLVDSFTLFNQLNYQNCSTDSTQATQQMLQSFMPNQFREEDIMEQIKQCEAEENALLEK 1775
            M K RP DY + P+TW+FP E      Y+KE KK  K+K FI+KPANGAMG GI L    D + S +  IVQEYI+KP L++GYK D RIY+L+T CDPL+ F+Y +GLVR+ TEKY   ++  +  ++ HLTNYSVNK N ++ R   E+ GSK+S+      F      +    W  I ++VVKTL++ +PH++H YRMCR GQ    +SV FE+LGFDILLD  L PWLLE+NR+PSFG D+ +D  VK  +L++  +LLNI+ S+K+++L  QK +AQRRL       ++ P   ++  ++R  +E+RK++L + L +V+   SRE  ENRH+GN+ R++PP+DK + + Y  LL  +F  F         +    + Q+ L + +  + +EEDI++ ++QCE ++  L+ K
Sbjct:    1 MIKSRPLDYTFVPRTWIFPAEYTQFQNYVKELKKKRKQKTFIVKPANGAMGHGISLIRNGDKLPSQDHLIVQEYIEKPFLMEGYKFDLRIYILVTSCDPLKIFLYHDGLVRMGTEKYIPPNESNLTQLYMHLTNYSVNKHNEHFERDETENKGSKRSIK-WFTEFLQANQHDVAKFWSDISELVVKTLIVAEPHVLHAYRMCRPGQPPGSESVCFEVLGFDILLDRKLKPWLLEINRAPSFGTDQKIDYDVKRGVLLNALKLLNIRTSDKRRNLAKQKAEAQRRLYGQNSIKRLLPG-SSDWEQQRHQLERRKEELKERLAQVRKQISREEHENRHMGNYRRIYPPEDKALLEKYENLLAVAFQTF--------LSGRAASFQRELNNPL-KRMKEEDILDLLEQCEIDDEKLMGK 405          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Human
Match: TTLL6 (tubulin tyrosine ligase like 6 [Source:HGNC Symbol;Acc:HGNC:26664])

HSP 1 Score: 272.322 bits (695), Expect = 6.909e-77
Identity = 150/359 (41.78%), Postives = 213/359 (59.33%), Query Frame = 3
Query:  297 MTANVNGTRFEIVKKILESVGFTLRDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXXXLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQ 1373
            +  N++  R+E V++  +  GF    ++   T Y  WTD  +S ER+ E+KSYQ+INHF GM EI RKD L +  S+M K+ PKD+ +FP+TW  P +    +  ++   +  K K +I KP +G  G GI +      IK  E  I Q YI KP ++DG+K D RIYVL+T CDPLR F+Y EGL R +T  Y+      +D I  HLTNYS+NK +SN++R   ++    +   S  + +    + N + +W+ I D+++KTL+   P + HNY  C      N  S  FEILGFDILLD  L PWLLEVN SPSF  D  LD++VK  LL DT  L+N++  +K+K L  ++Q+ Q
Sbjct:  109 LVINLSSCRYESVRRAAQQYGFREGGEDDDWTLY--WTDYSVSLERVMEMKSYQKINHFPGMSEICRKDLLARNMSRMLKMFPKDFRFFPRTWCLPAD----WGDLQTYSRSRKNKTYICKPDSGCQGKGIFITRTVKEIKPGEDMICQLYISKPFIIDGFKFDLRIYVLVTSCDPLRIFVYNEGLARFATTSYSRPCTDNLDDICMHLTNYSINKHSSNFSR---DAHSGSKRKLSTFSAYLEDHSYNVEQIWRDIEDVIIKTLISAHPIIRHNYHTCFPNHTLN--SACFEILGFDILLDHKLKPWLLEVNHSPSFSTDSRLDKEVKDGLLYDTLVLINLESCDKKKVLEEERQRGQ 456          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Celegans
Match: ttll-11 (Tubulin Tyrosine Ligase Like [Source:UniProtKB/TrEMBL;Acc:H2KZM9])

HSP 1 Score: 145.591 bits (366), Expect = 5.723e-36
Identity = 101/303 (33.33%), Postives = 164/303 (54.13%), Query Frame = 3
Query:  387 KTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQE-SNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKS-NEPSIVQEYIDKPCLL-DGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRG---VDEXXXXXXXXXXLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVS---FEILGFDILLDENLCPWLLEVNRSPSFGMDETL 1268
            + C + W +  +S           R+N F GM E+++K  LT   S MQKL P +Y ++P +W  P   ++    Y K       + +FI+KP  GA G GI L +  + I++ ++  +VQEY+  P L+ D  K DFR+Y +I   +PL  ++ REG+ R  TEKY         +++ HLTNYS+NK N  Y       D++ GSK+ LS++ ++ +++  + T  LW  I  I+VKT + + P ++ +Y      +   +DS     F+I+GFD+++ E+  P LLEVN +PS   D  +
Sbjct:   59 QPCDVYWHNVVLSDMNKIVTSPQSRVNKFPGMTELAKKISLTHSISSMQKLFPDEYAFYPNSWFLPAHLADFHAFYRKAQALGKTEMWFIVKPDEGAQGTGIYLINSPNQIRNVDQRQLVQEYVADPLLMNDKLKFDFRVYGVIKSINPLSIYVAREGMARFCTEKYEKPDSSNFKNLYAHLTNYSLNKANEAYVHSNTLQDQTRGSKRLLSTVFHQLESR-GVKTKRLWHDIKLILVKTTLAMLPEIMLHY------EHHFYDSTGPQCFQIMGFDVMIREDGTPILLEVNAAPSLTADHIV 354          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Celegans
Match: ttll-11 (Tubulin Tyrosine Ligase Like [Source:UniProtKB/TrEMBL;Acc:H2KZM9])

HSP 1 Score: 145.591 bits (366), Expect = 1.106e-35
Identity = 101/303 (33.33%), Postives = 164/303 (54.13%), Query Frame = 3
Query:  387 KTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQE-SNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKS-NEPSIVQEYIDKPCLL-DGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRG---VDEXXXXXXXXXXLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVS---FEILGFDILLDENLCPWLLEVNRSPSFGMDETL 1268
            + C + W +  +S           R+N F GM E+++K  LT   S MQKL P +Y ++P +W  P   ++    Y K       + +FI+KP  GA G GI L +  + I++ ++  +VQEY+  P L+ D  K DFR+Y +I   +PL  ++ REG+ R  TEKY         +++ HLTNYS+NK N  Y       D++ GSK+ LS++ ++ +++  + T  LW  I  I+VKT + + P ++ +Y      +   +DS     F+I+GFD+++ E+  P LLEVN +PS   D  +
Sbjct:  159 QPCDVYWHNVVLSDMNKIVTSPQSRVNKFPGMTELAKKISLTHSISSMQKLFPDEYAFYPNSWFLPAHLADFHAFYRKAQALGKTEMWFIVKPDEGAQGTGIYLINSPNQIRNVDQRQLVQEYVADPLLMNDKLKFDFRVYGVIKSINPLSIYVAREGMARFCTEKYEKPDSSNFKNLYAHLTNYSLNKANEAYVHSNTLQDQTRGSKRLLSTVFHQLESR-GVKTKRLWHDIKLILVKTTLAMLPEIMLHY------EHHFYDSTGPQCFQIMGFDVMIREDGTPILLEVNAAPSLTADHIV 454          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Celegans
Match: ttll-5 (Tubulin Tyrosine Ligase Like [Source:UniProtKB/TrEMBL;Acc:O17720])

HSP 1 Score: 139.043 bits (349), Expect = 1.100e-33
Identity = 95/318 (29.87%), Postives = 157/318 (49.37%), Query Frame = 3
Query:  399 LIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXX--------XXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXXXLMNRFKTKFNINTDA--LWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNI 1322
            +IW  + +   R+ EL  +QR+N F    E+++KD L +   + + +  + +++ P+ ++ P+E+  +        K                +KP N   G GI   +    I +  P +V  Y+  P L++ +K D RIYV +T   PL A++Y EGL RL++  Y  ++     + + HLTNYS+NK ++++ R    SS       +L    +   N   DA  L  +I D++VK+L+ +Q  +    R         F   +FE+ GFD+L+D+ L PWLLEVN SPS   D  LD  +K  L+ D   L  +
Sbjct:  103 VIWMGAPVKSVRMRELMPWQRLNQFPRSTELTKKDRLYENIERSKSIFGESFDFIPEFYVTPRENRKMENAFVRVAKEIAAAGGELCFPGEFIVKPTNSRQGKGIFFANSMADIPAEGPLLVSRYLKDPYLVNNHKFDLRIYVAVTSFYPLVAYVYSEGLARLASRPYDTSASSADSNEYVHLTNYSINKNSTSFVRNESMSSEDLGHKWTLGALLRYVENEGKDAKLLMLRIEDLIVKSLLSIQNSVATASRTN-----LRFACTNFELFGFDVLVDQALKPWLLEVNLSPSLACDAPLDSLLKTRLIADLLNLACV 415          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Celegans
Match: ttll-5 (Tubulin Tyrosine Ligase Like [Source:UniProtKB/TrEMBL;Acc:O17720])

HSP 1 Score: 139.043 bits (349), Expect = 1.794e-33
Identity = 96/318 (30.19%), Postives = 159/318 (50.00%), Query Frame = 3
Query:  399 LIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXX--------XXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXXXLMNRFKTKFNINTDA--LWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNI 1322
            +IW  + +   R+ EL  +QR+N F    E+++KD L +   + + +  + +++ P+ ++ P+E+  +        K                +KP N   G GI   +    I +  P +V  Y+  P L++ +K D RIYV +T   PL A++Y EGL RL++  Y  ++     + + HLTNYS+NK ++++ R    SS       +L    +   N   DA  L  +I D++VK+L+ +Q  +    R      L+ F   +FE+ GFD+L+D+ L PWLLEVN SPS   D  LD  +K  L+ D   L  +
Sbjct:  156 VIWMGAPVKSVRMRELMPWQRLNQFPRSTELTKKDRLYENIERSKSIFGESFDFIPEFYVTPRENRKMENAFVRVAKEIAAAGGELCFPGEFIVKPTNSRQGKGIFFANSMADIPAEGPLLVSRYLKDPYLVNNHKFDLRIYVAVTSFYPLVAYVYSEGLARLASRPYDTSASSADSNEYVHLTNYSINKNSTSFVRNESMSSEDLGHKWTLGALLRYVENEGKDAKLLMLRIEDLIVKSLLSIQNSVATASRT----NLR-FACTNFELFGFDVLVDQALKPWLLEVNLSPSLACDAPLDSLLKTRLIADLLNLACV 468          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Celegans
Match: ttll-9 (Tubulin Tyrosine Ligase Like [Source:UniProtKB/TrEMBL;Acc:Q564U4])

HSP 1 Score: 125.946 bits (315), Expect = 1.621e-30
Identity = 104/308 (33.77%), Postives = 154/308 (50.00%), Query Frame = 3
Query:  456 QRINHFMGMVEISRKDFLTKKFSKMQKLRPK-------DYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLF----------SEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXXXLMNRFKTKFNINT-DALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIK 1325
            Q I HF    E++RKDFL K + K +K + K       ++N+ P +++ P E +L    ++E +K      +I+KP  GA G GI LF           +D       P +VQ Y+  P L+ G K D RIYVL+T   PL A+++REG  R S  +Y+  S   +D  F HLTN +V K  ++Y    D   G K SL  L   FK+    +        + ++++++L  VQ  +I              D+  FE+ G+DIL DENL PWLLEVN SPS       D ++K  +L     +L+I+
Sbjct:   79 QMICHFRNDFELTRKDFLIKNYKKARKAKEKSGIDVVSEFNFLPSSYVLPTEYHLF---VEEFRKYPNDTIWIMKPVAGAQGKGIFLFRKLKHVQEWKKKDSSGSEALPYVVQCYVHNPYLVGGKKFDVRIYVLVTSFRPLNAWVHREGFARFSHSRYSTDS---VDDAFVHLTNVAVAKTAADY----DPERGLKWSLPKLFRFFKSVHGQSKLSKTMNDLTNVIIESLKSVQNLIIQ-------------DNHCFELYGYDILFDENLKPWLLEVNASPSLTASSQEDFELKYRILNHMIDVLDIE 363          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Fly
Match: TTLL6B (gene:FBgn0039501 transcript:FBtr0085180)

HSP 1 Score: 271.552 bits (693), Expect = 3.093e-78
Identity = 162/444 (36.49%), Postives = 247/444 (55.63%), Query Frame = 3
Query:  300 TANVNGTRFEIVKKILESVGFTLRDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXXXLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIE-PHLDNETLKKRKDIEKRKQDLIDLLVRVQAS-----SSREYFENRHVGNFLRVFPPDDKTVYDYYAELLVDS 1613
            T  V+ +R+ ++ KI +++G+ L  +   K   ++W+DSF   E    +K +Q+INHF GM+EI RKD L++  ++M K+ P+DY  FPKTW+ P +                K+ FILKP +GA G GI L ++   I  +E  I Q YI +P L+DGYK D R+Y LIT  DPLR F+Y EGL R +T KY   +    + ++ HLTNYSVNK+NS+Y    D      +   S +N +  + N + +  W  + D+++KT++   P L HNY  C  G   +     FEILGFDIL+D  L P++LEVN SPSF  +E +DR+VK  L+ DT  L++   ++K++ L   +++ ++RL        ++ P L   T K + D +K   D   + V  +A      + +  +E  H+GNF ++ PP D +  DYY      S
Sbjct:  147 TICVSNSRYAMIGKISKTLGYKLVKES--KMWNILWSDSFPGVELFKNMKRFQQINHFPGMIEICRKDLLSRNLNRMLKIFPQDYKIFPKTWMLPADYG-----DAMNYALNHKRTFILKPDSGAQGRGIWLTNDLKTIGPHERLICQTYIHRPLLIDGYKFDLRVYTLITSVDPLRIFVYNEGLARFATNKYVEPTPGNANDLYMHLTNYSVNKRNSHYEL-CDNDDCGSKRKLSAINNWMRRHNYDVEEFWSNVDDVIIKTVLSAWPVLKHNYHACFPG--HDKIQACFEILGFDILVDWKLKPYILEVNHSPSFHTNEQVDREVKRPLIRDTLNLVSTVLADKRQILKEDRKRVKQRLLKIRGDPPVQRPRLGGGTSKPKIDAQKGSPDAQPVDVEPEAEDHGPLAQQIAWEESHLGNFRKIMPPPDLSKLDYYTRFYAQS 580          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Fly
Match: TTLL6A (gene:FBgn0034459 transcript:FBtr0300829)

HSP 1 Score: 245.743 bits (626), Expect = 4.519e-68
Identity = 141/438 (32.19%), Postives = 231/438 (52.74%), Query Frame = 3
Query:  294 QMTANVNGTRFEIVKKILESVGFTLRDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXXXLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMC--RTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRKDIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDDKTVYDYYAEL 1601
            +++  V  TRF++V K+  ++GF    +   +   + W+DS    + +  +K +Q+INHF GMVEI RKD L++  ++M K+ P DY  FPKTWL P ++   Y       K  +        A    G GI + ++   +   E  I Q YI++P L+DGYK D R+Y L+T  DPLR F+Y EGL R +T+KY   +     ++F HLTNY +N++NS Y  G +      +   S  N++    N +    W  + D ++KTL+   P L HNY +C  +  ++Q     SF++LGFDIL+D  L P++LEVN +PS   DE++D +VK  L+ DT  +L+    +K++ +   + + + RL    +  K    +   +      I +     +     + A + +  +E  H+GN+ R+ PP D +  +YY + 
Sbjct:  130 RLSVCVEHTRFQLVAKVTRNMGFQHVPEH--RLWNIQWSDSTPHHDLLRNMKRFQQINHFPGMVEICRKDLLSRNLNRMLKMFPGDYRIFPKTWLMPTDA---YDVAIYANKHKRTFILKPYSA--GQGRGIWITTDLRTVGKREKLICQTYIERPLLIDGYKFDLRVYTLVTSVDPLRIFVYNEGLARFATQKYVPPTTGNSHNVFMHLTNYCLNRRNSQYMVG-NGPEAGSKRKLSAFNKWLVDHNYDVGEFWASVDDAIIKTLISAWPTLKHNYNVCFPKHDKIQ----ASFQLLGFDILVDWKLKPYILEVNHTPSLSADESVDMEVKRPLIRDTLNMLSTALVDKEQIIRDDRTEHRARLLRNIYNKKAAAQMPGYS----SPIREVGGHDVRQACSIGALTQQIAWEESHLGNYRRIMPPRDSSKVNYYCKF 551          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Fly
Match: TTLL5 (gene:FBgn0051108 transcript:FBtr0084802)

HSP 1 Score: 179.489 bits (454), Expect = 7.855e-46
Identity = 139/396 (35.10%), Postives = 207/396 (52.27%), Query Frame = 3
Query:  399 LIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRP-KDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTR---GVDEXXXXXXXXXXLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKP-SNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRKDIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDD 1571
            L+WT   +  + +  L  YQR+NHF    E++RKD L K   +MQ LR  K ++  P+T++ P ES  L     + + P   K      A  + G GI + +  D I  +E ++V +YI  P  +DG+K D R+YVL+T  DPL  ++Y EG+VRL+T KY   +D   +    HL NYS+NK +S+Y R     DE  G K +LS+L+   K + + +T  L   I D+++K ++     +I   RM     + N ++  FE+ GFDIL+D  L PWLLE+N SPS G+D  LD KVK  L+ D    + I   S + KS Y   QK  R  + +  R    P    +T K +K       +L     R+  ++  +Y      G F+R+FP DD
Sbjct:  249 LLWTGVHMKLDIVRNLAPYQRVNHFPRSYEMTRKDRLYKNIERMQHLRGMKHFDIVPQTFVLPIESRDLVVAHNKHRGPWIVKP-----AASSRGRGIFIVNSPDQIPQDEQAVVSKYIVDPLCIDGHKCDLRVYVLVTSFDPLIIYLYEEGIVRLATVKYDRHADNLWNPCM-HLCNYSINKYHSDYIRSSDAQDEDVGHKWTLSALLRHLKLQ-SCDTRQLMLNIEDLIIKAVLACAQSIISACRMF----VPNGNNC-FELYGFDILIDNALKPWLLEINLSPSMGVDSPLDTKVKSCLMADLLTCVGIPAYSPEMKSHY--DQKWSRFRSSSCQRIATFPSTSQKTKKSKKKGAAINLNLTGEEQRILRNARLQYSRR---GGFVRIFPTDD 627          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Fly
Match: TTLL5 (gene:FBgn0051108 transcript:FBtr0339247)

HSP 1 Score: 179.489 bits (454), Expect = 7.855e-46
Identity = 139/396 (35.10%), Postives = 207/396 (52.27%), Query Frame = 3
Query:  399 LIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRP-KDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTR---GVDEXXXXXXXXXXLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKP-SNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRKDIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDD 1571
            L+WT   +  + +  L  YQR+NHF    E++RKD L K   +MQ LR  K ++  P+T++ P ES  L     + + P   K      A  + G GI + +  D I  +E ++V +YI  P  +DG+K D R+YVL+T  DPL  ++Y EG+VRL+T KY   +D   +    HL NYS+NK +S+Y R     DE  G K +LS+L+   K + + +T  L   I D+++K ++     +I   RM     + N ++  FE+ GFDIL+D  L PWLLE+N SPS G+D  LD KVK  L+ D    + I   S + KS Y   QK  R  + +  R    P    +T K +K       +L     R+  ++  +Y      G F+R+FP DD
Sbjct:  249 LLWTGVHMKLDIVRNLAPYQRVNHFPRSYEMTRKDRLYKNIERMQHLRGMKHFDIVPQTFVLPIESRDLVVAHNKHRGPWIVKP-----AASSRGRGIFIVNSPDQIPQDEQAVVSKYIVDPLCIDGHKCDLRVYVLVTSFDPLIIYLYEEGIVRLATVKYDRHADNLWNPCM-HLCNYSINKYHSDYIRSSDAQDEDVGHKWTLSALLRHLKLQ-SCDTRQLMLNIEDLIIKAVLACAQSIISACRMF----VPNGNNC-FELYGFDILIDNALKPWLLEINLSPSMGVDSPLDTKVKSCLMADLLTCVGIPAYSPEMKSHY--DQKWSRFRSSSCQRIATFPSTSQKTKKSKKKGAAINLNLTGEEQRILRNARLQYSRR---GGFVRIFPTDD 627          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Fly
Match: TTLL4A (gene:FBgn0026147 transcript:FBtr0304950)

HSP 1 Score: 162.155 bits (409), Expect = 1.485e-40
Identity = 111/314 (35.35%), Postives = 166/314 (52.87%), Query Frame = 3
Query:  444 LKSYQRINHFMGMVEISRKDFLTKKFSK-MQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVD------EXXXXXXXXXXLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLL--VDTFRLLNIKPS---NKQKSL 1349
            ++SYQ+INH  G   I RKD   K   + M K   K++ + P+T++ P +   L ++  +  +   K       +  A G GIR+ +    I    P IVQ+YI++P L++G K D R+YVL+T  +PLR F+Y  GL R ++ KY+  +D   D    HLTNYS+NK +SNY++  D           K   + L NR      + TD LW+ +  +V++T +L   + I++  M R      +    FE+ GFD++LD +L PWLLEVN SPS   +  LD  VK  L+  V    L N+ P    +KQK L
Sbjct:  370 IRSYQKINHLPGSFRIGRKDSCWKNLQRQMGKHSNKEFGFMPRTYIIPNDLGALRRHWPKYAQRNTKWIIKPPAS--ARGAGIRVINRWGQIPKRRPLIVQKYIERPLLINGSKFDLRLYVLVTSVNPLRVFMYHNGLARFASVKYSAKTDTLNDRCM-HLTNYSINKFSSNYSKNEDVNACHGHKWTIKSLWTYLANR-----GVRTDCLWEALRSLVLRT-ILAGENGINS--MIRANVESKYS--CFELFGFDVILDSDLVPWLLEVNISPSLHSELPLDAHVKAPLVQGVLNTALYNVPPKLSLDKQKEL 670          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Zebrafish
Match: ttll7 (tubulin tyrosine ligase-like family, member 7 [Source:ZFIN;Acc:ZDB-GENE-070112-2112])

HSP 1 Score: 349.747 bits (896), Expect = 1.643e-109
Identity = 205/447 (45.86%), Postives = 292/447 (65.32%), Query Frame = 3
Query:  297 MTANVNGTRFEIVKKILESVGF-TLRDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXXXLMNRFKTKFNIN---TDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRKDIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDDKTVYDYYAELLVDSFTLF 1625
            +TANV GT++EIV+ ++E + F   RDD+  +T  LIW DS +  E+I EL++YQRINHF GM EI RKD L +  +KM K +P++Y++ PKTW+FP E      Y+KE K+  K+K FI+KPANGAMG GI L    + +   +  IVQEY+DKP L++GYK D R Y+L+T CDPLR F+Y +GLVR+ TEKY   ++  ++ ++ HLTNYSVNK N N+ R  DE+       S  +  F     IN       W  + ++VVKTL++ +PH++H YRMCR GQ     SV FE+LGFDI+LD  L PWLLE+NR+PSFG D+ +D  VK   L++  +LLNI+ S+K+++L  QK +AQRRL       K+     +E  K+R  +E+R+++L + L +V+   SR+  E RH+GN+ R++PPDDK + + Y  LL  +F  F
Sbjct:   43 ITANVIGTKYEIVRIVIEELTFHKARDDD--ETANLIWNDSAVQHEKIAELRNYQRINHFPGMGEICRKDCLARNMAKMIKSQPQEYSFIPKTWIFPAECTQFQNYVKELKRKGKQKTFIVKPANGAMGHGISLIRNCEKLPVQDHFIVQEYLDKPFLMEGYKFDLRFYILVTSCDPLRVFLYNDGLVRMGTEKYHTPNESNLNQLYMHLTNYSVNKHNENFER--DETVDKGSKRS--IGWFTEFLRINDYDVAKFWGDVSELVVKTLLVAEPHVLHAYRMCRPGQPPGSASVCFEVLGFDIILDRKLKPWLLEINRAPSFGTDQKIDYDVKKGALLNALKLLNIRASDKRRNLAQQKAEAQRRLYGQGSMRKLTAG-SSEWEKQRHLLERRREELKERLAQVRKQVSRDEHEKRHLGNYRRIYPPDDKLLLEKYESLLSAAFQTF 482          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Zebrafish
Match: ttll7 (tubulin tyrosine ligase-like family, member 7 [Source:ZFIN;Acc:ZDB-GENE-070112-2112])

HSP 1 Score: 361.303 bits (926), Expect = 3.547e-109
Identity = 219/514 (42.61%), Postives = 320/514 (62.26%), Query Frame = 3
Query:  297 MTANVNGTRFEIVKKILESVGF-TLRDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXXXLMNRFKTKFNIN---TDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRKDIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDDKTVYDYYAELLVDSFTLFNQLNYQNCSTDSTQATQQMLQSFMPN---QFREEDIMEQIKQCEAEENALLEKWKLPQNAELTTIIP 1817
            +TANV GT++EIV+ ++E + F   RDD+  +T  LIW DS +  E+I EL++YQRINHF GM EI RKD L +  +KM K +P++Y++ PKTW+FP E      Y+KE K+  K+K FI+KPANGAMG GI L    + +   +  IVQEY+DKP L++GYK D R Y+L+T CDPLR F+Y +GLVR+ TEKY   ++  ++ ++ HLTNYSVNK N N+ R  DE+       S  +  F     IN       W  + ++VVKTL++ +PH++H YRMCR GQ     SV FE+LGFDI+LD  L PWLLE+NR+PSFG D+ +D  VK   L++  +LLNI+ S+K+++L  QK +AQRRL       K+     +E  K+R  +E+R+++L + L +V+   SR+  E RH+GN+ R++PPDDK + + Y  LL  +F  F                   LQ  M N   + +EEDI++ ++QCE ++  L+ K    +  ++ + +P
Sbjct:   43 ITANVIGTKYEIVRIVIEELTFHKARDDD--ETANLIWNDSAVQHEKIAELRNYQRINHFPGMGEICRKDCLARNMAKMIKSQPQEYSFIPKTWIFPAECTQFQNYVKELKRKGKQKTFIVKPANGAMGHGISLIRNCEKLPVQDHFIVQEYLDKPFLMEGYKFDLRFYILVTSCDPLRVFLYNDGLVRMGTEKYHTPNESNLNQLYMHLTNYSVNKHNENFER--DETVDKGSKRS--IGWFTEFLRINDYDVAKFWGDVSELVVKTLLVAEPHVLHAYRMCRPGQPPGSASVCFEVLGFDIILDRKLKPWLLEINRAPSFGTDQKIDYDVKKGALLNALKLLNIRASDKRRNLAQQKAEAQRRLYGQGSMRKLTAG-SSEWEKQRHLLERRREELKERLAQVRKQVSRDEHEKRHLGNYRRIYPPDDKLLLEKYESLLSAAFQTF------------LAGRAASLQKEMNNPLKRMKEEDILDLLEQCELDDEKLMGKTSKQKGPKVLSSMP 537          

HSP 2 Score: 130.954 bits (328), Expect = 1.544e-30
Identity = 58/139 (41.73%), Postives = 93/139 (66.91%), Query Frame = 3
Query: 2373 IRYPGQTDVETKSMLAKIFSNWEHQRHSVATYWLATLNAKKRDKIIQIVRNNVDKIINDNFKFSADISAARVNRLISKVYNRLLWNRGNGLIQCF--SHFKSWQLIFSHSGDLIKPLELDICSRVVQLCLDCVLIVYQF 2783
            IRYPG+++ E ++ML +I +NW++ +  VA+YWL  L+A K+ K++ IVR N+  ++   +    D+ + R+ RL ++V+NRLLW+ G GL  C   S   SW+ +F+ + +++   EL  C RVVQLC DC+LIVY+F
Sbjct:  723 IRYPGKSEEEAEAMLDEILNNWKYHKPKVASYWLVKLDATKQRKVLDIVRTNIRSVLQRIWS-EPDVESLRLYRLFNRVFNRLLWSHGQGLWNCLSTSGRSSWECVFNKTSEVVNAQELRCCQRVVQLCRDCLLIVYKF 860          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Zebrafish
Match: ttll7 (tubulin tyrosine ligase-like family, member 7 [Source:ZFIN;Acc:ZDB-GENE-070112-2112])

HSP 1 Score: 361.303 bits (926), Expect = 3.618e-109
Identity = 219/514 (42.61%), Postives = 320/514 (62.26%), Query Frame = 3
Query:  297 MTANVNGTRFEIVKKILESVGF-TLRDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXXXLMNRFKTKFNIN---TDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRKDIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDDKTVYDYYAELLVDSFTLFNQLNYQNCSTDSTQATQQMLQSFMPN---QFREEDIMEQIKQCEAEENALLEKWKLPQNAELTTIIP 1817
            +TANV GT++EIV+ ++E + F   RDD+  +T  LIW DS +  E+I EL++YQRINHF GM EI RKD L +  +KM K +P++Y++ PKTW+FP E      Y+KE K+  K+K FI+KPANGAMG GI L    + +   +  IVQEY+DKP L++GYK D R Y+L+T CDPLR F+Y +GLVR+ TEKY   ++  ++ ++ HLTNYSVNK N N+ R  DE+       S  +  F     IN       W  + ++VVKTL++ +PH++H YRMCR GQ     SV FE+LGFDI+LD  L PWLLE+NR+PSFG D+ +D  VK   L++  +LLNI+ S+K+++L  QK +AQRRL       K+     +E  K+R  +E+R+++L + L +V+   SR+  E RH+GN+ R++PPDDK + + Y  LL  +F  F                   LQ  M N   + +EEDI++ ++QCE ++  L+ K    +  ++ + +P
Sbjct:   43 ITANVIGTKYEIVRIVIEELTFHKARDDD--ETANLIWNDSAVQHEKIAELRNYQRINHFPGMGEICRKDCLARNMAKMIKSQPQEYSFIPKTWIFPAECTQFQNYVKELKRKGKQKTFIVKPANGAMGHGISLIRNCEKLPVQDHFIVQEYLDKPFLMEGYKFDLRFYILVTSCDPLRVFLYNDGLVRMGTEKYHTPNESNLNQLYMHLTNYSVNKHNENFER--DETVDKGSKRS--IGWFTEFLRINDYDVAKFWGDVSELVVKTLLVAEPHVLHAYRMCRPGQPPGSASVCFEVLGFDIILDRKLKPWLLEINRAPSFGTDQKIDYDVKKGALLNALKLLNIRASDKRRNLAQQKAEAQRRLYGQGSMRKLTAG-SSEWEKQRHLLERRREELKERLAQVRKQVSRDEHEKRHLGNYRRIYPPDDKLLLEKYESLLSAAFQTF------------LAGRAASLQKEMNNPLKRMKEEDILDLLEQCELDDEKLMGKTSKQKGPKVLSSMP 537          

HSP 2 Score: 131.724 bits (330), Expect = 9.501e-31
Identity = 58/138 (42.03%), Postives = 93/138 (67.39%), Query Frame = 3
Query: 2373 IRYPGQTDVETKSMLAKIFSNWEHQRHSVATYWLATLNAKKRDKIIQIVRNNVDKIINDNFKFSADISAARVNRLISKVYNRLLWNRGNGLIQCFS-HFKSWQLIFSHSGDLIKPLELDICSRVVQLCLDCVLIVYQF 2783
            IRYPG+++ E ++ML +I +NW++ +  VA+YWL  L+A K+ K++ IVR N+  ++   +    D+ + R+ RL ++V+NRLLW+ G GL  C S    SW+ +F+ + +++   EL  C RVVQLC DC+LIVY+F
Sbjct:  723 IRYPGKSEEEAEAMLDEILNNWKYHKPKVASYWLVKLDATKQRKVLDIVRTNIRSVLQRIWS-EPDVESLRLYRLFNRVFNRLLWSHGQGLWNCLSTSGSSWECVFNKTSEVVNAQELRCCQRVVQLCRDCLLIVYKF 859          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Zebrafish
Match: ttll6 (tubulin tyrosine ligase-like family, member 6 [Source:NCBI gene;Acc:564075])

HSP 1 Score: 273.092 bits (697), Expect = 3.946e-78
Identity = 173/476 (36.34%), Postives = 253/476 (53.15%), Query Frame = 3
Query:  306 NVNGTRFEIVKKILESVGFTLRDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXXXLMNRFKTK---FNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRKDIEKRKQDLIDLLVRVQASSSREY--FENRHVGNFLRVFPPDDKTVYDYYAELLVDSFTLFNQLNYQNCSTDSTQATQQMLQSFMPNQFREE 1718
            N+   ++E V++     G  +R+    +   L WTD  +S +R+ ++K YQ+INHF GM EI RKD L +  ++M KL PK+YN FP+TW  P +    Y   +   +  K K FI KP +G  G GI L   +  I+  E  I Q Y+ KP ++DG+K D RIYVL+T CDP R F+Y EGLVR  T  Y   +   ++ +  HLTNY++NK + N+ R  D  S  K      ++ FK      + +T+ LW  I D+++KTL+   P L HNY+ C         S  FEILGFD+LLD  L PWLLEVN SPSF  D  LDR+VK SLL DT  L+N+   +++K    +K++ + R                  L++ +  E R ++    L + QA+S  +   +E +H+G F R+FP D    Y+ Y +    S +LF +      S    +  +Q LQ     Q ++E
Sbjct:   57 NLTNCKYESVRRAARRYG--IREAAEGEDWTLYWTDCSVSLDRVMDMKRYQKINHFPGMNEICRKDLLARNMNRMLKLFPKEYNIFPRTWCLPAD----YSDFQAYTRAKKHKTFICKPDSGCQGRGIYLTKSNKDIRPGEHMICQVYMSKPFIIDGFKFDLRIYVLVTSCDPFRVFMYDEGLVRFCTTHYTEPTVSNLEDVCMHLTNYAINKHSENFVRDEDTGSKRK------LSSFKKHMEDMSYDTEKLWTDIEDVIIKTLISAHPILKHNYQTCFPNHASG--SACFEILGFDVLLDRRLKPWLLEVNHSPSFTTDSRLDREVKDSLLYDTLVLINLGACDRRKITEEEKRRVKER------------------LQQNRSREARNEE----LRQSQAASMEQMQKYEAKHMGGFRRIFPRDGGEKYEKYFQ---HSSSLFQET---AASKAREECARQQLQELRLKQEQKE 490          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Zebrafish
Match: ttll6 (tubulin tyrosine ligase-like family, member 6 [Source:NCBI gene;Acc:564075])

HSP 1 Score: 273.092 bits (697), Expect = 3.946e-78
Identity = 173/476 (36.34%), Postives = 253/476 (53.15%), Query Frame = 3
Query:  306 NVNGTRFEIVKKILESVGFTLRDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXXXLMNRFKTK---FNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRKDIEKRKQDLIDLLVRVQASSSREY--FENRHVGNFLRVFPPDDKTVYDYYAELLVDSFTLFNQLNYQNCSTDSTQATQQMLQSFMPNQFREE 1718
            N+   ++E V++     G  +R+    +   L WTD  +S +R+ ++K YQ+INHF GM EI RKD L +  ++M KL PK+YN FP+TW  P +    Y   +   +  K K FI KP +G  G GI L   +  I+  E  I Q Y+ KP ++DG+K D RIYVL+T CDP R F+Y EGLVR  T  Y   +   ++ +  HLTNY++NK + N+ R  D  S  K      ++ FK      + +T+ LW  I D+++KTL+   P L HNY+ C         S  FEILGFD+LLD  L PWLLEVN SPSF  D  LDR+VK SLL DT  L+N+   +++K    +K++ + R                  L++ +  E R ++    L + QA+S  +   +E +H+G F R+FP D    Y+ Y +    S +LF +      S    +  +Q LQ     Q ++E
Sbjct:   57 NLTNCKYESVRRAARRYG--IREAAEGEDWTLYWTDCSVSLDRVMDMKRYQKINHFPGMNEICRKDLLARNMNRMLKLFPKEYNIFPRTWCLPAD----YSDFQAYTRAKKHKTFICKPDSGCQGRGIYLTKSNKDIRPGEHMICQVYMSKPFIIDGFKFDLRIYVLVTSCDPFRVFMYDEGLVRFCTTHYTEPTVSNLEDVCMHLTNYAINKHSENFVRDEDTGSKRK------LSSFKKHMEDMSYDTEKLWTDIEDVIIKTLISAHPILKHNYQTCFPNHASG--SACFEILGFDVLLDRRLKPWLLEVNHSPSFTTDSRLDREVKDSLLYDTLVLINLGACDRRKITEEEKRRVKER------------------LQQNRSREARNEE----LRQSQAASMEQMQKYEAKHMGGFRRIFPRDGGEKYEKYFQ---HSSSLFQET---AASKAREECARQQLQELRLKQEQKE 490          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Xenopus
Match: trub2 (TruB pseudouridine (psi) synthase family member 2 [Source:Xenbase;Acc:XB-GENE-996199])

HSP 1 Score: 389.423 bits (999), Expect = 6.144e-122
Identity = 222/511 (43.44%), Postives = 320/511 (62.62%), Query Frame = 3
Query:  297 MTANVNGTRFEIVKKILESVGFT-LRDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXXXLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRKDIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDDKTVYDYYAELLVDSFTLFNQLNYQNCSTDSTQATQQMLQSFMPN---QFREEDIMEQIKQCEAEENALLEKWKLPQNAELTTIIP 1817
            +T N   T  EIV+ + E + FT  RDD+  +T  LIW D  +  E+I EL++YQRINHF GM EI RKD L +  +KM K +P +YN+ P+TW+FP E      YIKE KK  ++K FI+KPANGAMG GI L    + +++ +  IVQEY++KP LL+ YK D RIY+L+T CDPLR F+Y +GLVR+ TEKY   S+  +  ++ HLTNYSVNK N N+ R   E+ GSK+S+      F    + +    W  I D+VVKTL++ +PH++H YRMCR GQ    +SV FE+LGFDI+LD  L PWLLE+NR+PSFG D+ +D  VK  +L++  +LLNI+ S+K+K+L  QK +AQ+RL       ++ P   ++  K+R  +E+RK++L + L +V+   SRE +ENRH+GN+ R++PP+DK + + Y  LL  +F  F                   LQ  M N   + +EEDI++ ++QCE ++  L  K   P+     + +P
Sbjct:   42 ITENWVSTTGEIVRLVTEEMMFTKARDDD--ETANLIWNDCAVQHEKIAELRNYQRINHFPGMGEICRKDCLARNMTKMIKCQPHEYNFIPRTWIFPAEYTQFQTYIKELKKKRRQKTFIIKPANGAMGHGISLTRNGEKLQAQDHLIVQEYLEKPFLLESYKFDLRIYILVTSCDPLRIFLYNDGLVRMGTEKYHPPSESNLSQLYMHLTNYSVNKHNENFERDETENRGSKRSIK-WFTEFLRANDYDISKFWNDISDLVVKTLIVAEPHVLHAYRMCRPGQHPTSESVCFEVLGFDIILDRKLKPWLLEINRAPSFGTDQKIDHDVKKGVLLNALKLLNIRASDKKKNLAKQKAEAQKRLYGQGSMKRLSP-ASSDWEKQRHTLERRKEELKERLAQVRKQISREEYENRHLGNYRRIYPPEDKLLLEKYEGLLATAFQTF------------LAGRAASLQREMNNPLKRMKEEDILDLLEQCELDDEKLSGKPTRPKEPRTLSSMP 536          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Xenopus
Match: trub2 (TruB pseudouridine (psi) synthase family member 2 [Source:Xenbase;Acc:XB-GENE-996199])

HSP 1 Score: 389.423 bits (999), Expect = 1.246e-119
Identity = 222/511 (43.44%), Postives = 320/511 (62.62%), Query Frame = 3
Query:  297 MTANVNGTRFEIVKKILESVGFT-LRDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXXXLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRKDIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDDKTVYDYYAELLVDSFTLFNQLNYQNCSTDSTQATQQMLQSFMPN---QFREEDIMEQIKQCEAEENALLEKWKLPQNAELTTIIP 1817
            +T N   T  EIV+ + E + FT  RDD+  +T  LIW D  +  E+I EL++YQRINHF GM EI RKD L +  +KM K +P +YN+ P+TW+FP E      YIKE KK  ++K FI+KPANGAMG GI L    + +++ +  IVQEY++KP LL+ YK D RIY+L+T CDPLR F+Y +GLVR+ TEKY   S+  +  ++ HLTNYSVNK N N+ R   E+ GSK+S+      F    + +    W  I D+VVKTL++ +PH++H YRMCR GQ    +SV FE+LGFDI+LD  L PWLLE+NR+PSFG D+ +D  VK  +L++  +LLNI+ S+K+K+L  QK +AQ+RL       ++ P   ++  K+R  +E+RK++L + L +V+   SRE +ENRH+GN+ R++PP+DK + + Y  LL  +F  F                   LQ  M N   + +EEDI++ ++QCE ++  L  K   P+     + +P
Sbjct:   42 ITENWVSTTGEIVRLVTEEMMFTKARDDD--ETANLIWNDCAVQHEKIAELRNYQRINHFPGMGEICRKDCLARNMTKMIKCQPHEYNFIPRTWIFPAEYTQFQTYIKELKKKRRQKTFIIKPANGAMGHGISLTRNGEKLQAQDHLIVQEYLEKPFLLESYKFDLRIYILVTSCDPLRIFLYNDGLVRMGTEKYHPPSESNLSQLYMHLTNYSVNKHNENFERDETENRGSKRSIK-WFTEFLRANDYDISKFWNDISDLVVKTLIVAEPHVLHAYRMCRPGQHPTSESVCFEVLGFDIILDRKLKPWLLEINRAPSFGTDQKIDHDVKKGVLLNALKLLNIRASDKKKNLAKQKAEAQKRLYGQGSMKRLSP-ASSDWEKQRHTLERRKEELKERLAQVRKQISREEYENRHLGNYRRIYPPEDKLLLEKYEGLLATAFQTF------------LAGRAASLQREMNNPLKRMKEEDILDLLEQCELDDEKLSGKPTRPKEPRTLSSMP 536          

HSP 2 Score: 117.472 bits (293), Expect = 3.378e-26
Identity = 56/140 (40.00%), Postives = 87/140 (62.14%), Query Frame = 3
Query: 2373 IRYPGQTDVE-TKSMLAKIFSNWEHQRHSVATYWLATLNAKKRDKIIQIVRNNVDKIINDNFKFSADISAARVNRLISKVYNRLLWNRGNGLIQCFSH-FKSWQLIFSHSGDLIKPLELDICSRVVQLCLDCVLIVYQFS 2786
            IR PG+   E T S + +I  NW + +  VA+YWL  L++ K+ K++ IVR N+  ++   +K S D+    + R  ++V+NRLLWN G GL  CFS+   SW+ IF  S +++ P +   C R+VQLC DC+L VY+++
Sbjct:  715 IRIPGKGVEEITHSHIDEIMDNWTYHKSKVASYWLIKLDSVKQRKVLDIVRTNIRSVLQRIWKVS-DVECLHIYRSFNRVFNRLLWNHGQGLWSCFSNSGTSWETIFCKSTEVVTPQQFQCCQRLVQLCKDCLLAVYKYA 853          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Xenopus
Match: trub2 (TruB pseudouridine (psi) synthase family member 2 [Source:Xenbase;Acc:XB-GENE-996199])

HSP 1 Score: 385.571 bits (989), Expect = 2.009e-118
Identity = 220/510 (43.14%), Postives = 321/510 (62.94%), Query Frame = 3
Query:  300 TANVNGTRFEIVKKILESVGFT-LRDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXXXLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRKDIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDDKTVYDYYAELLVDSFTLFNQLNYQNCSTDSTQATQQMLQSFMPN---QFREEDIMEQIKQCEAEENALLEKWKLPQNAELTTIIP 1817
            + NV+ T+  I++ + E + FT  RDD+  +T  LIW D  +  E+I EL++YQRINHF GM EI RKD L +  +KM K +P +YN+ P+TW+FP E      YIKE KK  ++K FI+KPANGAMG GI L    + +++ +  IVQEY++KP LL+ YK D RIY+L+T CDPLR F+Y +GLVR+ TEKY   S+  +  ++ HLTNYSVNK N N+ R   E+ GSK+S+      F    + +    W  I D+VVKTL++ +PH++H YRMCR GQ    +SV FE+LGFDI+LD  L PWLLE+NR+PSFG D+ +D  VK  +L++  +LLNI+ S+K+K+L  QK +AQ+RL       ++ P   ++  K+R  +E+RK++L + L +V+   SRE +ENRH+GN+ R++PP+DK + + Y  LL  +F  F                   LQ  M N   + +EEDI++ ++QCE ++  L  K   P+     + +P
Sbjct:    1 SQNVSITQDFIIRLVTEEMMFTKARDDD--ETANLIWNDCAVQHEKIAELRNYQRINHFPGMGEICRKDCLARNMTKMIKCQPHEYNFIPRTWIFPAEYTQFQTYIKELKKKRRQKTFIIKPANGAMGHGISLTRNGEKLQAQDHLIVQEYLEKPFLLESYKFDLRIYILVTSCDPLRIFLYNDGLVRMGTEKYHPPSESNLSQLYMHLTNYSVNKHNENFERDETENRGSKRSIK-WFTEFLRANDYDISKFWNDISDLVVKTLIVAEPHVLHAYRMCRPGQHPTSESVCFEVLGFDIILDRKLKPWLLEINRAPSFGTDQKIDHDVKKGVLLNALKLLNIRASDKKKNLAKQKAEAQKRLYGQGSMKRLSP-ASSDWEKQRHTLERRKEELKERLAQVRKQISREEYENRHLGNYRRIYPPEDKLLLEKYEGLLATAFQTF------------LAGRAASLQREMNNPLKRMKEEDILDLLEQCELDDEKLSGKPTRPKEPRTLSSMP 494          

HSP 2 Score: 118.242 bits (295), Expect = 2.109e-26
Identity = 62/162 (38.27%), Postives = 96/162 (59.26%), Query Frame = 3
Query: 2373 IRYPGQTDVE-TKSMLAKIFSNWEHQRHSVATYWLATLNAKKRDKIIQIVRNNVDKIINDNFKFSADISAARVNRLISKVYNRLLWNRGNGLIQCFSH-FKSWQLIFSHSGDLIKPLELDICSRVVQLCLDCVLIVYQFSI-SLSQSSTPRSDKSFASQSVI 2849
            IR PG+   E T S + +I  NW + +  VA+YWL  L++ K+ K++ IVR N+  ++   +K S D+    + R  ++V+NRLLWN G GL  CFS+   SW+ IF  S +++ P +   C R+VQLC DC+L VY+++  S     +P  D S  S ++I
Sbjct:  670 IRIPGKGVEEITHSHIDEIMDNWTYHKSKVASYWLIKLDSVKQRKVLDIVRTNIRSVLQRIWKVS-DVECLHIYRSFNRVFNRLLWNHGQGLWSCFSNSGTSWETIFCKSTEVVTPQQFQCCQRLVQLCKDCLLAVYKYATDSRVAGMSPDWDDSRYSLTLI 830          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Xenopus
Match: trub2 (TruB pseudouridine (psi) synthase family member 2 [Source:Xenbase;Acc:XB-GENE-996199])

HSP 1 Score: 383.259 bits (983), Expect = 3.914e-118
Identity = 217/499 (43.49%), Postives = 314/499 (62.93%), Query Frame = 3
Query:  333 VKKILESVGFT-LRDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXXXLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRKDIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDDKTVYDYYAELLVDSFTLFNQLNYQNCSTDSTQATQQMLQSFMPN---QFREEDIMEQIKQCEAEENALLEKWKLPQNAELTTIIP 1817
            V+ + E + FT  RDD+  +T  LIW D  +  E+I EL++YQRINHF GM EI RKD L +  +KM K +P +YN+ P+TW+FP E      YIKE KK  ++K FI+KPANGAMG GI L    + +++ +  IVQEY++KP LL+ YK D RIY+L+T CDPLR F+Y +GLVR+ TEKY   S+  +  ++ HLTNYSVNK N N+ R   E+ GSK+S+      F    + +    W  I D+VVKTL++ +PH++H YRMCR GQ    +SV FE+LGFDI+LD  L PWLLE+NR+PSFG D+ +D  VK  +L++  +LLNI+ S+K+K+L  QK +AQ+RL       ++ P   ++  K+R  +E+RK++L + L +V+   SRE +ENRH+GN+ R++PP+DK + + Y  LL  +F  F                   LQ  M N   + +EEDI++ ++QCE ++  L  K   P+     + +P
Sbjct:    5 VRLVTEEMMFTKARDDD--ETANLIWNDCAVQHEKIAELRNYQRINHFPGMGEICRKDCLARNMTKMIKCQPHEYNFIPRTWIFPAEYTQFQTYIKELKKKRRQKTFIIKPANGAMGHGISLTRNGEKLQAQDHLIVQEYLEKPFLLESYKFDLRIYILVTSCDPLRIFLYNDGLVRMGTEKYHPPSESNLSQLYMHLTNYSVNKHNENFERDETENRGSKRSIK-WFTEFLRANDYDISKFWNDISDLVVKTLIVAEPHVLHAYRMCRPGQHPTSESVCFEVLGFDIILDRKLKPWLLEINRAPSFGTDQKIDHDVKKGVLLNALKLLNIRASDKKKNLAKQKAEAQKRLYGQGSMKRLSP-ASSDWEKQRHTLERRKEELKERLAQVRKQISREEYENRHLGNYRRIYPPEDKLLLEKYEGLLATAFQTF------------LAGRAASLQREMNNPLKRMKEEDILDLLEQCELDDEKLSGKPTRPKEPRTLSSMP 487          

HSP 2 Score: 118.242 bits (295), Expect = 1.960e-26
Identity = 62/162 (38.27%), Postives = 96/162 (59.26%), Query Frame = 3
Query: 2373 IRYPGQTDVE-TKSMLAKIFSNWEHQRHSVATYWLATLNAKKRDKIIQIVRNNVDKIINDNFKFSADISAARVNRLISKVYNRLLWNRGNGLIQCFSH-FKSWQLIFSHSGDLIKPLELDICSRVVQLCLDCVLIVYQFSI-SLSQSSTPRSDKSFASQSVI 2849
            IR PG+   E T S + +I  NW + +  VA+YWL  L++ K+ K++ IVR N+  ++   +K S D+    + R  ++V+NRLLWN G GL  CFS+   SW+ IF  S +++ P +   C R+VQLC DC+L VY+++  S     +P  D S  S ++I
Sbjct:  640 IRIPGKGVEEITHSHIDEIMDNWTYHKSKVASYWLIKLDSVKQRKVLDIVRTNIRSVLQRIWKVS-DVECLHIYRSFNRVFNRLLWNHGQGLWSCFSNSGTSWETIFCKSTEVVTPQQFQCCQRLVQLCKDCLLAVYKYATDSRVAGMSPDWDDSRYSLTLI 800          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Xenopus
Match: ENSXETT00000044160.1 (tubulin tyrosine ligase like 13, pseudogene [Source:NCBI gene;Acc:100492422])

HSP 1 Score: 271.937 bits (694), Expect = 1.948e-79
Identity = 163/422 (38.63%), Postives = 235/422 (55.69%), Query Frame = 3
Query:  333 VKKILESVGFTLRDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXXXLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRKDIEKRKQDLIDLLVRVQAS--SSREYFENRHVGNFLRVFPPDDKTVYDYY 1592
            V++     G     DE   T Y  WTD  +S ER+ ++K +Q+INHF GM EI RKD L +  +++ KL PK+YN FP+TW  P +    Y  ++   +  K   +I KP +G  G GI L      IK  +  I Q+YI KP L+DG+K D RIY L+T C+PLR F+Y+EGL R +T  Y   S   +D +  HLTNY++NK N N+ R   +     +   S +N +    + +T  LW+ I D+++KTL+   P L HNYR C    +    S  FEILGFDILLD  L PWL+EVN SPSF  D  LDR+VK  L+ DT  LLN++  +K+K +   K++ + RL         + ++  ET        +R+Q     L   QAS  +  E +E+ H+G + R++P D+  VY+ +
Sbjct:   24 VRRAARRCGLKEVGDEEEWTVY--WTDCSVSLERVMDMKRFQKINHFPGMNEICRKDLLARNMNRLSKLFPKEYNIFPRTWCLPAD----YGDLQAHCRTKKNSTYICKPDSGCQGRGIFLSKNLKDIKHGDNMICQQYIPKPFLVDGFKFDLRIYALVTSCEPLRIFVYKEGLARFATMNYVEPSHSNLDDVCMHLTNYAINKHNENFIR---DDLTGSKRKLSTLNTWLENNHYDTCRLWEDIDDVIIKTLISAHPILKHNYRTCFPNYVAG--SACFEILGFDILLDRKLKPWLIEVNHSPSFTTDSILDREVKDPLIQDTLNLLNLRACDKRKVIEEDKRRVKERL--------FQRNVPRET--------RREQ-----LETSQASRLAQMEKYEDSHLGGYRRIYPRDNGEVYEKF 413          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Mouse
Match: Ttll7 (tubulin tyrosine ligase-like family, member 7 [Source:MGI Symbol;Acc:MGI:1918142])

HSP 1 Score: 399.438 bits (1025), Expect = 1.031e-123
Identity = 226/513 (44.05%), Postives = 328/513 (63.94%), Query Frame = 3
Query:  297 MTANVNGTRFEIVKKILESVGFTLRDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXXXLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRKDIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDDKTVYDYYAELLVDSFTLFNQLNYQNCSTDSTQATQQMLQSFMPNQFREEDIMEQIKQCEAEENALLEKWK----------LPQNAELT 1805
            +TANV GT+FEIV+ +++ +GF    DE  +T  LIW D+ + QE+IT+L++YQRINHF GM EI RKDFL +  +KM K RP DY + P+TW+FP E      Y+KE KK  K+K FI+KPANGAMG GI L    D + S +  IVQEYI+KP L++GYK D RIY+L+T CDPL+ F+Y +GLVR+ TEKY   ++  +  ++ HLTNYSVNK N  + R   E  GSK+S+      F      +    W  I ++VVKTL++ +PH++H YRMCR GQ    +SV FE+LGFDILLD  L PWLLE+NR+PSFG D+ +D  VK  +L++  +LLNI+ S+K+K+L  QK +AQRRL       ++ P   ++  ++R  +E+RK++L + L++V+   S+E  ENRH+GN+ R++PP+DK + + Y  LL  +F  F        S  +    ++M       + REED+++ ++QCE ++  L+ K            +P+ AE+T
Sbjct:   41 ITANVAGTKFEIVRLVIDEMGFMKTPDED-ETSNLIWCDAAVQQEKITDLQNYQRINHFPGMGEICRKDFLARNMTKMIKSRPMDYTFVPRTWIFPSEYTQFQNYVKELKKKRKQKTFIVKPANGAMGHGISLIRNGDKVPSQDHLIVQEYIEKPFLMEGYKFDLRIYILVTSCDPLKIFLYHDGLVRMGTEKYIPPNESNLTQLYMHLTNYSVNKHNERFERNETEDKGSKRSIK-WFTEFLQANQHDVTKFWSDISELVVKTLIVAEPHVLHAYRMCRPGQPPGSESVCFEVLGFDILLDRKLKPWLLEINRAPSFGTDQKIDYDVKRGVLLNALKLLNIRTSDKRKNLAKQKAEAQRRLYGQNPVRRLSPG-SSDWEQQRHQLERRKEELKERLLQVRKQVSQEEHENRHMGNYRRIYPPEDKALLEKYEGLLAVAFQTF-------LSGRAASFQREMNNPL--KKMREEDLLDLLEQCEIDDEKLMGKTGRVRGPKPLCCMPECAEVT 541          

HSP 2 Score: 120.168 bits (300), Expect = 4.628e-27
Identity = 51/139 (36.69%), Postives = 92/139 (66.19%), Query Frame = 3
Query: 2373 IRYPGQTDVETKSMLAKIFSNWEHQRHSVATYWLATLNAKKRDKIIQIVRNNVDKIINDNFKFSADISAARVNRLISKVYNRLLWNRGNGLIQCFS-HFKSWQLIFSHSGDLIKPLELDICSRVVQLCLDCVLIVYQFS 2786
            IR+PG++D E++ ++  I  NW+H +  VA+YWL  L++ K+ K++ IV++++  ++   ++   D     + R+ ++V+NRLLW+ G GL  CF     SW+ IFS S +++ PL+L  C R+V+LC  C+L+VY+++
Sbjct:  693 IRFPGKSDAESELLIEDIMDNWKHYKTKVASYWLIKLDSVKQRKVLDIVKSSIRTVLPRIWRV-PDAEELSLYRIFNRVFNRLLWSHGQGLWSCFCDSGSSWESIFSKSPEVVTPLQLQCCQRLVELCKQCLLVVYKYT 830          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Mouse
Match: Ttll7 (tubulin tyrosine ligase-like family, member 7 [Source:MGI Symbol;Acc:MGI:1918142])

HSP 1 Score: 399.823 bits (1026), Expect = 1.047e-123
Identity = 226/513 (44.05%), Postives = 328/513 (63.94%), Query Frame = 3
Query:  297 MTANVNGTRFEIVKKILESVGFTLRDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXXXLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRKDIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDDKTVYDYYAELLVDSFTLFNQLNYQNCSTDSTQATQQMLQSFMPNQFREEDIMEQIKQCEAEENALLEKWK----------LPQNAELT 1805
            +TANV GT+FEIV+ +++ +GF    DE  +T  LIW D+ + QE+IT+L++YQRINHF GM EI RKDFL +  +KM K RP DY + P+TW+FP E      Y+KE KK  K+K FI+KPANGAMG GI L    D + S +  IVQEYI+KP L++GYK D RIY+L+T CDPL+ F+Y +GLVR+ TEKY   ++  +  ++ HLTNYSVNK N  + R   E  GSK+S+      F      +    W  I ++VVKTL++ +PH++H YRMCR GQ    +SV FE+LGFDILLD  L PWLLE+NR+PSFG D+ +D  VK  +L++  +LLNI+ S+K+K+L  QK +AQRRL       ++ P   ++  ++R  +E+RK++L + L++V+   S+E  ENRH+GN+ R++PP+DK + + Y  LL  +F  F        S  +    ++M       + REED+++ ++QCE ++  L+ K            +P+ AE+T
Sbjct:   41 ITANVAGTKFEIVRLVIDEMGFMKTPDED-ETSNLIWCDAAVQQEKITDLQNYQRINHFPGMGEICRKDFLARNMTKMIKSRPMDYTFVPRTWIFPSEYTQFQNYVKELKKKRKQKTFIVKPANGAMGHGISLIRNGDKVPSQDHLIVQEYIEKPFLMEGYKFDLRIYILVTSCDPLKIFLYHDGLVRMGTEKYIPPNESNLTQLYMHLTNYSVNKHNERFERNETEDKGSKRSIK-WFTEFLQANQHDVTKFWSDISELVVKTLIVAEPHVLHAYRMCRPGQPPGSESVCFEVLGFDILLDRKLKPWLLEINRAPSFGTDQKIDYDVKRGVLLNALKLLNIRTSDKRKNLAKQKAEAQRRLYGQNPVRRLSPG-SSDWEQQRHQLERRKEELKERLLQVRKQVSQEEHENRHMGNYRRIYPPEDKALLEKYEGLLAVAFQTF-------LSGRAASFQREMNNPL--KKMREEDLLDLLEQCEIDDEKLMGKTGRVRGPKPLCCMPECAEVT 541          

HSP 2 Score: 120.168 bits (300), Expect = 4.624e-27
Identity = 51/139 (36.69%), Postives = 92/139 (66.19%), Query Frame = 3
Query: 2373 IRYPGQTDVETKSMLAKIFSNWEHQRHSVATYWLATLNAKKRDKIIQIVRNNVDKIINDNFKFSADISAARVNRLISKVYNRLLWNRGNGLIQCFS-HFKSWQLIFSHSGDLIKPLELDICSRVVQLCLDCVLIVYQFS 2786
            IR+PG++D E++ ++  I  NW+H +  VA+YWL  L++ K+ K++ IV++++  ++   ++   D     + R+ ++V+NRLLW+ G GL  CF     SW+ IFS S +++ PL+L  C R+V+LC  C+L+VY+++
Sbjct:  698 IRFPGKSDAESELLIEDIMDNWKHYKTKVASYWLIKLDSVKQRKVLDIVKSSIRTVLPRIWRV-PDAEELSLYRIFNRVFNRLLWSHGQGLWSCFCDSGSSWESIFSKSPEVVTPLQLQCCQRLVELCKQCLLVVYKYT 835          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Mouse
Match: Ttll7 (tubulin tyrosine ligase-like family, member 7 [Source:MGI Symbol;Acc:MGI:1918142])

HSP 1 Score: 399.438 bits (1025), Expect = 1.986e-123
Identity = 226/513 (44.05%), Postives = 328/513 (63.94%), Query Frame = 3
Query:  297 MTANVNGTRFEIVKKILESVGFTLRDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXXXLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRKDIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDDKTVYDYYAELLVDSFTLFNQLNYQNCSTDSTQATQQMLQSFMPNQFREEDIMEQIKQCEAEENALLEKWK----------LPQNAELT 1805
            +TANV GT+FEIV+ +++ +GF    DE  +T  LIW D+ + QE+IT+L++YQRINHF GM EI RKDFL +  +KM K RP DY + P+TW+FP E      Y+KE KK  K+K FI+KPANGAMG GI L    D + S +  IVQEYI+KP L++GYK D RIY+L+T CDPL+ F+Y +GLVR+ TEKY   ++  +  ++ HLTNYSVNK N  + R   E  GSK+S+      F      +    W  I ++VVKTL++ +PH++H YRMCR GQ    +SV FE+LGFDILLD  L PWLLE+NR+PSFG D+ +D  VK  +L++  +LLNI+ S+K+K+L  QK +AQRRL       ++ P   ++  ++R  +E+RK++L + L++V+   S+E  ENRH+GN+ R++PP+DK + + Y  LL  +F  F        S  +    ++M       + REED+++ ++QCE ++  L+ K            +P+ AE+T
Sbjct:   41 ITANVAGTKFEIVRLVIDEMGFMKTPDED-ETSNLIWCDAAVQQEKITDLQNYQRINHFPGMGEICRKDFLARNMTKMIKSRPMDYTFVPRTWIFPSEYTQFQNYVKELKKKRKQKTFIVKPANGAMGHGISLIRNGDKVPSQDHLIVQEYIEKPFLMEGYKFDLRIYILVTSCDPLKIFLYHDGLVRMGTEKYIPPNESNLTQLYMHLTNYSVNKHNERFERNETEDKGSKRSIK-WFTEFLQANQHDVTKFWSDISELVVKTLIVAEPHVLHAYRMCRPGQPPGSESVCFEVLGFDILLDRKLKPWLLEINRAPSFGTDQKIDYDVKRGVLLNALKLLNIRTSDKRKNLAKQKAEAQRRLYGQNPVRRLSPG-SSDWEQQRHQLERRKEELKERLLQVRKQVSQEEHENRHMGNYRRIYPPEDKALLEKYEGLLAVAFQTF-------LSGRAASFQREMNNPL--KKMREEDLLDLLEQCEIDDEKLMGKTGRVRGPKPLCCMPECAEVT 541          

HSP 2 Score: 120.168 bits (300), Expect = 4.562e-27
Identity = 51/139 (36.69%), Postives = 92/139 (66.19%), Query Frame = 3
Query: 2373 IRYPGQTDVETKSMLAKIFSNWEHQRHSVATYWLATLNAKKRDKIIQIVRNNVDKIINDNFKFSADISAARVNRLISKVYNRLLWNRGNGLIQCFS-HFKSWQLIFSHSGDLIKPLELDICSRVVQLCLDCVLIVYQFS 2786
            IR+PG++D E++ ++  I  NW+H +  VA+YWL  L++ K+ K++ IV++++  ++   ++   D     + R+ ++V+NRLLW+ G GL  CF     SW+ IFS S +++ PL+L  C R+V+LC  C+L+VY+++
Sbjct:  718 IRFPGKSDAESELLIEDIMDNWKHYKTKVASYWLIKLDSVKQRKVLDIVKSSIRTVLPRIWRV-PDAEELSLYRIFNRVFNRLLWSHGQGLWSCFCDSGSSWESIFSKSPEVVTPLQLQCCQRLVELCKQCLLVVYKYT 855          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Mouse
Match: Ttll6 (tubulin tyrosine ligase-like family, member 6 [Source:MGI Symbol;Acc:MGI:2683461])

HSP 1 Score: 266.544 bits (680), Expect = 1.672e-75
Identity = 148/359 (41.23%), Postives = 210/359 (58.50%), Query Frame = 3
Query:  297 MTANVNGTRFEIVKKILESVGFTLRDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXXXLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQ 1373
            +  N++  R++ V++  +  G     D    T Y  WTD  +S ER+ E+KSYQ+INHF GM EI RKD L +  S+M KL PKD+++FP+TW  P +    +  ++   +  K K +I KP +G  G GI +      IK  E  I Q YI KP ++DG+K D R+YVL+T CDPLR F+Y EGL R +T  Y+  +   +D I  HLTNYS+NK +SN+   V ++    +   S  N +      + + +W+ I D+++KTL+   P + HNY  C      N  S  FEILGFDILLD  L PWLLEVN SPSF  D  LD++VK SLL D   L+N+   +K+K L  ++Q+ +
Sbjct:   60 LVINLSNCRYDSVRRAAQQYGLREAGDNDDWTLY--WTDYSVSLERVMEMKSYQKINHFPGMSEICRKDLLARNMSRMLKLFPKDFHFFPRTWCLPAD----WGDLQTYSRTRKNKTYICKPDSGCQGRGIFITRSVKEIKPGEDMICQLYISKPFIIDGFKFDLRVYVLVTSCDPLRVFVYNEGLARFATTSYSHPNLDNLDEICMHLTNYSINKHSSNF---VQDAFSGSKRKLSTFNSYMKTHGYDVEQIWRGIEDVIIKTLISAHPVIKHNYHTCFPSHTLN--SACFEILGFDILLDRKLKPWLLEVNHSPSFSTDSKLDKEVKDSLLYDALVLINLGNCDKKKVLEEERQRGR 407          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Mouse
Match: Ttll13 (tubulin tyrosine ligase-like family, member 13 [Source:MGI Symbol;Acc:MGI:1920845])

HSP 1 Score: 261.151 bits (666), Expect = 8.063e-74
Identity = 172/488 (35.25%), Postives = 259/488 (53.07%), Query Frame = 3
Query:  297 MTANVNGTRFEIVKKILESVGFTLRDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXXXLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRKDIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDDKTVYDYYAELLVDSFTLFNQLNYQNCSTDSTQATQQMLQSFMPNQFREEDIMEQIKQCEAEEN 1760
            +  N+   ++E V++  +  G     ++   T Y  WTD  +S ER+ ++K +Q+INHF GM EI RKD L +  ++MQKL P +YN FP+TW  P +    Y   +   +  K + +I KP +G  G GI +      IK  E  I Q+YI KP L+DG+K D RIYVLIT CDPLR F+Y EGL R +T  Y   S   ++ +  HLTNY++NK N N+ R   + +   +   S +N +  + + +   LW  I DI++KT++     L HNYR C    L       FEILGFDILLD  L PWLLEVN SPSF  D  LDR+VK +LL D   L+N++  +K+K +   K++ + RL    F    +P    ET  +R+  E  +  + D          +E +E+ H+G + R++P  D    + YA     + +LF +      S    +  +Q L+     Q ++E+   + ++   E+N
Sbjct:   57 LAINLTNCKYESVRRAAQMCGLKEVGEDEEWTVY--WTDCSVSLERVMDMKRFQKINHFPGMTEICRKDLLARNLNRMQKLYPTEYNIFPRTWCLPAD----YGDFQAYGRQRKTRTYICKPDSGCQGRGIFITRTPKEIKPGEHMICQQYITKPFLIDGFKFDMRIYVLITSCDPLRIFMYEEGLARFATMPYVEPSHNNLEEVCMHLTNYAINKHNENFVR---DDAVGSKRKLSTLNAWLREHSHDPQELWGDIEDIIIKTIISAHSVLRHNYRTCFPQYLCGGTCACFEILGFDILLDHKLKPWLLEVNHSPSFTTDSRLDREVKDALLCDAMNLVNLRGCDKKKVIEEDKRRVKERL----FPCHQQP---RET--RREQFELSQAAMHD----------QERYEDSHLGGYRRIYPGPDS---EKYAPFFKHNGSLFQET---AASKAREECARQQLEEIRLKQEQQENPGTKKRKENKEQN 510          
BLAST of Tubulin polyglutamylase TTLL7 vs. UniProt/SwissProt
Match: sp|F7E540|TTLL7_XENTR (Tubulin polyglutamylase TTLL7 OS=Xenopus tropicalis OX=8364 GN=ttll7 PE=2 SV=2)

HSP 1 Score: 400.593 bits (1028), Expect = 5.810e-123
Identity = 225/511 (44.03%), Postives = 325/511 (63.60%), Query Frame = 3
Query:  297 MTANVNGTRFEIVKKILESVGFT-LRDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXXXLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRKDIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDDKTVYDYYAELLVDSFTLFNQLNYQNCSTDSTQATQQMLQSFMPN---QFREEDIMEQIKQCEAEENALLEKWKLPQNAELTTIIP 1817
            +TANV GT++EIV+ + E + FT  RDD+  +T  LIW D  +  E+I EL++YQRINHF GM EI RKD L +  +KM K +P +YN+ P+TW+FP E      YIKE KK  ++K FI+KPANGAMG GI L    + +++ +  IVQEY++KP LL+ YK D RIY+L+T CDPLR F+Y +GLVR+ TEKY   S+  +  ++ HLTNYSVNK N N+ R   E+ GSK+S+      F    + +    W  I D+VVKTL++ +PH++H YRMCR GQ    +SV FE+LGFDI+LD  L PWLLE+NR+PSFG D+ +D  VK  +L++  +LLNI+ S+K+K+L  QK +AQ+RL       ++ P   ++  K+R  +E+RK++L + L +V+   SRE +ENRH+GN+ R++PP+DK + + Y  LL  +F  F                   LQ  M N   + +EEDI++ ++QCE ++  L  K   P+     + +P
Sbjct:   43 ITANVVGTKYEIVRLVTEEMMFTKARDDD--ETANLIWNDCAVQHEKIAELRNYQRINHFPGMGEICRKDCLARNMTKMIKCQPHEYNFIPRTWIFPAEYTQFQTYIKELKKKRRQKTFIIKPANGAMGHGISLTRNGEKLQAQDHLIVQEYLEKPFLLESYKFDLRIYILVTSCDPLRIFLYNDGLVRMGTEKYHPPSESNLSQLYMHLTNYSVNKHNENFERDETENRGSKRSIK-WFTEFLRANDYDISKFWNDISDLVVKTLIVAEPHVLHAYRMCRPGQHPTSESVCFEVLGFDIILDRKLKPWLLEINRAPSFGTDQKIDHDVKKGVLLNALKLLNIRASDKKKNLAKQKAEAQKRLYGQGSMKRLSP-ASSDWEKQRHTLERRKEELKERLAQVRKQISREEYENRHLGNYRRIYPPEDKLLLEKYEGLLATAFQTF------------LAGRAASLQREMNNPLKRMKEEDILDLLEQCELDDEKLSGKPTRPKEPRTLSSMP 537          

HSP 2 Score: 117.472 bits (293), Expect = 1.854e-25
Identity = 56/140 (40.00%), Postives = 87/140 (62.14%), Query Frame = 3
Query: 2373 IRYPGQTDVE-TKSMLAKIFSNWEHQRHSVATYWLATLNAKKRDKIIQIVRNNVDKIINDNFKFSADISAARVNRLISKVYNRLLWNRGNGLIQCFSH-FKSWQLIFSHSGDLIKPLELDICSRVVQLCLDCVLIVYQFS 2786
            IR PG+   E T S + +I  NW + +  VA+YWL  L++ K+ K++ IVR N+  ++   +K S D+    + R  ++V+NRLLWN G GL  CFS+   SW+ IF  S +++ P +   C R+VQLC DC+L VY+++
Sbjct:  716 IRIPGKGVEEITHSHIDEIMDNWTYHKSKVASYWLIKLDSVKQRKVLDIVRTNIRSVLQRIWKVS-DVECLHIYRSFNRVFNRLLWNHGQGLWSCFSNSGTSWETIFCKSTEVVTPQQFQCCQRLVQLCKDCLLAVYKYA 854          
BLAST of Tubulin polyglutamylase TTLL7 vs. UniProt/SwissProt
Match: sp|Q6ZT98|TTLL7_HUMAN (Tubulin polyglutamylase TTLL7 OS=Homo sapiens OX=9606 GN=TTLL7 PE=1 SV=2)

HSP 1 Score: 399.438 bits (1025), Expect = 8.172e-123
Identity = 223/493 (45.23%), Postives = 324/493 (65.72%), Query Frame = 3
Query:  297 MTANVNGTRFEIVKKILESVGFTLRDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXXXLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRKDIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDDKTVYDYYAELLVDSFTLFNQLNYQNCSTDSTQATQQMLQSFMPNQFREEDIMEQIKQCEAEENALLEK 1775
            +TANV GT+FEIV+ +++ +GF    DE  +T  LIW DS + QE+I+EL++YQRINHF GM EI RKDFL +  +KM K RP DY + P+TW+FP E      Y+KE KK  K+K FI+KPANGAMG GI L    D + S +  IVQEYI+KP L++GYK D RIY+L+T CDPL+ F+Y +GLVR+ TEKY   ++  +  ++ HLTNYSVNK N ++ R   E+ GSK+S+      F      +    W  I ++VVKTL++ +PH++H YRMCR GQ    +SV FE+LGFDILLD  L PWLLE+NR+PSFG D+ +D  VK  +L++  +LLNI+ S+K+++L  QK +AQRRL       ++ P   ++  ++R  +E+RK++L + L +V+   SRE  ENRH+GN+ R++PP+DK + + Y  LL  +F  F         +    + Q+ L + +  + +EEDI++ ++QCE ++  L+ K
Sbjct:   41 ITANVAGTKFEIVRLVIDEMGFMKTPDED-ETSNLIWCDSAVQQEKISELQNYQRINHFPGMGEICRKDFLARNMTKMIKSRPLDYTFVPRTWIFPAEYTQFQNYVKELKKKRKQKTFIVKPANGAMGHGISLIRNGDKLPSQDHLIVQEYIEKPFLMEGYKFDLRIYILVTSCDPLKIFLYHDGLVRMGTEKYIPPNESNLTQLYMHLTNYSVNKHNEHFERDETENKGSKRSIK-WFTEFLQANQHDVAKFWSDISELVVKTLIVAEPHVLHAYRMCRPGQPPGSESVCFEVLGFDILLDRKLKPWLLEINRAPSFGTDQKIDYDVKRGVLLNALKLLNIRTSDKRRNLAKQKAEAQRRLYGQNSIKRLLPG-SSDWEQQRHQLERRKEELKERLAQVRKQISREEHENRHMGNYRRIYPPEDKALLEKYENLLAVAFQTF--------LSGRAASFQRELNNPL-KRMKEEDILDLLEQCEIDDEKLMGK 521          

HSP 2 Score: 121.709 bits (304), Expect = 8.584e-27
Identity = 51/139 (36.69%), Postives = 93/139 (66.91%), Query Frame = 3
Query: 2373 IRYPGQTDVETKSMLAKIFSNWEHQRHSVATYWLATLNAKKRDKIIQIVRNNVDKIINDNFKFSADISAARVNRLISKVYNRLLWNRGNGLIQCFS-HFKSWQLIFSHSGDLIKPLELDICSRVVQLCLDCVLIVYQFS 2786
            IR+PG++D E++ ++  I  NW++ +  VA+YWL  L++ K+ K++ IV+ ++  ++   +K   D+    + R+ ++V+NRLLW+RG GL  CF     SW+ IF+ S +++ PL+L  C R+V+LC  C+L+VY+++
Sbjct:  693 IRFPGKSDAESELLIEDIIDNWKYHKTKVASYWLIKLDSVKQRKVLDIVKTSIRTVLPRIWKV-PDVEEVNLYRIFNRVFNRLLWSRGQGLWNCFCDSGSSWESIFNKSPEVVTPLQLQCCQRLVELCKQCLLVVYKYA 830          
BLAST of Tubulin polyglutamylase TTLL7 vs. UniProt/SwissProt
Match: sp|A4Q9F0|TTLL7_MOUSE (Tubulin polyglutamylase TTLL7 OS=Mus musculus OX=10090 GN=Ttll7 PE=1 SV=1)

HSP 1 Score: 399.438 bits (1025), Expect = 1.291e-122
Identity = 226/513 (44.05%), Postives = 328/513 (63.94%), Query Frame = 3
Query:  297 MTANVNGTRFEIVKKILESVGFTLRDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXXXLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRKDIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDDKTVYDYYAELLVDSFTLFNQLNYQNCSTDSTQATQQMLQSFMPNQFREEDIMEQIKQCEAEENALLEKWK----------LPQNAELT 1805
            +TANV GT+FEIV+ +++ +GF    DE  +T  LIW D+ + QE+IT+L++YQRINHF GM EI RKDFL +  +KM K RP DY + P+TW+FP E      Y+KE KK  K+K FI+KPANGAMG GI L    D + S +  IVQEYI+KP L++GYK D RIY+L+T CDPL+ F+Y +GLVR+ TEKY   ++  +  ++ HLTNYSVNK N  + R   E  GSK+S+      F      +    W  I ++VVKTL++ +PH++H YRMCR GQ    +SV FE+LGFDILLD  L PWLLE+NR+PSFG D+ +D  VK  +L++  +LLNI+ S+K+K+L  QK +AQRRL       ++ P   ++  ++R  +E+RK++L + L++V+   S+E  ENRH+GN+ R++PP+DK + + Y  LL  +F  F        S  +    ++M       + REED+++ ++QCE ++  L+ K            +P+ AE+T
Sbjct:   41 ITANVAGTKFEIVRLVIDEMGFMKTPDED-ETSNLIWCDAAVQQEKITDLQNYQRINHFPGMGEICRKDFLARNMTKMIKSRPMDYTFVPRTWIFPSEYTQFQNYVKELKKKRKQKTFIVKPANGAMGHGISLIRNGDKVPSQDHLIVQEYIEKPFLMEGYKFDLRIYILVTSCDPLKIFLYHDGLVRMGTEKYIPPNESNLTQLYMHLTNYSVNKHNERFERNETEDKGSKRSIK-WFTEFLQANQHDVTKFWSDISELVVKTLIVAEPHVLHAYRMCRPGQPPGSESVCFEVLGFDILLDRKLKPWLLEINRAPSFGTDQKIDYDVKRGVLLNALKLLNIRTSDKRKNLAKQKAEAQRRLYGQNPVRRLSPG-SSDWEQQRHQLERRKEELKERLLQVRKQVSQEEHENRHMGNYRRIYPPEDKALLEKYEGLLAVAFQTF-------LSGRAASFQREMNNPL--KKMREEDLLDLLEQCEIDDEKLMGKTGRVRGPKPLCCMPECAEVT 541          

HSP 2 Score: 120.168 bits (300), Expect = 3.164e-26
Identity = 51/139 (36.69%), Postives = 92/139 (66.19%), Query Frame = 3
Query: 2373 IRYPGQTDVETKSMLAKIFSNWEHQRHSVATYWLATLNAKKRDKIIQIVRNNVDKIINDNFKFSADISAARVNRLISKVYNRLLWNRGNGLIQCFS-HFKSWQLIFSHSGDLIKPLELDICSRVVQLCLDCVLIVYQFS 2786
            IR+PG++D E++ ++  I  NW+H +  VA+YWL  L++ K+ K++ IV++++  ++   ++   D     + R+ ++V+NRLLW+ G GL  CF     SW+ IFS S +++ PL+L  C R+V+LC  C+L+VY+++
Sbjct:  718 IRFPGKSDAESELLIEDIMDNWKHYKTKVASYWLIKLDSVKQRKVLDIVKSSIRTVLPRIWRV-PDAEELSLYRIFNRVFNRLLWSHGQGLWSCFCDSGSSWESIFSKSPEVVTPLQLQCCQRLVELCKQCLLVVYKYT 855          
BLAST of Tubulin polyglutamylase TTLL7 vs. UniProt/SwissProt
Match: sp|Q8N841|TTLL6_HUMAN (Tubulin polyglutamylase TTLL6 OS=Homo sapiens OX=9606 GN=TTLL6 PE=1 SV=2)

HSP 1 Score: 272.322 bits (695), Expect = 1.617e-76
Identity = 150/359 (41.78%), Postives = 213/359 (59.33%), Query Frame = 3
Query:  297 MTANVNGTRFEIVKKILESVGFTLRDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXXXLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQ 1373
            +  N++  R+E V++  +  GF    ++   T Y  WTD  +S ER+ E+KSYQ+INHF GM EI RKD L +  S+M K+ PKD+ +FP+TW  P +    +  ++   +  K K +I KP +G  G GI +      IK  E  I Q YI KP ++DG+K D RIYVL+T CDPLR F+Y EGL R +T  Y+      +D I  HLTNYS+NK +SN++R   ++    +   S  + +    + N + +W+ I D+++KTL+   P + HNY  C      N  S  FEILGFDILLD  L PWLLEVN SPSF  D  LD++VK  LL DT  L+N++  +K+K L  ++Q+ Q
Sbjct:   61 LVINLSSCRYESVRRAAQQYGFREGGEDDDWTLY--WTDYSVSLERVMEMKSYQKINHFPGMSEICRKDLLARNMSRMLKMFPKDFRFFPRTWCLPAD----WGDLQTYSRSRKNKTYICKPDSGCQGKGIFITRTVKEIKPGEDMICQLYISKPFIIDGFKFDLRIYVLVTSCDPLRIFVYNEGLARFATTSYSRPCTDNLDDICMHLTNYSINKHSSNFSR---DAHSGSKRKLSTFSAYLEDHSYNVEQIWRDIEDVIIKTLISAHPIIRHNYHTCFPNHTLN--SACFEILGFDILLDHKLKPWLLEVNHSPSFSTDSRLDKEVKDGLLYDTLVLINLESCDKKKVLEEERQRGQ 408          
BLAST of Tubulin polyglutamylase TTLL7 vs. UniProt/SwissProt
Match: sp|A8CVX7|TTLL6_DANRE (Tubulin polyglutamylase ttll6 OS=Danio rerio OX=7955 GN=ttll6 PE=2 SV=1)

HSP 1 Score: 269.626 bits (688), Expect = 5.105e-76
Identity = 171/474 (36.08%), Postives = 248/474 (52.32%), Query Frame = 3
Query:  306 NVNGTRFEIVKKILESVGFTLRDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXXXLMNRFKTK---FNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRKDIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDDKTVYDYYAELLVDSFTLFNQLNYQNCSTDSTQATQQMLQSFMPNQFREE 1718
            N+   ++E V++     G  +R+    +   L WTD  +S +R+ ++K YQ+INHF GM EI RKD L +  ++M KL PK+YN FP+TW  P +    Y   +   +  K K FI KP +G  G GI L      I+  E  I Q Y+ KP ++DG+K D RIYVL+T CDP R F+Y EGLVR  T  Y   +   ++ +  HLTNY++NK + N+ R  D  S  K      ++ FK      + +T+ LW  I D ++KTL+   P L HNY+ C         S  FEILGFD+LLD  L PWLLEVN SPSF  D  LDR+VK SLL DT  L+N+   +++K    +K++ + RL              N + + R +  ++ Q     L+        + +E +H+G F R+FP D    Y+ Y +    S +LF +      S    +  +Q LQ     Q ++E
Sbjct:   57 NLTNCKYESVRRAARRYG--IREAAEGEDWTLYWTDCSVSLDRVMDMKRYQKINHFPGMNEICRKDLLARNMNRMLKLFPKEYNIFPRTWCLPAD----YSDFQAYTRAKKHKTFICKPDSGCQGRGIYLTKSSKDIRPGEHMICQVYMSKPFIIDGFKFDLRIYVLVTSCDPFRVFMYDEGLVRFCTTHYTEPTVSNLEDVCMHLTNYAINKHSENFVRDEDTGSKRK------LSSFKKHMEDMSYDTEKLWTDIEDAIIKTLISAHPILKHNYQTCFPNHASG--SACFEILGFDVLLDRRLKPWLLEVNHSPSFTTDSRLDREVKDSLLYDTLVLINLGACDRRKITEEEKRRVKERLQ------------QNRSREARNEEPRQSQAASMELM--------QKYEAKHMGGFRRIFPRDGGEKYEKYFQ---HSSSLFQET---AASKAREECARQQLQELRLKQEQKE 490          
BLAST of Tubulin polyglutamylase TTLL7 vs. TrEMBL
Match: R7UAZ0 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_226440 PE=4 SV=1)

HSP 1 Score: 444.891 bits (1143), Expect = 5.287e-137
Identity = 231/489 (47.24%), Postives = 326/489 (66.67%), Query Frame = 3
Query:  291 HQMTANVNGTRFEIVKKILESVGFTLRDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXXXLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRKDIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDDKTVYDYYAELLVDSFTLFNQLNYQNCSTDSTQATQQMLQSFMPNQFREEDIMEQIKQCEAEE 1757
            + ++AN++GTR++IV++++E  GFT+   E     YLIW DSF+S ERI+ELK +QRINHF GM EI RKD L +  +KM K  P+DY++ PKTW+ P E      Y ++ KK  K K FI KP+NGAMG GI LF   + I  NE  I+QEYIDKP L++G+K D RIYVLIT CDPLR F++ +GL+RL TEKY   +D  +D ++ HLTNYSVNK N  Y +    +    +      N +  + + +   LWK I +++VKTL++  PH++H YRMCR GQ  + DSV FE+LGFD++LD+ L PWL+E+NRSPSFG DE LD  +K SL+  T +LLNIK S+K+K++  QK + QRRL   + R  I+  + +E  KKR+ +E++K++L D+L R++  ++RE FENR+ GNF R+FPPDDK   + Y+ L+ D+F LF         +    + QQ +Q    N F+EEDI++ + QCEA+E
Sbjct:  299 YPVSANLSGTRYDIVRQMVEQAGFTISRHED-PMAYLIWNDSFVSTERISELKPFQRINHFPGMGEICRKDCLARNMAKMAKAHPEDYSFVPKTWILPSEYTAFQTYARDLKKKKKSKTFIAKPSNGAMGNGISLFRNTEKIPQNENIIIQEYIDKPLLIEGFKCDMRIYVLITSCDPLRVFLFNDGLLRLGTEKYVYPTDGNIDHLYMHLTNYSVNKHNDRYEKS-HTTDTGSKRSLKFFNDYLRRHDYDVSHLWKNITELIVKTLIVSLPHIMHAYRMCRPGQSPSSDSVCFELLGFDVMLDKKLRPWLIEINRSPSFGTDEKLDYDIKSSLVEHTLKLLNIKASDKRKNIAAQKAQTQRRLLRPSKR--IDKDM-SELDKKRQSVERKKEELKDMLTRIRKDATREDFENRNCGNFKRIFPPDDKFRREKYSSLITDAFNLF--------LSGRAASLQQEIQRAYSNTFKEEDILDMLAQCEADE 774          

HSP 2 Score: 99.3673 bits (246), Expect = 2.685e-17
Identity = 47/102 (46.08%), Postives = 65/102 (63.73%), Query Frame = 3
Query: 2502 KIIQIVRNNVDKIINDNFKFSADISAARVNRLISKVYNRLLWNRGNGLIQCF-SHFKSWQLIFSHSGDLIKPLELDICSRVVQLCLDCVLIVYQFSISLSQS 2804
            K+I IVR+NV  ++   +K S D+   R+ R+ ++V+NRLLW+ G GL  CF +   SW+ IFS S D I   E+  C R+VQLC DC+LIVYQF+     S
Sbjct:  790 KVIDIVRSNVRALLQRTWKIS-DVDTLRLFRIFTRVFNRLLWSHGQGLWNCFQTSGNSWETIFSKSSDTISASEMACCRRIVQLCRDCLLIVYQFAAEAKSS 890          
BLAST of Tubulin polyglutamylase TTLL7 vs. TrEMBL
Match: K1S3M0 (Tubulin polyglutamylase TTLL7 OS=Crassostrea gigas OX=29159 GN=CGI_10028200 PE=4 SV=1)

HSP 1 Score: 436.417 bits (1121), Expect = 4.233e-134
Identity = 231/491 (47.05%), Postives = 329/491 (67.01%), Query Frame = 3
Query:  291 HQMTANVNGTRFEIVKKILESVGFTL-RDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXXXLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLD-NETLKKRKDIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDDKTVYDYYAELLVDSFTLFNQLNYQNCSTDSTQATQQMLQSFMPNQFREEDIMEQIKQCEAEE 1757
            H +TAN++GTR+E+++ + E   F + ++D+     YLIW+DSF+S +RITELK +QRINHF GMVE++RKD L +   K+Q+   +++N+ PKTW+ P + +LL  Y K+ K   K + FI+KPANGA G GI+L+   + I  +E  IVQEYIDKP LL+GYK D RIYVL+T CDPLR FI+ +GLVR+ST+KY   +D  + +++ HLTNYSVNK N  Y +G D      +      N +  K + +T  LW++I D+VVKTL++ QPHL+H YRMCR G     DSV FE+LGFD+L+D+ L PWLLE+NRSPSFG DE +D  +K +L+ DT RLLNIK S+K+++ + QK +AQ+RL    FR+     +D +E  KKR +IEKRK++L + L RV+ +++RE FENR+ G F R+FP +DK     Y  ++   F +          +    A Q+ +Q    NQ+REEDI++ I +CEA+E
Sbjct:   73 HGITANLSGTRYEVIRLVCEKCKFDICKEDD--PNSYLIWSDSFVSADRITELKPFQRINHFPGMVEVTRKDCLARNMMKIQRHHAEEFNFVPKTWILPADHSLLQNYAKDLKAKKKYRTFIVKPANGAQGHGIQLYRNAEKIPPSEHFIVQEYIDKPLLLEGYKFDLRIYVLVTSCDPLRIFIFNDGLVRMSTDKYVNPADANLSNLYMHLTNYSVNKHNEYYQKG-DSVETGSKRSIRYFNEYLRKNDFDTMLLWRRIYDMVVKTLLVAQPHLLHAYRMCRPGAPPGSDSVCFEVLGFDVLIDKKLNPWLLEINRSPSFGTDEKIDFDIKSALIEDTVRLLNIKLSDKRRNYFAQKAEAQKRL----FRTTKRNEVDMSELEKKRLNIEKRKEELKEQLARVRKATAREDFENRNAGRFRRIFPSEDKLKQQKYVNIMSSIFGVV--------MSGRAPAMQKEIQKVYNNQWREEDILDMIAECEADE 548          

HSP 2 Score: 130.954 bits (328), Expect = 3.716e-27
Identity = 67/161 (41.61%), Postives = 101/161 (62.73%), Query Frame = 3
Query: 2373 IRYPGQTDVETKSMLAKIFSNWEHQRHSVATYWLATLNAKKRDKIIQIVRNNVDKIINDNFKFSADISAARVNRLISKVYNRLLWNRGNGLIQCF---SHFKSWQLIFSHSGDLIKPLELDICSRVVQLCLDCVLIVYQFSI---SLSQSSTPRSDKSFAS 2837
            I++PG+TD E + +L  +  NW+  +  +A+YWL  L++ KR K+I IVR+NV  ++   ++ S D+   R+ R+ ++V+NRLLW+ G GL  CF   S   SW+ IFS S + I   E + C R+VQLC DC+LIVYQF+    S SQ ++  +D S A 
Sbjct:  705 IKFPGKTDQEAELILDTLHENWKFHKPRIASYWLVKLDSIKRRKVIDIVRSNVRAVLQRIWRIS-DVDNLRLYRIFTRVFNRLLWSHGQGLWNCFSTTSQNGSWETIFSKSSENICENEFNCCRRIVQLCRDCLLIVYQFAAEAKSTSQQNSENTDLSSAG 864          
BLAST of Tubulin polyglutamylase TTLL7 vs. TrEMBL
Match: A7RT71 (Predicted protein (Fragment) OS=Nematostella vectensis OX=45351 GN=v1g92568 PE=4 SV=1)

HSP 1 Score: 421.779 bits (1083), Expect = 1.601e-133
Identity = 228/489 (46.63%), Postives = 320/489 (65.44%), Query Frame = 3
Query:  297 MTANVNGTRFEIVKKILESVGFTL-RDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXXXLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRKDIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDDKTVYDYYAELLVDSFTLFNQLNYQNCSTDSTQATQQMLQSFMPNQFREEDIMEQIKQCEAEEN 1760
            +TAN++ T+++IV+K     G  + RDD+   +C+ IW+DS +  ER  ELK YQRINHF GM EI RKD L +  +KM++  P +Y++ P+TW+ P E      Y +E KK  + K FI+KPANGAMG GI L    D I S+E  ++QEYID+P LLDGYK D R+YVL+T CDPLR F+Y +GLVRL TE Y   ++  MD +F HLTNYS+NK N N+ R  ++  GSK+S+  L N +    + + + LW+ I +++VKTL++ QPH++H+YRMCR G     DSV FE+LGFDILLD  L PWLLE+NRSPSFG D  LD++VKG  L DT RLLNIKPS++++ +  +K ++QRRL     RS+    + +E  KK+  + KR+ +L + L +++  S+RE FEN ++GNF RV+PPDD+   + Y  LL D+F LF          D  Q    +         REE+I++ ++QCEA+EN
Sbjct:    6 VTANISATKYDIVRKACVHAGMVVTRDDD--PSCFFIWSDSSVGAERFIELKPYQRINHFPGMGEICRKDSLARNIAKMKRAHPDEYSFAPQTWVLPAEYAAFQMYCRELKKKKRAKTFIMKPANGAMGNGISLIRNGDRIPSHEQLVIQEYIDRPFLLDGYKFDLRVYVLVTSCDPLRIFVYNDGLVRLGTECYEPPTEDNMDELFMHLTNYSINKHNENFERDENDDMGSKRSIKWL-NEWLQSMDYDVNFLWRGITEVIVKTLIVAQPHVLHSYRMCRPGAATGSDSVCFELLGFDILLDRKLKPWLLEINRSPSFGTDSKLDQEVKGGALRDTLRLLNIKPSDRRRGMAAEKAESQRRLLTQPKRSEYTMSV-SELDKKKMILNKRRNELKERLNQLRRESAREEFENINMGNFRRVYPPDDRAKNEKYTGLLADAFKLFLSGRAAALQKDGNQPFSTL---------REEEILDLLEQCEADEN 481          
BLAST of Tubulin polyglutamylase TTLL7 vs. TrEMBL
Match: A0A1S3II96 (tubulin polyglutamylase TTLL7 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106164467 PE=4 SV=1)

HSP 1 Score: 433.335 bits (1113), Expect = 5.991e-133
Identity = 239/490 (48.78%), Postives = 335/490 (68.37%), Query Frame = 3
Query:  297 MTANVNGTRFEIVKKILESVGFTL-RDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXXXLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFR-SKIEPHLDNETLKKRK-DIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDDKTVYDYYAELLVDSFTLFNQLNYQNCSTDSTQATQQMLQSFMPNQFREEDIMEQIKQCEAEE 1757
            +TAN+ GTR+E+V++++E  GF + RDD+     +L+W DSF+S E+I+ELK +QRINHF GM EI+RKD L +  +KM KL P +YN+ PKTW+ P + ++L  Y K+ K   K + FI+KP+ GA G GI L+   + I  +E  IVQEY+DKP LLDGYK D RIYVL+T CDPLR F++ +GLVRLSTEKY    D  +DS+F HLTNYS+NK + NY +  +E +GSK+++  L N +  K + +   LWK I D+++KTL++ +PH++H YRMCR GQ    DSV FEILGFDI LD  L PWLLE+NRSPSFG DE LD ++K  LL DT RLLN+K S+K+K+L  QK ++Q+RL     R S I   +D   L+K+K   E+RK++L  LL R++  ++RE FENR+ G F R+FPPDDK   D +  LL  +F+ F        S  +T  T+++ +++  N+ +E DI++ + QCEA+E
Sbjct:   70 VTANLAGTRYEVVREMVEKNGFHVSRDDD--PNSFLLWFDSFVSTEKISELKVFQRINHFPGMGEITRKDSLARNMAKMCKLHPDEYNFVPKTWILPADYSVLQNYAKDLKAKKKHRTFIVKPSTGAQGHGISLYKNAEKIPQSEHFIVQEYLDKPYLLDGYKFDLRIYVLMTSCDPLRIFLFNDGLVRLSTEKYIPPHDSNIDSLFMHLTNYSLNKHSENYEKDQNEDTGSKRTIRYL-NEYLRKEDKDVAWLWKNISDVIIKTLIVAEPHILHAYRMCRPGQQAGSDSVCFEILGFDIFLDRKLKPWLLEINRSPSFGTDEALDYRIKSGLLEDTLRLLNVKASDKRKNLAAQKAESQKRLFQQPSRKSDI---MDLSDLEKKKLSTERRKEELKGLLSRIRKDATREDFENRNCGRFRRIFPPDDKFHADKFTNLLTSAFSTF-------LSGKATTLTKEIERTYN-NKLKEADILDMLAQCEADE 545          

HSP 2 Score: 128.642 bits (322), Expect = 2.169e-26
Identity = 66/161 (40.99%), Postives = 107/161 (66.46%), Query Frame = 3
Query: 2373 IRYPGQTDVETKSMLAKIFSNWEHQRHSVATYWLATLNAKKRDKIIQIVRNNVDKIINDNFKFSADISAARVNRLISKVYNRLLWNRGNGLIQCFSH-FKSWQLIFSHSGDLIKPLELDICSRVVQLCLDCVLIVYQFSI---SLSQSSTPRSDKSFASQS 2843
            I++PG+TD E + +L KI  NW+  +  +A+YWL  L++ KR K+I IVR+NV  ++   +K   D+ + R+ R+ ++V+NRLLW+ G GL  CF     SW+ IFS S D I   E++ C R+VQLC DC+LIVYQF+    +L+Q S+  ++++ ++++
Sbjct:  704 IKFPGKTDEEAEWILDKIQENWKFHKPRIASYWLVKLDSIKRRKVIDIVRSNVRAVLQRTWK-CPDVESLRLYRIFNRVFNRLLWSHGQGLWNCFGQSGNSWETIFSKSSDSISSTEMNCCRRIVQLCRDCLLIVYQFASDAKNLAQQSSSLNEETGSTKA 863          
BLAST of Tubulin polyglutamylase TTLL7 vs. TrEMBL
Match: A0A1S3II05 (tubulin polyglutamylase TTLL7 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106164467 PE=4 SV=1)

HSP 1 Score: 428.328 bits (1100), Expect = 4.792e-131
Identity = 237/492 (48.17%), Postives = 329/492 (66.87%), Query Frame = 3
Query:  297 MTANVNGTRFEIVKKILESVGFTL-RDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXXXLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFR-SKIEPHLDNETLKKRK-DIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDDKTVYDYYAELLVDSFTLF--NQLNYQNCSTDSTQATQQMLQSFMPNQFREEDIMEQIKQCEAEE 1757
            +TAN+ GTR+E+V++++E  GF + RDD+     +L+W DSF+S E+I+ELK +QRINHF GM EI+RKD L +  +KM KL P +YN+ PKTW+ P + ++L  Y K+ K   K + FI+KP+ GA G GI L+   + I  +E  IVQEY+DKP LLDGYK D RIYVL+T CDPLR F++ +GLVRLSTEKY    D  +DS+F HLTNYS+NK + NY +  +E +GSK+++  L N +  K + +   LWK I D+++KTL++ +PH++H YRMCR GQ    DSV FEILGFDI LD  L PWLLE+NRSPSFG DE LD ++K  LL DT RLLN+K S+K+K+L  QK ++Q+RL     R S I   +D   L+K+K   E+RK++L  LL R++  ++RE FENR+ G F R+FPPDDK   D +  LL  +F+ F   +        + T   +  + S +     E DI++ + QCEA+E
Sbjct:   70 VTANLAGTRYEVVREMVEKNGFHVSRDDD--PNSFLLWFDSFVSTEKISELKVFQRINHFPGMGEITRKDSLARNMAKMCKLHPDEYNFVPKTWILPADYSVLQNYAKDLKAKKKHRTFIVKPSTGAQGHGISLYKNAEKIPQSEHFIVQEYLDKPYLLDGYKFDLRIYVLMTSCDPLRIFLFNDGLVRLSTEKYIPPHDSNIDSLFMHLTNYSLNKHSENYEKDQNEDTGSKRTIRYL-NEYLRKEDKDVAWLWKNISDVIIKTLIVAEPHILHAYRMCRPGQQAGSDSVCFEILGFDIFLDRKLKPWLLEINRSPSFGTDEALDYRIKSGLLEDTLRLLNVKASDKRKNLAAQKAESQKRLFQQPSRKSDI---MDLSDLEKKKLSTERRKEELKGLLSRIRKDATREDFENRNCGRFRRIFPPDDKFHADKFTNLLTSAFSTFLSGKATTLTKEIERTYNNKLKIPSLVGTDLTEADILDMLAQCEADE 555          

HSP 2 Score: 128.642 bits (322), Expect = 2.113e-26
Identity = 66/161 (40.99%), Postives = 107/161 (66.46%), Query Frame = 3
Query: 2373 IRYPGQTDVETKSMLAKIFSNWEHQRHSVATYWLATLNAKKRDKIIQIVRNNVDKIINDNFKFSADISAARVNRLISKVYNRLLWNRGNGLIQCFSH-FKSWQLIFSHSGDLIKPLELDICSRVVQLCLDCVLIVYQFSI---SLSQSSTPRSDKSFASQS 2843
            I++PG+TD E + +L KI  NW+  +  +A+YWL  L++ KR K+I IVR+NV  ++   +K   D+ + R+ R+ ++V+NRLLW+ G GL  CF     SW+ IFS S D I   E++ C R+VQLC DC+LIVYQF+    +L+Q S+  ++++ ++++
Sbjct:  714 IKFPGKTDEEAEWILDKIQENWKFHKPRIASYWLVKLDSIKRRKVIDIVRSNVRAVLQRTWK-CPDVESLRLYRIFNRVFNRLLWSHGQGLWNCFGQSGNSWETIFSKSSDSISSTEMNCCRRIVQLCRDCLLIVYQFASDAKNLAQQSSSLNEETGSTKA 873          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Cavefish
Match: ttll7 (tubulin tyrosine ligase like 7 [Source:NCBI gene;Acc:103028996])

HSP 1 Score: 394.045 bits (1011), Expect = 1.562e-122
Identity = 216/497 (43.46%), Postives = 313/497 (62.98%), Query Frame = 3
Query:  297 MTANVNGTRFEIVKKILESVGFTLRDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXX-XXXXXXXXLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRKDIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDDKTVYDYYAELLVDSFTLFNQLNYQNCSTDSTQATQQMLQSFMPN---QFREEDIMEQIKQCEAEENALLEK 1775
            +TANV GT++EIV+  +  + F    DE  +T  LIW DS +  E+I EL++YQRINHF GM EI RKD L +  +KM K++P++Y++ PKTW+FP E      Y+KE ++  K+K FI+KPANGAMG GI L    + + + +  IVQEY+DKP L++GYK D RIY+L+T CDPLR F+Y +GLVR+ TEKY   +D  +  ++ HLTNYSVNK N N+ R  DE+     +        F    + +    W  + ++VVKTL++ +PH++H YRMCR GQ    DSV FE+LGFDI+LD  L PWLLE+NR+PSFG D+ +D  VK  +L++  +LLN++ S+K+++L  QK +AQRRL       K+     +E  K+R  +E+RK++L + L +V+   SRE  E RH+GN+ R++PPDDK + + Y  LL  +F  F                   LQ  M N   + +EEDI++ ++QCE ++  L+ K
Sbjct:   41 ITANVAGTKYEIVRIAIREIDFHKTRDED-ETANLIWNDSAVQHEKIAELRNYQRINHFPGMGEICRKDCLARNMAKMIKIQPQEYSFSPKTWIFPAEYTQFQNYVKELRRKRKQKTFIVKPANGAMGHGISLIRNCEKLPAQDHFIVQEYLDKPFLMEGYKFDLRIYILVTSCDPLRIFLYNDGLVRMGTEKYHTPNDSNLSQLYMHLTNYSVNKHNENFER--DETVDKGSKRSIGWFTEFLRTNDYDVAKFWGDVSELVVKTLIVAEPHVLHAYRMCRPGQPPGSDSVCFEVLGFDIILDRKLKPWLLEINRAPSFGTDQKIDFDVKKGVLLNALKLLNVRASDKRRNLAQQKAEAQRRLYGQGTMKKLSAG-SSEWEKQRLTLERRKEELKERLAQVRKQISREEHEKRHLGNYRRIYPPDDKLLLEKYEGLLSAAFQTF------------LAGRAASLQKEMNNPLKRMKEEDILDLLEQCELDDEKLMGK 521          

HSP 2 Score: 133.65 bits (335), Expect = 1.541e-31
Identity = 60/138 (43.48%), Postives = 95/138 (68.84%), Query Frame = 3
Query: 2373 IRYPGQTDVETKSMLAKIFSNWEHQRHSVATYWLATLNAKKRDKIIQIVRNNVDKIINDNFKFSADISAARVNRLISKVYNRLLWNRGNGLIQCF-SHFKSWQLIFSHSGDLIKPLELDICSRVVQLCLDCVLIVYQF 2783
            IR+PG+++ E +++L +I +NW++ +  VA+YWL  L+A K+ K++ IVR NV  ++   ++   D+ + R+ RL S+V+NRLLW+ G GL  CF S   SW+ IFS S +++   EL  C R+VQLC DC+L+VY+F
Sbjct:  662 IRFPGKSEEEAEAVLNEILNNWKYHKPKVASYWLVKLDATKQRKVLDIVRTNVRSVLQRIWR-EPDVDSLRLYRLFSRVFNRLLWSHGQGLWNCFCSSGSSWESIFSKSSEVVTTQELQCCQRLVQLCRDCLLVVYKF 798          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Cavefish
Match: ttll7 (tubulin tyrosine ligase like 7 [Source:NCBI gene;Acc:103028996])

HSP 1 Score: 394.815 bits (1013), Expect = 8.123e-122
Identity = 217/497 (43.66%), Postives = 313/497 (62.98%), Query Frame = 3
Query:  297 MTANVNGTRFEIVKKILESVGFTLRDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXX-XLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRKDIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDDKTVYDYYAELLVDSFTLFNQLNYQNCSTDSTQATQQMLQSFMPN---QFREEDIMEQIKQCEAEENALLEK 1775
            +TANV GT++EIV+  +  + F    DE  +T  LIW DS +  E+I EL++YQRINHF GM EI RKD L +  +KM K++P++Y++ PKTW+FP E      Y+KE ++  K+K FI+KPANGAMG GI L    + + + +  IVQEY+DKP L++GYK D RIY+L+T CDPLR F+Y +GLVR+ TEKY   +D  +  ++ HLTNYSVNK N N+ R  DE+       S      F    + +    W  + ++VVKTL++ +PH++H YRMCR GQ    DSV FE+LGFDI+LD  L PWLLE+NR+PSFG D+ +D  VK  +L++  +LLN++ S+K+++L  QK +AQRRL       K+     +E  K+R  +E+RK++L + L +V+   SRE  E RH+GN+ R++PPDDK + + Y  LL  +F  F                   LQ  M N   + +EEDI++ ++QCE ++  L+ K
Sbjct:   41 ITANVAGTKYEIVRIAIREIDFHKTRDED-ETANLIWNDSAVQHEKIAELRNYQRINHFPGMGEICRKDCLARNMAKMIKIQPQEYSFSPKTWIFPAEYTQFQNYVKELRRKRKQKTFIVKPANGAMGHGISLIRNCEKLPAQDHFIVQEYLDKPFLMEGYKFDLRIYILVTSCDPLRIFLYNDGLVRMGTEKYHTPNDSNLSQLYMHLTNYSVNKHNENFER--DETVDKGSKRSIGWFTEFLRTNDYDVAKFWGDVSELVVKTLIVAEPHVLHAYRMCRPGQPPGSDSVCFEVLGFDIILDRKLKPWLLEINRAPSFGTDQKIDFDVKKGVLLNALKLLNVRASDKRRNLAQQKAEAQRRLYGQGTMKKLSAG-SSEWEKQRLTLERRKEELKERLAQVRKQISREEHEKRHLGNYRRIYPPDDKLLLEKYEGLLSAAFQTF------------LAGRAASLQKEMNNPLKRMKEEDILDLLEQCELDDEKLMGK 521          

HSP 2 Score: 134.035 bits (336), Expect = 1.567e-31
Identity = 67/162 (41.36%), Postives = 103/162 (63.58%), Query Frame = 3
Query: 2373 IRYPGQTDVETKSMLAKIFSNWEHQRHSVATYWLATLNAKKRDKIIQIVRNNVDKIINDNFKFSADISAARVNRLISKVYNRLLWNRGNGLIQCF--SHFKSWQLIFSHSGDLIKPLELDICSRVVQLCLDCVLIVYQF----SISLSQSSTPRSDKSFASQ 2840
            IR+PG+++ E +++L +I +NW++ +  VA+YWL  L+A K+ K++ IVR NV  ++   ++   D+ + R+ RL S+V+NRLLW+ G GL  CF  S   SW+ IFS S +++   EL  C R+VQLC DC+L+VY+F      SL+  S    D S  SQ
Sbjct:  730 IRFPGKSEEEAEAVLNEILNNWKYHKPKVASYWLVKLDATKQRKVLDIVRTNVRSVLQRIWR-EPDVDSLRLYRLFSRVFNRLLWSHGQGLWNCFCSSGRSSWESIFSKSSEVVTTQELQCCQRLVQLCRDCLLVVYKFVSDSHGSLTGLSPEWDDTSLVSQ 890          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Cavefish
Match: ttll7 (tubulin tyrosine ligase like 7 [Source:NCBI gene;Acc:103028996])

HSP 1 Score: 395.201 bits (1014), Expect = 9.895e-122
Identity = 217/497 (43.66%), Postives = 313/497 (62.98%), Query Frame = 3
Query:  297 MTANVNGTRFEIVKKILESVGFTLRDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXX-XLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRKDIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDDKTVYDYYAELLVDSFTLFNQLNYQNCSTDSTQATQQMLQSFMPN---QFREEDIMEQIKQCEAEENALLEK 1775
            +TANV GT++EIV+  +  + F    DE  +T  LIW DS +  E+I EL++YQRINHF GM EI RKD L +  +KM K++P++Y++ PKTW+FP E      Y+KE ++  K+K FI+KPANGAMG GI L    + + + +  IVQEY+DKP L++GYK D RIY+L+T CDPLR F+Y +GLVR+ TEKY   +D  +  ++ HLTNYSVNK N N+ R  DE+       S      F    + +    W  + ++VVKTL++ +PH++H YRMCR GQ    DSV FE+LGFDI+LD  L PWLLE+NR+PSFG D+ +D  VK  +L++  +LLN++ S+K+++L  QK +AQRRL       K+     +E  K+R  +E+RK++L + L +V+   SRE  E RH+GN+ R++PPDDK + + Y  LL  +F  F                   LQ  M N   + +EEDI++ ++QCE ++  L+ K
Sbjct:   41 ITANVAGTKYEIVRIAIREIDFHKTRDED-ETANLIWNDSAVQHEKIAELRNYQRINHFPGMGEICRKDCLARNMAKMIKIQPQEYSFSPKTWIFPAEYTQFQNYVKELRRKRKQKTFIVKPANGAMGHGISLIRNCEKLPAQDHFIVQEYLDKPFLMEGYKFDLRIYILVTSCDPLRIFLYNDGLVRMGTEKYHTPNDSNLSQLYMHLTNYSVNKHNENFER--DETVDKGSKRSIGWFTEFLRTNDYDVAKFWGDVSELVVKTLIVAEPHVLHAYRMCRPGQPPGSDSVCFEVLGFDIILDRKLKPWLLEINRAPSFGTDQKIDFDVKKGVLLNALKLLNVRASDKRRNLAQQKAEAQRRLYGQGTMKKLSAG-SSEWEKQRLTLERRKEELKERLAQVRKQISREEHEKRHLGNYRRIYPPDDKLLLEKYEGLLSAAFQTF------------LAGRAASLQKEMNNPLKRMKEEDILDLLEQCELDDEKLMGK 521          

HSP 2 Score: 134.806 bits (338), Expect = 8.462e-32
Identity = 72/184 (39.13%), Postives = 113/184 (61.41%), Query Frame = 3
Query: 2373 IRYPGQTDVETKSMLAKIFSNWEHQRHSVATYWLATLNAKKRDKIIQIVRNNVDKIINDNFKFSADISAARVNRLISKVYNRLLWNRGNGLIQCF--SHFKSWQLIFSHSGDLIKPLELDICSRVVQLCLDCVLIVYQFSISLSQSS----TPRSDKSFASQSVISDYKESDLTSSFSVNSVTA 2906
            IR+PG+++ E +++L +I +NW++ +  VA+YWL  L+A K+ K++ IVR NV  ++   ++   D+ + R+ RL S+V+NRLLW+ G GL  CF  S   SW+ IFS S +++   EL  C R+VQLC DC+L+VY+F +S S  S    +P  D +     V S +     +SSF  N  +A
Sbjct:  730 IRFPGKSEEEAEAVLNEILNNWKYHKPKVASYWLVKLDATKQRKVLDIVRTNVRSVLQRIWR-EPDVDSLRLYRLFSRVFNRLLWSHGQGLWNCFCSSGRSSWESIFSKSSEVVTTQELQCCQRLVQLCRDCLLVVYKF-VSDSHGSLTGLSPEWDDTRYLLPVTSQFIIKWPSSSFGRNVASA 911          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Cavefish
Match: ttll7 (tubulin tyrosine ligase like 7 [Source:NCBI gene;Acc:103028996])

HSP 1 Score: 394.43 bits (1012), Expect = 1.332e-121
Identity = 217/497 (43.66%), Postives = 313/497 (62.98%), Query Frame = 3
Query:  297 MTANVNGTRFEIVKKILESVGFTLRDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXX-XLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRKDIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDDKTVYDYYAELLVDSFTLFNQLNYQNCSTDSTQATQQMLQSFMPN---QFREEDIMEQIKQCEAEENALLEK 1775
            +TANV GT++EIV+  +  + F    DE  +T  LIW DS +  E+I EL++YQRINHF GM EI RKD L +  +KM K++P++Y++ PKTW+FP E      Y+KE ++  K+K FI+KPANGAMG GI L    + + + +  IVQEY+DKP L++GYK D RIY+L+T CDPLR F+Y +GLVR+ TEKY   +D  +  ++ HLTNYSVNK N N+ R  DE+       S      F    + +    W  + ++VVKTL++ +PH++H YRMCR GQ    DSV FE+LGFDI+LD  L PWLLE+NR+PSFG D+ +D  VK  +L++  +LLN++ S+K+++L  QK +AQRRL       K+     +E  K+R  +E+RK++L + L +V+   SRE  E RH+GN+ R++PPDDK + + Y  LL  +F  F                   LQ  M N   + +EEDI++ ++QCE ++  L+ K
Sbjct:   41 ITANVAGTKYEIVRIAIREIDFHKTRDE-DETANLIWNDSAVQHEKIAELRNYQRINHFPGMGEICRKDCLARNMAKMIKIQPQEYSFSPKTWIFPAEYTQFQNYVKELRRKRKQKTFIVKPANGAMGHGISLIRNCEKLPAQDHFIVQEYLDKPFLMEGYKFDLRIYILVTSCDPLRIFLYNDGLVRMGTEKYHTPNDSNLSQLYMHLTNYSVNKHNENFER--DETVDKGSKRSIGWFTEFLRTNDYDVAKFWGDVSELVVKTLIVAEPHVLHAYRMCRPGQPPGSDSVCFEVLGFDIILDRKLKPWLLEINRAPSFGTDQKIDFDVKKGVLLNALKLLNVRASDKRRNLAQQKAEAQRRLYGQGTMKKLSAG-SSEWEKQRLTLERRKEELKERLAQVRKQISREEHEKRHLGNYRRIYPPDDKLLLEKYEGLLSAAFQTF------------LAGRAASLQKEMNNPLKRMKEEDILDLLEQCELDDEKLMGK 521          

HSP 2 Score: 133.265 bits (334), Expect = 2.529e-31
Identity = 60/139 (43.17%), Postives = 95/139 (68.35%), Query Frame = 3
Query: 2373 IRYPGQTDVETKSMLAKIFSNWEHQRHSVATYWLATLNAKKRDKIIQIVRNNVDKIINDNFKFSADISAARVNRLISKVYNRLLWNRGNGLIQCF--SHFKSWQLIFSHSGDLIKPLELDICSRVVQLCLDCVLIVYQF 2783
            IR+PG+++ E +++L +I +NW++ +  VA+YWL  L+A K+ K++ IVR NV  ++   ++   D+ + R+ RL S+V+NRLLW+ G GL  CF  S   SW+ IFS S +++   EL  C R+VQLC DC+L+VY+F
Sbjct:  730 IRFPGKSEEEAEAVLNEILNNWKYHKPKVASYWLVKLDATKQRKVLDIVRTNVRSVLQRIWR-EPDVDSLRLYRLFSRVFNRLLWSHGQGLWNCFCSSGRSSWESIFSKSSEVVTTQELQCCQRLVQLCRDCLLVVYKF 867          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Cavefish
Match: ttll6 (tubulin tyrosine ligase like 6 [Source:NCBI gene;Acc:103042535])

HSP 1 Score: 272.322 bits (695), Expect = 5.179e-78
Identity = 171/507 (33.73%), Postives = 256/507 (50.49%), Query Frame = 3
Query:  306 NVNGTRFEIVKKILESVGFTLRDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXXXLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRKDIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDDKTVYDYYAELLVDSFTLFNQLNYQNCSTDSTQATQQMLQSFMPNQFREEDIMEQIKQCEAEENALLEKWKLPQNAELTTIIPSVN 1826
            N+   ++E V++     G  LR+    +   L WTD  +S +R+ ++K YQ+INHF GM EI RKD L +  ++M KL PKDYN FP+TW  P +    Y   +   +  K K +I KP +G  G GI L   +  I+  E  I Q Y+ +P ++DG+K D R+YVL+T CDP R F+Y EGL R  T  Y   +   M  +  HLTNY++NK + N+ R  D      +   S +N+       NT+ +W  I D+++KTL+   P L HNY  C         S  FEILGFD+LLD  L PWLLEVN SPSF  D  LDR+VK  LL DT  L+N+   +++K +  +K++ + RL              N + + R + E R+    ++          E +E++H+G F R++P +    Y+ Y      S +LF +      S    +  +Q LQ     + +EE      +  + E      K   P+ ++  +  P  N
Sbjct:   58 NLTNCKYESVRRAARKYG--LREAGEGEDWTLFWTDCSVSLDRVMDMKRYQKINHFPGMSEICRKDLLARNMNRMLKLFPKDYNIFPRTWCLPAD----YSDFQAYTRAKKHKMYICKPDSGCQGRGIFLTKSNKDIRPGEHMICQVYVSRPFIIDGFKFDLRVYVLVTSCDPFRIFVYNEGLARFCTNLYNEPTSSNMGDVCMHLTNYAINKHSENFVRDDD---TGSKRKLSTLNKHLEAMCYNTEKVWVDIEDVIIKTLISAHPILKHNYHTCFPNHASG--SACFEILGFDVLLDHRLKPWLLEVNHSPSFTTDSRLDREVKDGLLYDTLVLINLGACDRRKIMEEEKRRVKERLQ------------QNRSREARSE-ELRQSHATNM-------EQMERYESKHLGGFRRIYPREGGEKYEKY---FKHSSSLFQET---AASKAREECARQQLQEL---RLKEEQKGNHRRDLQGESAGERAK---PRKSQTHSTHPGTN 521          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008895.1 (pep scaffold:Pmarinus_7.0:GL476825:58484:82827:1 gene:ENSPMAG00000008053.1 transcript:ENSPMAT00000008895.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 122.865 bits (307), Expect = 3.386e-30
Identity = 105/340 (30.88%), Postives = 168/340 (49.41%), Query Frame = 3
Query:  318 TRFEIVKKILESVGFTLRDDEVFKTCY---LIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRP-KDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXXXL--MNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLN 1319
            T   +V+ IL S GF     EV  +     L+WT +      +  L  +Q++NHF    E++RKD L K   +MQ+    K +N  P T+L P E    Y+         +  + +   A+ + G G+ L +  + +  +E  +V  Y+  P L+D +K D R+YVL+T  +PL  ++Y EGL R +T KY   S   + + F HLTNYSVNKK+ +Y    D       +  S+  M R   +   +T AL  +I D++VKT++ V+  +  + RM             F ++G  +LL +    +LL ++ S +   D  LD KVK S++ D F L+ 
Sbjct:   72 TESRLVRNILGSHGF----HEVHPSSNDFNLMWTGTHPKPFSLRSLTDFQKVNHFPRSYELTRKDRLCKNVQRMQQSHGHKHFNIIPATFLLPAE----YQDFCSAHSKDRGPWIVKPVAS-SRGRGVYLVNSPNQVTMDENILVSRYLGNPLLIDDFKFDVRLYVLVTSYEPLVIYLYEEGLTRFATVKYDRNSKF-IKNQFMHLTNYSVNKKSRDYVSCDDPEVEDFGNKWSMSAMLRCLKQDGHDTTALMARIEDLIVKTILSVEQTIASSVRM-----FVPHRGNCFGMMGLGVLLYKRGRTFLLHLDLSLTLCSDAPLDLKVKASMVSDMFSLVG 396          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004193.1 (pep scaffold:Pmarinus_7.0:GL495833:1191:3921:-1 gene:ENSPMAG00000003831.1 transcript:ENSPMAT00000004193.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.0846 bits (157), Expect = 4.021e-13
Identity = 36/95 (37.89%), Postives = 49/95 (51.58%), Query Frame = 3
Query: 1038 INTDALWKQIIDIVVKTLVLVQP-------HLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVD 1301
            ++   +W+QI DI VKT++  +P         + N R C             E+ GFD++LDE L PWLLEVN SPS   +  LD  VK  L+ D
Sbjct:   14 VDCRTIWEQIKDIAVKTVIASEPFVSSLLAQFVGNRRSCH------------ELFGFDVMLDEKLKPWLLEVNISPSLHSNSPLDVAVKVQLIKD 96          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Sea Lamprey
Match: TTLL10 (tubulin tyrosine ligase like 10 [Source:HGNC Symbol;Acc:HGNC:26693])

HSP 1 Score: 66.6254 bits (161), Expect = 1.088e-11
Identity = 55/176 (31.25%), Postives = 84/176 (47.73%), Query Frame = 3
Query:  735 IVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXXXLMNRFKTKFNINTDALWKQIIDIVVKTLV-LVQPHLIHNYRMCRT---GQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSF 1250
            IVQ Y+  P LLDG K D R Y+LI    P    ++R G  RLS + Y+  S    + +  HLTN  + KK+  Y    +E+  +       M+RF    N +         D V+ T    +Q  + H +   ++   G+L  FD     ++G D L+DE+   WLLE+N +P+ 
Sbjct:  176 IVQRYVTNPLLLDGRKFDVRSYMLIASAAP-PIVLFRHGYARLSCQSYSPES----NDLTAHLTNQYMQKKSPVYQEVKEETVWT-------MSRFNDHVNEHCAPHKGLPKDWVLTTFTKRMQQVMTHCFLATKSKLEGKLGLFD-----LIGCDFLIDEDFKVWLLEMNCNPAL 334          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Sea Lamprey
Match: ttll3 (tubulin tyrosine ligase-like family, member 3 [Source:NCBI gene;Acc:724000])

HSP 1 Score: 62.7734 bits (151), Expect = 2.486e-10
Identity = 56/233 (24.03%), Postives = 101/233 (43.35%), Query Frame = 3
Query:  687 IRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNY-TRGVDEXXXXXXXXXXLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFG-----------------MDETLDRKVKGSLLVDTFRLLNIKPS 1331
            +RL   D  +  +   IVQ+Y+++P L+   K D R + L+T  +PL  + Y++  +R ST+ + + +   +D+   HL N S+ K   N   R       +       ++  ++   +     W+ ++   +K  ++       +    R G        SFE+ G D LL E+  PWLLE+N SP+                   +   LDR+V  S     F L++ +P+
Sbjct:  321 LRLVECDTALVKDGRWIVQKYVERPLLIHATKFDIRQWFLVTDWNPLTVWFYQDCYLRFSTQPFQLDN---LDTSI-HLCNNSIQKHFENAQGRSAQLPRDNIWHGRQFVSYLES---LGLGFAWEGVVVPGMKQAIIHALQAAQDVVDARRG--------SFELYGADFLLGEDQRPWLLEINSSPTMSPSTPVTAELCARVQDDLLRVVLDRRVDRSAHTGGFYLIHKQPA 538          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Sea Lamprey
Match: ttll3 (tubulin tyrosine ligase-like family, member 3 [Source:NCBI gene;Acc:724000])

HSP 1 Score: 62.3882 bits (150), Expect = 3.546e-10
Identity = 56/233 (24.03%), Postives = 101/233 (43.35%), Query Frame = 3
Query:  687 IRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNY-TRGVDEXXXXXXXXXXLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFG-----------------MDETLDRKVKGSLLVDTFRLLNIKPS 1331
            +RL   D  +  +   IVQ+Y+++P L+   K D R + L+T  +PL  + Y++  +R ST+ + + +   +D+   HL N S+ K   N   R       +       ++  ++   +     W+ ++   +K  ++       +    R G        SFE+ G D LL E+  PWLLE+N SP+                   +   LDR+V  S     F L++ +P+
Sbjct:  348 LRLVECDTALVKDGRWIVQKYVERPLLIHATKFDIRQWFLVTDWNPLTVWFYQDCYLRFSTQPFQLDN---LDTSI-HLCNNSIQKHFENAQGRSAQLPRDNIWHGRQFVSYLES---LGLGFAWEGVVVPGMKQAIIHALQAAQDVVDARRG--------SFELYGADFLLGEDQRPWLLEINSSPTMSPSTPVTAELCARVQDDLLRVVLDRRVDRSAHTGGFYLIHKQPA 565          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Nematostella
Match: EDO45410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT71])

HSP 1 Score: 421.779 bits (1083), Expect = 2.310e-137
Identity = 228/489 (46.63%), Postives = 320/489 (65.44%), Query Frame = 3
Query:  297 MTANVNGTRFEIVKKILESVGFTL-RDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXXXLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRKDIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDDKTVYDYYAELLVDSFTLFNQLNYQNCSTDSTQATQQMLQSFMPNQFREEDIMEQIKQCEAEEN 1760
            +TAN++ T+++IV+K     G  + RDD+   +C+ IW+DS +  ER  ELK YQRINHF GM EI RKD L +  +KM++  P +Y++ P+TW+ P E      Y +E KK  + K FI+KPANGAMG GI L    D I S+E  ++QEYID+P LLDGYK D R+YVL+T CDPLR F+Y +GLVRL TE Y   ++  MD +F HLTNYS+NK N N+ R  ++  GSK+S+  L N +    + + + LW+ I +++VKTL++ QPH++H+YRMCR G     DSV FE+LGFDILLD  L PWLLE+NRSPSFG D  LD++VKG  L DT RLLNIKPS++++ +  +K ++QRRL     RS+    + +E  KK+  + KR+ +L + L +++  S+RE FEN ++GNF RV+PPDD+   + Y  LL D+F LF          D  Q    +         REE+I++ ++QCEA+EN
Sbjct:    6 VTANISATKYDIVRKACVHAGMVVTRDDD--PSCFFIWSDSSVGAERFIELKPYQRINHFPGMGEICRKDSLARNIAKMKRAHPDEYSFAPQTWVLPAEYAAFQMYCRELKKKKRAKTFIMKPANGAMGNGISLIRNGDRIPSHEQLVIQEYIDRPFLLDGYKFDLRVYVLVTSCDPLRIFVYNDGLVRLGTECYEPPTEDNMDELFMHLTNYSINKHNENFERDENDDMGSKRSIKWL-NEWLQSMDYDVNFLWRGITEVIVKTLIVAQPHVLHSYRMCRPGAATGSDSVCFELLGFDILLDRKLKPWLLEINRSPSFGTDSKLDQEVKGGALRDTLRLLNIKPSDRRRGMAAEKAESQRRLLTQPKRSEYTMSV-SELDKKKMILNKRRNELKERLNQLRRESAREEFENINMGNFRRVYPPDDRAKNEKYTGLLADAFKLFLSGRAAALQKDGNQPFSTL---------REEEILDLLEQCEADEN 481          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Nematostella
Match: EDO34389 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPH2])

HSP 1 Score: 259.996 bits (663), Expect = 2.335e-77
Identity = 164/445 (36.85%), Postives = 246/445 (55.28%), Query Frame = 3
Query:  297 MTANVNGTRFEIVKKILESVGFTLRDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXXXLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRKDIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDDKTVYDYYAELLVDSFTLFNQ 1631
            ++  +   +++ V+++ +  G     +E      L W D  ++ ER  E+K YQ+INHF GM EI RKD L +  +++ K  PKDY  FPKTW+ P +    Y   +   +  K K FI KP +G+ G GI +      IK  E  + Q+Y+ KP L+DG+K D RIYVL+T CDPLR F+Y +GL R +T KY    +  +D I  HLTNYS+NK + ++ R  DE  GSK+ ++++ N F  +   +   +W  I D ++KTLV   P L HNYR C      N  S  FEILGFD+LLD+ L PW++EVN SPSF  D  LD+++K  L+ D   LLN    +++K +   K++ + RL L   R K EP        KR D E ++          Q +     +E++H+G + R++P  ++   + YA    +S +LF +
Sbjct:    2 LSVCLTNCKYDSVRRVTKRFGMKEVGEE--DDWSLFWIDCSVALERCMEMKRYQKINHFPGMSEICRKDLLARNMNRLWKQFPKDYAVFPKTWVLPAD----YGDFQSYCRQKKNKTFITKPESGSQGKGIVITKNPKDIKPGEHLVCQQYVSKPFLIDGFKFDLRIYVLVTSCDPLRVFVYEDGLARFATSKYTEPQNNNLDDICMHLTNYSINKHSKDFIR--DEEIGSKRRITTINNWF-VENGYDLKEIWDGIEDCIIKTLVTAHPILKHNYRTCFPN--HNKGSACFEILGFDVLLDKKLKPWVIEVNHSPSFTTDSPLDKEIKEGLMSDALALLNFGACDRRKIIEEDKRRVRERL-LQKQRPK-EP--------KRDDCENQQ----------QYNEWITKYEDKHLGKYRRIYPQGNE---EKYARFFENSCSLFQE 412          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Nematostella
Match: EDO40146 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7W3])

HSP 1 Score: 176.792 bits (447), Expect = 1.094e-47
Identity = 141/458 (30.79%), Postives = 219/458 (47.82%), Query Frame = 3
Query:  318 TRFEIVKKILESVGFTLRDDEVFKTCY-LIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRP-KDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDG---------YKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXXXL--MNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNI--------KPSNKQ--------KSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRKDIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDDKTVYDYYAELL 1604
            T  ++V+ IL S  F  R+     + + L+WT S +    +  ++ +Q+INHF    E++RKD L K   ++Q  +  K +++ P +++ P+E N  Y    + +     K         + G GI L S    +  ++  +V  YI  P L+DG         +K D R+YV +TC DPLR ++Y EGL R +T KY  +     +S   HLTNYSVNKK+ N+    D       +  S+  M RF     I+T AL  +I D+VVKT++  +  +    +M             FEI GFDIL+DENL PWLLEVN SPS   D  LD K+K  L+ D F L+          +P+  +        ++  +QKQ+ Q    L+   S + P        +RK +++ +  L     R+   +  EY      G F+R+FP  +   ++ Y   L
Sbjct:   15 TECKLVRSILNSHAF--REVHPNSSNFNLMWTGSHLKPHSLRGMQDFQKINHFPRSYELTRKDRLYKNIQRLQHSKGLKHFDFIPNSFVLPEEYNEFYAAFMKERGHWIVKP-----VASSRGRGIFLISHPSQVPLDDHLLVCRYITNPLLIDGNIYCFNFIGFKFDVRLYVGVTCYDPLRIYLYEEGLSRFATVKYDKSGKNIRNSCM-HLTNYSVNKKSENFVSCQDPEVEDYGNKWSMSAMLRFIKHKGIDTTALMMRIEDVVVKTIIAGELPIASACKM-----FMPHPGNCFEIYGFDILIDENLRPWLLEVNLSPSLACDSPLDLKIKSHLVTDMFNLIGFVAHDPLIRRPNGTRRVPDYAAARNKKYQKQRTQSAGALST--SGLRP---TSAAARRKAVDE-ELTLTPEESRILRQTKEEYARR---GGFVRIFPSSES--WELYGSFL 448          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Nematostella
Match: EDO38145 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDP2])

HSP 1 Score: 168.703 bits (426), Expect = 9.294e-45
Identity = 133/393 (33.84%), Postives = 199/393 (50.64%), Query Frame = 3
Query:  441 ELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPK-DYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSN-YTRGVDEXXXXXXXX---XXLMNRFKTKFNINTDALWKQIIDIVVKTLV----LVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKK------RKDIEKRKQDLIDLL----VRVQASSSREYFENRHVGNFLRVFP 1562
             ++ YQ++NHF G  +I RKD L +  SKM     K ++ + P+T++ P +  LL    +   +   ++ +ILKP   A G+GIR+  +   I    P IVQ+Y+ KP L++G K D RIYV +T  DPLR +I+ +GLVR +T KY+ +S   + + F HLTNYSVNKKN   Y    D+S           SL   FK +  IN   +W  + D++VK ++     V   +  N R           S   E+ G D++LDENL PWLLEVN SPS   +  LDR +KG ++ D   L+N+      ++L      +   L  +  + K    L ++   K      R   E+ +Q ++D+L    VR+   +  EY      G F R FP
Sbjct:   81 SIREYQKVNHFPGTFQIGRKDRLWRNLSKMMVHHGKKEFGFLPQTYVLPYDFKLL---KRAWDEGGSRQKWILKPPASARGIGIRVIHKWTQIPRKRPVIVQKYLHKPFLINGSKFDLRIYVYVTSYDPLRIYIFEDGLVRFATCKYS-SSVKSLSNRFMHLTNYSVNKKNEGAYQSNADDSLCQGHKWYYLKSLWGYFK-RMGINHAQVWDSVKDVIVKAIIASDSFVNTLIKQNVR---------HRSCCHELFGCDVMLDENLKPWLLEVNISPSLHSNSQLDRNIKGQMIRD---LMNLAAFRIPENLVTTTTASASSLN-SFVQDKSTTSLSSDERAKHAFYVGRNVDERTRQSILDILTPSDVRILMETEDEYSRR---GCFQRAFP 452          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Nematostella
Match: EDO42060 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2K6])

HSP 1 Score: 162.155 bits (409), Expect = 6.557e-44
Identity = 113/335 (33.73%), Postives = 173/335 (51.64%), Query Frame = 3
Query:  327 EIVKKILESVGFTLRDDEVF---KTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKD-YNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXXXLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLN 1319
            E+++ +    G+   D+E      T  L W  S        + + +QR+NHF     I+RKD L +   +M+ +     +N+ P ++  P +    +      KK   K  +I KPA+ + G GI LF     +  +  ++VQ YI  P L+ GYK D R+YVL+T   PL  ++Y EG+VR STEK+ +++   + ++F HLTN S+NK+  +Y+   +      +   S +  +  + NI    LW +I  I++ TL+   P +  +   C            FE+ GFDIL+DENL PWLLEVN SPS G D  +D  +K  LL DTF LLN
Sbjct:   14 ELLRDVCLERGWHEFDEEAVDPDATWSLWWKSSGFRTGEYEDCRPWQRLNHFPKTSAITRKDCLARNLRRMRGVYGNYLFNFAPLSFNLPNDYRK-FVAEYSKKKDATKNIWICKPADLSRGRGIFLFENLLDLTYDSAAVVQRYISSPLLICGYKFDLRLYVLVTSFHPLCIYVYHEGMVRFSTEKFDLST---LSNLFSHLTNSSINKQGPSYSLDKERIGTGCKWTLSQLRAYFHQHNIGDGMLWHRINTIIILTLLTQAPEVSKSCTNC------------FELYGFDILIDENLKPWLLEVNFSPSLGSDCLVDLTIKKPLLNDTFELLN 332          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Medaka
Match: ttll7 (tubulin tyrosine ligase like 7 [Source:NCBI gene;Acc:101160724])

HSP 1 Score: 382.489 bits (981), Expect = 8.712e-118
Identity = 219/498 (43.98%), Postives = 317/498 (63.65%), Query Frame = 3
Query:  297 MTANVNGTRFEIVKKILESVGFT-LRDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXX-XLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRKDIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDDKTVYDYYAELLVDSFTLFNQLNYQNCSTDSTQATQQMLQSFMPN---QFREEDIMEQIKQCEAEENALLEK 1775
            ++ANV GT++EIV+ ++  + F   RDD+  +T  LIW DS +  E+I EL++YQRINHF GM EI RKD L +  SKM K +P++Y++ PKTW+FP E   L  Y+KE ++  K+K FI+KP+NGAMG GI L    + + + E  IVQEY+DKP L++GYK D RIY+L+T CDPLR F+Y +GLVR+ TEKY   S+  +  ++ HLTNYSVNK N N+ R  DE+       S S   +F    + +    W  I ++VVKTL++ +PH++H YRMCR GQ    DSV FE+LGFDI+LD  L PWLLE+NR+PSF  D+ +D  VK   L++  +LLNI+ S+K+++L  QK +AQRRL       K+ P   ++  K+R  +E+R+++L + L +V+   SRE  E +H+GN+ R++PPDDK + + Y  LL  +F  F                   LQ  M N   + +EEDI++ ++QCE ++  L+ K
Sbjct:   41 ISANVAGTKYEIVRIVINEMDFIKARDDD--ETANLIWNDSAVQHEKIAELRNYQRINHFPGMGEICRKDCLARNMSKMIKCQPQEYSFIPKTWIFPAEYTQLQNYVKELRRKRKQKTFIVKPSNGAMGHGIWLIRNCEKLPAQEHFIVQEYLDKPFLMEGYKFDLRIYILVTSCDPLRIFLYNDGLVRMGTEKYHAPSEANLSQLYMHLTNYSVNKHNENFER--DETVDKGSKRSISWFTQFLRCNDYDVAKFWGDISELVVKTLIVAEPHVLHAYRMCRPGQPPGSDSVCFEVLGFDIILDHKLKPWLLEINRAPSFATDQKIDYDVKKGALLNALKLLNIRASDKKRNLAQQKAEAQRRLYGHGSMKKL-PAASSDWEKQRHTLERRREELKEQLAQVRKQFSREQHEKQHLGNYRRIYPPDDKLLLEKYESLLSAAFQTF------------LAGRAASLQKEMNNPLKRMKEEDILDLLEQCELDDEKLMGK 521          

HSP 2 Score: 89.3521 bits (220), Expect = 1.027e-17
Identity = 39/104 (37.50%), Postives = 67/104 (64.42%), Query Frame = 3
Query: 2373 IRYPGQTDVETKSMLAKIFSNWEHQRHSVATYWLATLNAKKRDKIIQIVRNNVDKIINDNFKFSADISAARVNRLISKVYNRLLWNRGNGLIQCFSHFKSWQLI 2684
            IR+PG+T+ E +++L +I  NW++ +  VA+YWL  L++ K+ K++ IVR NV   +   ++   D+ +  + RL ++V+NRLLW+ G GL  CFS+   W  +
Sbjct:  731 IRFPGKTEEEAEAVLDEILDNWKYHKPKVASYWLVKLDSTKQRKVLDIVRTNVRLALQRIWR-EPDVESLHLYRLFNRVFNRLLWSHGQGLWNCFSNTGYWNAV 833          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Medaka
Match: ttll7 (tubulin tyrosine ligase like 7 [Source:NCBI gene;Acc:101160724])

HSP 1 Score: 382.104 bits (980), Expect = 3.785e-117
Identity = 219/498 (43.98%), Postives = 317/498 (63.65%), Query Frame = 3
Query:  297 MTANVNGTRFEIVKKILESVGFT-LRDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXX-XLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRKDIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDDKTVYDYYAELLVDSFTLFNQLNYQNCSTDSTQATQQMLQSFMPN---QFREEDIMEQIKQCEAEENALLEK 1775
            ++ANV GT++EIV+ ++  + F   RDD+  +T  LIW DS +  E+I EL++YQRINHF GM EI RKD L +  SKM K +P++Y++ PKTW+FP E   L  Y+KE ++  K+K FI+KP+NGAMG GI L    + + + E  IVQEY+DKP L++GYK D RIY+L+T CDPLR F+Y +GLVR+ TEKY   S+  +  ++ HLTNYSVNK N N+ R  DE+       S S   +F    + +    W  I ++VVKTL++ +PH++H YRMCR GQ    DSV FE+LGFDI+LD  L PWLLE+NR+PSF  D+ +D  VK   L++  +LLNI+ S+K+++L  QK +AQRRL       K+ P   ++  K+R  +E+R+++L + L +V+   SRE  E +H+GN+ R++PPDDK + + Y  LL  +F  F                   LQ  M N   + +EEDI++ ++QCE ++  L+ K
Sbjct:   41 ISANVAGTKYEIVRIVINEMDFIKARDDD--ETANLIWNDSAVQHEKIAELRNYQRINHFPGMGEICRKDCLARNMSKMIKCQPQEYSFIPKTWIFPAEYTQLQNYVKELRRKRKQKTFIVKPSNGAMGHGIWLIRNCEKLPAQEHFIVQEYLDKPFLMEGYKFDLRIYILVTSCDPLRIFLYNDGLVRMGTEKYHAPSEANLSQLYMHLTNYSVNKHNENFER--DETVDKGSKRSISWFTQFLRCNDYDVAKFWGDISELVVKTLIVAEPHVLHAYRMCRPGQPPGSDSVCFEVLGFDIILDHKLKPWLLEINRAPSFATDQKIDYDVKKGALLNALKLLNIRASDKKRNLAQQKAEAQRRLYGHGSMKKL-PAASSDWEKQRHTLERRREELKEQLAQVRKQFSREQHEKQHLGNYRRIYPPDDKLLLEKYESLLSAAFQTF------------LAGRAASLQKEMNNPLKRMKEEDILDLLEQCELDDEKLMGK 521          

HSP 2 Score: 130.954 bits (328), Expect = 1.295e-30
Identity = 62/146 (42.47%), Postives = 98/146 (67.12%), Query Frame = 3
Query: 2373 IRYPGQTDVETKSMLAKIFSNWEHQRHSVATYWLATLNAKKRDKIIQIVRNNVDKIINDNFKFSADISAARVNRLISKVYNRLLWNRGNGLIQCFSH-FKSWQLIFSHSGDLIKPLELDICSRVVQLCLDCVLIVYQFSISLSQSS 2807
            IR+PG+T+ E +++L +I  NW++ +  VA+YWL  L++ K+ K++ IVR NV   +   ++   D+ +  + RL ++V+NRLLW+ G GL  CFS+   SW+ IFS S ++  P EL  C R+VQLC DC+L+VY+F +S S+ S
Sbjct:  731 IRFPGKTEEEAEAVLDEILDNWKYHKPKVASYWLVKLDSTKQRKVLDIVRTNVRLALQRIWR-EPDVESLHLYRLFNRVFNRLLWSHGQGLWNCFSNTGSSWETIFSKSSEVASPQELQCCRRLVQLCRDCLLVVYKF-VSESRGS 874          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Medaka
Match: ttll7 (tubulin tyrosine ligase like 7 [Source:NCBI gene;Acc:101160724])

HSP 1 Score: 382.489 bits (981), Expect = 8.137e-117
Identity = 219/498 (43.98%), Postives = 317/498 (63.65%), Query Frame = 3
Query:  297 MTANVNGTRFEIVKKILESVGFT-LRDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXX-XLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRKDIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDDKTVYDYYAELLVDSFTLFNQLNYQNCSTDSTQATQQMLQSFMPN---QFREEDIMEQIKQCEAEENALLEK 1775
            ++ANV GT++EIV+ ++  + F   RDD+  +T  LIW DS +  E+I EL++YQRINHF GM EI RKD L +  SKM K +P++Y++ PKTW+FP E   L  Y+KE ++  K+K FI+KP+NGAMG GI L    + + + E  IVQEY+DKP L++GYK D RIY+L+T CDPLR F+Y +GLVR+ TEKY   S+  +  ++ HLTNYSVNK N N+ R  DE+       S S   +F    + +    W  I ++VVKTL++ +PH++H YRMCR GQ    DSV FE+LGFDI+LD  L PWLLE+NR+PSF  D+ +D  VK   L++  +LLNI+ S+K+++L  QK +AQRRL       K+ P   ++  K+R  +E+R+++L + L +V+   SRE  E +H+GN+ R++PPDDK + + Y  LL  +F  F                   LQ  M N   + +EEDI++ ++QCE ++  L+ K
Sbjct:   41 ISANVAGTKYEIVRIVINEMDFIKARDDD--ETANLIWNDSAVQHEKIAELRNYQRINHFPGMGEICRKDCLARNMSKMIKCQPQEYSFIPKTWIFPAEYTQLQNYVKELRRKRKQKTFIVKPSNGAMGHGIWLIRNCEKLPAQEHFIVQEYLDKPFLMEGYKFDLRIYILVTSCDPLRIFLYNDGLVRMGTEKYHAPSEANLSQLYMHLTNYSVNKHNENFER--DETVDKGSKRSISWFTQFLRCNDYDVAKFWGDISELVVKTLIVAEPHVLHAYRMCRPGQPPGSDSVCFEVLGFDIILDHKLKPWLLEINRAPSFATDQKIDYDVKKGALLNALKLLNIRASDKKRNLAQQKAEAQRRLYGHGSMKKL-PAASSDWEKQRHTLERRREELKEQLAQVRKQFSREQHEKQHLGNYRRIYPPDDKLLLEKYESLLSAAFQTF------------LAGRAASLQKEMNNPLKRMKEEDILDLLEQCELDDEKLMGK 521          

HSP 2 Score: 131.339 bits (329), Expect = 1.302e-30
Identity = 62/146 (42.47%), Postives = 98/146 (67.12%), Query Frame = 3
Query: 2373 IRYPGQTDVETKSMLAKIFSNWEHQRHSVATYWLATLNAKKRDKIIQIVRNNVDKIINDNFKFSADISAARVNRLISKVYNRLLWNRGNGLIQCFSH-FKSWQLIFSHSGDLIKPLELDICSRVVQLCLDCVLIVYQFSISLSQSS 2807
            IR+PG+T+ E +++L +I  NW++ +  VA+YWL  L++ K+ K++ IVR NV   +   ++   D+ +  + RL ++V+NRLLW+ G GL  CFS+   SW+ IFS S ++  P EL  C R+VQLC DC+L+VY+F +S S+ S
Sbjct:  731 IRFPGKTEEEAEAVLDEILDNWKYHKPKVASYWLVKLDSTKQRKVLDIVRTNVRLALQRIWR-EPDVESLHLYRLFNRVFNRLLWSHGQGLWNCFSNTGSSWETIFSKSSEVASPQELQCCRRLVQLCRDCLLVVYKF-VSESRGS 874          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Medaka
Match: ttll6 (tubulin tyrosine ligase like 6 [Source:NCBI gene;Acc:101164261])

HSP 1 Score: 274.248 bits (700), Expect = 9.567e-79
Identity = 167/440 (37.95%), Postives = 232/440 (52.73%), Query Frame = 3
Query:  399 LIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXXXLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRKDIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDDKTVYDYYAELLVDSFTLFNQLNYQNCSTDSTQATQQMLQSFMPNQFREE 1718
            L+WTD  +S +R+ ++K YQ+INHF GM EI RKD L +  ++M KL PKDYN FPKTW  P +    Y   +   +  K K +I KP  G  G GI +      I+  E  I Q YI KP ++DGYK D RIYVL+T CDP   F++REGL R  T KY   +   ++ +  HLTNYS+NK + N+ R  D      +   S +NR     N NT+ +W+ I DI++KTL+   P L HNY  C         S  FEILGFD+LLD  L PW+LEVN SPSF  D  LDR+VK +LL DT  L+N+   ++ K    ++++A+ RL               +T  K    E R Q+L             E +E +++G F +++P  +   YD Y      S +LF +      S    +  +Q LQ     Q ++E
Sbjct:   84 LLWTDCSVSLDRVKDMKCYQKINHFPGMNEICRKDSLARNLNRMLKLFPKDYNIFPKTWCLPAD----YSDFQVYTRAKKSKTYICKPDTGCQGKGIFITKSSKDIQHEEHMICQVYISKPLIIDGYKFDLRIYVLVTSCDPFSIFMFREGLARFCTSKYNEPTRTNVEHVCMHLTNYSINKNSENFVRDED---TGSKRKLSTLNRHLESLNCNTEKMWEDIEDIIIKTLISAHPILKHNYHTCFPNHTAG--SACFEILGFDVLLDHRLKPWVLEVNHSPSFTTDSQLDREVKDALLYDTLVLINLAACDRHKITKEERRRAKDRL--------------QQTCSK----EARAQELRQ--SHAVTVEQMEEYEAKNLGGFKKIYPRKEGEKYDKY---FKHSRSLFQETTA---SKAREECARQQLQDLQVKQEQKE 488          
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Medaka
Match: ttll6 (tubulin tyrosine ligase like 6 [Source:NCBI gene;Acc:101164261])

HSP 1 Score: 267.7 bits (683), Expect = 2.690e-76
Identity = 170/465 (36.56%), Postives = 235/465 (50.54%), Query Frame = 3
Query:  399 LIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQES-------------NLL------------YXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXXXLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRKDIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDDKTVYDYYAELLVDSFTLFNQLNYQNCSTDSTQATQQMLQSFMPNQFREE 1718
            L+WTD  +S +R+ ++K YQ+INHF GM EI RKD L +  ++M KL PKDYN FPKTW  P ES             N +            Y   +   +  K K +I KP  G  G GI +      I+  E  I Q YI KP ++DGYK D RIYVL+T CDP   F++REGL R  T KY   +   ++ +  HLTNYS+NK + N+ R  D      +   S +NR     N NT+ +W+ I DI++KTL+   P L HNY  C         S  FEILGFD+LLD  L PW+LEVN SPSF  D  LDR+VK +LL DT  L+N+   ++ K    ++++A+ RL               +T  K    E R Q+L             E +E +++G F +++P  +   YD Y      S +LF +      S    +  +Q LQ     Q ++E
Sbjct:   84 LLWTDCSVSLDRVKDMKCYQKINHFPGMNEICRKDSLARNLNRMLKLFPKDYNIFPKTWCLPAESVSTLFEFRPFSYINFILFLICCPILLHSYSDFQVYTRAKKSKTYICKPDTGCQGKGIFITKSSKDIQHEEHMICQVYISKPLIIDGYKFDLRIYVLVTSCDPFSIFMFREGLARFCTSKYNEPTRTNVEHVCMHLTNYSINKNSENFVRDED---TGSKRKLSTLNRHLESLNCNTEKMWEDIEDIIIKTLISAHPILKHNYHTCFPNHTAG--SACFEILGFDVLLDHRLKPWVLEVNHSPSFTTDSQLDREVKDALLYDTLVLINLAACDRHKITKEERRRAKDRL--------------QQTCSK----EARAQELRQ--SHAVTVEQMEEYEAKNLGGFKKIYPRKEGEKYDKY---FKHSRSLFQETTA---SKAREECARQQLQDLQVKQEQKE 517          
BLAST of Tubulin polyglutamylase TTLL7 vs. Planmine SMEST
Match: SMESG000055128.1 (SMESG000055128.1)

HSP 1 Score: 1622.83 bits (4201), Expect = 0.000e+0
Identity = 931/936 (99.47%), Postives = 933/936 (99.68%), Query Frame = 3
Query:   99 MLSNNYHPNLQPRQGQNGIGNLEHDHIVSYLNHSKRLNGVPISEKDXXXXXXXXXXXXXXXXXXHQMTANVNGTRFEIVKKILESVGFTLRDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXXXLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRKDIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDDKTVYDYYAELLVDSFTLFNQLNYQNCSTDSTQATQQMLQSFMPNQFREEDIMEQIKQCEAEENALLEKWKLPQNAELTTIIPSVNYYXXXXXXXXXXXXXXXXXXXXXXXXXXIIGEYESYSANKKPTNIQLNNTXXXXXXXXXXXXXXFRPKSVLXXXXXXXXXXXXXEHTLKYSDLNKAKPFKKTKLPNKALKSKESSRVHXXXXXXXXXXXXXKDFNKTDEEVPSKYDLCYLSDSPAPLKDNFSRSPIYEEXXXXXXXXXXXXXIRYPGQTDVETKSMLAKIFSNWEHQRHSVATYWLATLNAKKRDKIIQIVRNNVDKIINDNFKFSADISAARVNRLISKVYNRLLWNRGNGLIQCFSHFKSWQLIFSHSGDLIKPLELDICSRVVQLCLDCVLIVYQFSISLSQSSTPRSDKSFASQSVISDYKESDLTSSFSVNSVTA 2906
            MLSNNYHPNLQPRQGQNGIGNLEHDHIVSYLNHSKRLNGVPISEKDRAEREKRIQKKKAKKRQKHQMTANVNGTRFEIVKKILESVGFTLRDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYKYIKETKKPTKKKYFILKPANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDESSGSKQSLSSLMNRFKTKFNINTDALWKQIIDIVVKTL+LVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRKDIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDDKTVYDYYAELLVDSFTLFNQLNYQNCSTDSTQATQQMLQSFMPNQFREEDIMEQIKQCEAEENALLEKWKLPQNAELTTIIPSVN+YETSSEEDTTSSNESASDSDANNLSDDIIGEYESYSANKKPTNIQLNNTNRKNANSKPINNNNFRPK VLRPSTSTPRPNSNSEHTLKYSDLNKAKP KKTKLPNKALKSKESSRVHSPFSQSSQISSRSKDFNKTDEEVPSKYD CYLSDSPAPLKDNFSRSPIYEELLKILLTSLTTLTIRYPGQTDVETKSMLAKIFSNWEHQRHSVATYWLATLNAKKRDKIIQIVRNNVDKIINDNFKFSADISAARVNRLISKVYNRLLWNRGNGLIQCFSHFKSWQLIFSHSGDLIKPLELDICSRVVQLCLDCVLIVYQFSISLSQSSTPRSDKSFASQSVISDYKESDLTSSFSVNSVTA
Sbjct:    1 MLSNNYHPNLQPRQGQNGIGNLEHDHIVSYLNHSKRLNGVPISEKDRAEREKRIQKKKAKKRQKHQMTANVNGTRFEIVKKILESVGFTLRDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYKYIKETKKPTKKKYFILKPANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDESSGSKQSLSSLMNRFKTKFNINTDALWKQIIDIVVKTLILVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRKDIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDDKTVYDYYAELLVDSFTLFNQLNYQNCSTDSTQATQQMLQSFMPNQFREEDIMEQIKQCEAEENALLEKWKLPQNAELTTIIPSVNFYETSSEEDTTSSNESASDSDANNLSDDIIGEYESYSANKKPTNIQLNNTNRKNANSKPINNNNFRPKFVLRPSTSTPRPNSNSEHTLKYSDLNKAKPVKKTKLPNKALKSKESSRVHSPFSQSSQISSRSKDFNKTDEEVPSKYDGCYLSDSPAPLKDNFSRSPIYEELLKILLTSLTTLTIRYPGQTDVETKSMLAKIFSNWEHQRHSVATYWLATLNAKKRDKIIQIVRNNVDKIINDNFKFSADISAARVNRLISKVYNRLLWNRGNGLIQCFSHFKSWQLIFSHSGDLIKPLELDICSRVVQLCLDCVLIVYQFSISLSQSSTPRSDKSFASQSVISDYKESDLTSSFSVNSVTA 936          
BLAST of Tubulin polyglutamylase TTLL7 vs. Planmine SMEST
Match: SMESG000055128.1 (SMESG000055128.1)

HSP 1 Score: 1021.15 bits (2639), Expect = 0.000e+0
Identity = 589/593 (99.33%), Postives = 590/593 (99.49%), Query Frame = 3
Query: 1128 MCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRKDIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDDKTVYDYYAELLVDSFTLFNQLNYQNCSTDSTQATQQMLQSFMPNQFREEDIMEQIKQCEAEENALLEKWKLPQNAELTTIIPSVNYYXXXXXXXXXXXXXXXXXXXXXXXXXXIIGEYESYSANKKPTNIQLNNTXXXXXXXXXXXXXXFRPKSVLXXXXXXXXXXXXXEHTLKYSDLNKAKPFKKTKLPNKALKSKESSRVHXXXXXXXXXXXXXKDFNKTDEEVPSKYDLCYLSDSPAPLKDNFSRSPIYEEXXXXXXXXXXXXXIRYPGQTDVETKSMLAKIFSNWEHQRHSVATYWLATLNAKKRDKIIQIVRNNVDKIINDNFKFSADISAARVNRLISKVYNRLLWNRGNGLIQCFSHFKSWQLIFSHSGDLIKPLELDICSRVVQLCLDCVLIVYQFSISLSQSSTPRSDKSFASQSVISDYKESDLTSSFSVNSVTA 2906
            MCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRKDIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDDKTVYDYYAELLVDSFTLFNQLNYQNCSTDSTQATQQMLQSFMPNQFREEDIMEQIKQCEAEENALLEKWKLPQNAELTTIIPSVN+YETSSEEDTTSSNESASDSDANNLSDDIIGEYESYSANKKPTNIQLNNTNRKNANSKPINNNNFRPK VLRPSTSTPRPNSNSEHTLKYSDLNKAKP KKTKLPNKALKSKESSRVHSPFSQSSQISSRSKDFNKTDEEVPSKYD CYLSDSPAPLKDNFSRSPIYEELLKILLTSLTTLTIRYPGQTDVETKSMLAKIFSNWEHQRHSVATYWLATLNAKKRDKIIQIVRNNVDKIINDNFKFSADISAARVNRLISKVYNRLLWNRGNGLIQCFSHFKSWQLIFSHSGDLIKPLELDICSRVVQLCLDCVLIVYQFSISLSQSSTPRSDKSFASQSVISDYKESDLTSSFSVNSVTA
Sbjct:    1 MCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRKDIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDDKTVYDYYAELLVDSFTLFNQLNYQNCSTDSTQATQQMLQSFMPNQFREEDIMEQIKQCEAEENALLEKWKLPQNAELTTIIPSVNFYETSSEEDTTSSNESASDSDANNLSDDIIGEYESYSANKKPTNIQLNNTNRKNANSKPINNNNFRPKFVLRPSTSTPRPNSNSEHTLKYSDLNKAKPVKKTKLPNKALKSKESSRVHSPFSQSSQISSRSKDFNKTDEEVPSKYDGCYLSDSPAPLKDNFSRSPIYEELLKILLTSLTTLTIRYPGQTDVETKSMLAKIFSNWEHQRHSVATYWLATLNAKKRDKIIQIVRNNVDKIINDNFKFSADISAARVNRLISKVYNRLLWNRGNGLIQCFSHFKSWQLIFSHSGDLIKPLELDICSRVVQLCLDCVLIVYQFSISLSQSSTPRSDKSFASQSVISDYKESDLTSSFSVNSVTA 593          
BLAST of Tubulin polyglutamylase TTLL7 vs. Planmine SMEST
Match: SMESG000055128.1 (SMESG000055128.1)

HSP 1 Score: 381.333 bits (978), Expect = 1.076e-125
Identity = 225/225 (100.00%), Postives = 225/225 (100.00%), Query Frame = 3
Query:   99 MLSNNYHPNLQPRQGQNGIGNLEHDHIVSYLNHSKRLNGVPISEKDXXXXXXXXXXXXXXXXXXHQMTANVNGTRFEIVKKILESVGFTLRDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLD 773
            MLSNNYHPNLQPRQGQNGIGNLEHDHIVSYLNHSKRLNGVPISEKDRAEREKRIQKKKAKKRQKHQMTANVNGTRFEIVKKILESVGFTLRDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYKYIKETKKPTKKKYFILKPANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLD
Sbjct:    1 MLSNNYHPNLQPRQGQNGIGNLEHDHIVSYLNHSKRLNGVPISEKDRAEREKRIQKKKAKKRQKHQMTANVNGTRFEIVKKILESVGFTLRDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYKYIKETKKPTKKKYFILKPANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLD 225          
BLAST of Tubulin polyglutamylase TTLL7 vs. Planmine SMEST
Match: SMESG000075764.1 (SMESG000075764.1)

HSP 1 Score: 263.077 bits (671), Expect = 9.134e-74
Identity = 156/431 (36.19%), Postives = 244/431 (56.61%), Query Frame = 3
Query:  300 TANVNGTRFEIVKKILESVGFTLRDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPKDYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXXXXXXLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRKDIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDDKTVYDYY 1592
            T  ++  ++E V+++ +  GF   ++E      LIWTD  ++ ER+  +K YQ+INH+ GM+EI RKD L +  ++M KL  K+YN  PK+W  P +    Y  ++   +  K K +ILKP  G  G GI +      IK +E  + Q Y+ KP L+DG+K D RIYVL+T CDPLR F Y++GLVR +T KY+  +   +D+I+ HLTNYS+ K + N+ +  D+  G  +   + +NR+      N + +W  + DI++KTL+     L HNYR C    ++   S  FEILGFD++ D  L P L+EVN SPSF  D  LD+++K +L+ DT +L+N   ++K++ +  +K+K + RL     R  I+  +D E  K                + +Q     E +E+ H+GNF R++P    + YD +
Sbjct:  121 TICLSNCKYESVRRVSKRFGFREVNEE--DDWNLIWTDFSVNMERVNGMKKYQKINHYPGMLEICRKDSLARNMNRMVKLFGKEYNIAPKSWCLPAD----YAELQAYARQKKHKTYILKPDAGCQGRGIWITKNPKEIKPSENMVCQVYLSKPFLIDGFKFDLRIYVLVTSCDPLRVFAYKDGLVRFTTTKYSEPNFNNVDNIYMHLTNYSLQKHSDNFVQ--DDEEGGTKRRITTLNRWFHDKGYNIEKIWTDVDDIIIKTLISAHTLLKHNYRTCFPNHVRG--SACFEILGFDVIFDRKLKPSLVEVNHSPSFHTDSKLDKEIKEALIWDTLQLVNFAAADKKRIIDEEKRKIRERLFQKQNRKDIKDEVDKEMAK---------------FMEIQ-----EKYEDGHLGNFRRIYPGPGSSKYDKF 521          
BLAST of Tubulin polyglutamylase TTLL7 vs. Planmine SMEST
Match: SMESG000073336.1 (SMESG000073336.1)

HSP 1 Score: 197.978 bits (502), Expect = 3.460e-52
Identity = 119/333 (35.74%), Postives = 189/333 (56.76%), Query Frame = 3
Query:  330 IVKKILESVGFTLRDDEVFKTCYLIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPK--DYNYFPKTWLFPQESNLLYXXXXXXXXXXXXXXXXXXXANGAMGMGIRLFSEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYREGLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDEXXXXXX--XXXXLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQLQNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLVDTFRLL 1316
            +VK+ ++  GF L +    K  ++ +  S +       +  +Q+INH  G  +I RKD L +  + +   + K  ++N+ PKT+  P +  LL +   + +   K K+ +  PA  A G+G+R+ S+   +     +++Q YI +P L++  K D RIYV IT CDPLR ++YREGLVR ++ KY+ +S   + + F HLTNYSVNKKNS+Y    D +       +L +L   F+    I+   +WK I D ++KT++ V+ H+  N +M  T +     +  +E+ GFD+LLD NL PW+LEVN SPS   +  LD +VK SL+ D F L+
Sbjct:  361 VVKRAVKRSGFKLTNKSGVK--WIGYFGSHLKSSGFRTINEHQKINHMPGSFQIGRKDRLWRNVTALSSKKSKIHEFNFLPKTYCLPADLKLLKRIWDDEESRKKAKWILKPPA-AARGIGVRVISKWSQVPKKRAALIQNYISRPFLINDSKFDLRIYVAITSCDPLRIYVYREGLVRFASHKYSKSSK-NISNRFIHLTNYSVNKKNSDYLNNEDHNKCQGHKWTLQTLWRHFEQDLRIDWIPIWKNIKDCIIKTIISVESHINSNIKMFCTNK-----NCVYELFGFDVLLDHNLKPWVLEVNVSPSLHSNSPLDIEVKSSLIADLFNLV 684          
The following BLAST results are available for this feature:
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TTLL72.506e-12745.23tubulin tyrosine ligase like 7 [Source:HGNC Symbol... [more]
TTLL71.888e-12645.23tubulin tyrosine ligase like 7 [Source:HGNC Symbol... [more]
TTLL71.702e-12345.23tubulin tyrosine ligase like 7 [Source:HGNC Symbol... [more]
TTLL72.906e-9643.51tubulin tyrosine ligase like 7 [Source:HGNC Symbol... [more]
TTLL66.909e-7741.78tubulin tyrosine ligase like 6 [Source:HGNC Symbol... [more]
back to top
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttll-115.723e-3633.33Tubulin Tyrosine Ligase Like [Source:UniProtKB/Tr... [more]
ttll-111.106e-3533.33Tubulin Tyrosine Ligase Like [Source:UniProtKB/Tr... [more]
ttll-51.100e-3329.87Tubulin Tyrosine Ligase Like [Source:UniProtKB/Tr... [more]
ttll-51.794e-3330.19Tubulin Tyrosine Ligase Like [Source:UniProtKB/Tr... [more]
ttll-91.621e-3033.77Tubulin Tyrosine Ligase Like [Source:UniProtKB/Tr... [more]
back to top
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TTLL6B3.093e-7836.49gene:FBgn0039501 transcript:FBtr0085180[more]
TTLL6A4.519e-6832.19gene:FBgn0034459 transcript:FBtr0300829[more]
TTLL57.855e-4635.10gene:FBgn0051108 transcript:FBtr0084802[more]
TTLL57.855e-4635.10gene:FBgn0051108 transcript:FBtr0339247[more]
TTLL4A1.485e-4035.35gene:FBgn0026147 transcript:FBtr0304950[more]
back to top
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttll71.643e-10945.86tubulin tyrosine ligase-like family, member 7 [Sou... [more]
ttll73.547e-10942.61tubulin tyrosine ligase-like family, member 7 [Sou... [more]
ttll73.618e-10942.61tubulin tyrosine ligase-like family, member 7 [Sou... [more]
ttll63.946e-7836.34tubulin tyrosine ligase-like family, member 6 [Sou... [more]
ttll63.946e-7836.34tubulin tyrosine ligase-like family, member 6 [Sou... [more]
back to top
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trub26.144e-12243.44TruB pseudouridine (psi) synthase family member 2 ... [more]
trub21.246e-11943.44TruB pseudouridine (psi) synthase family member 2 ... [more]
trub22.009e-11843.14TruB pseudouridine (psi) synthase family member 2 ... [more]
trub23.914e-11843.49TruB pseudouridine (psi) synthase family member 2 ... [more]
ENSXETT00000044160.11.948e-7938.63tubulin tyrosine ligase like 13, pseudogene [Sourc... [more]
back to top
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ttll71.031e-12344.05tubulin tyrosine ligase-like family, member 7 [Sou... [more]
Ttll71.047e-12344.05tubulin tyrosine ligase-like family, member 7 [Sou... [more]
Ttll71.986e-12344.05tubulin tyrosine ligase-like family, member 7 [Sou... [more]
Ttll61.672e-7541.23tubulin tyrosine ligase-like family, member 6 [Sou... [more]
Ttll138.063e-7435.25tubulin tyrosine ligase-like family, member 13 [So... [more]
back to top
BLAST of Tubulin polyglutamylase TTLL7 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|F7E540|TTLL7_XENTR5.810e-12344.03Tubulin polyglutamylase TTLL7 OS=Xenopus tropicali... [more]
sp|Q6ZT98|TTLL7_HUMAN8.172e-12345.23Tubulin polyglutamylase TTLL7 OS=Homo sapiens OX=9... [more]
sp|A4Q9F0|TTLL7_MOUSE1.291e-12244.05Tubulin polyglutamylase TTLL7 OS=Mus musculus OX=1... [more]
sp|Q8N841|TTLL6_HUMAN1.617e-7641.78Tubulin polyglutamylase TTLL6 OS=Homo sapiens OX=9... [more]
sp|A8CVX7|TTLL6_DANRE5.105e-7636.08Tubulin polyglutamylase ttll6 OS=Danio rerio OX=79... [more]
back to top
BLAST of Tubulin polyglutamylase TTLL7 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7UAZ05.287e-13747.24Uncharacterized protein OS=Capitella teleta OX=283... [more]
K1S3M04.233e-13447.05Tubulin polyglutamylase TTLL7 OS=Crassostrea gigas... [more]
A7RT711.601e-13346.63Predicted protein (Fragment) OS=Nematostella vecte... [more]
A0A1S3II965.991e-13348.78tubulin polyglutamylase TTLL7 isoform X2 OS=Lingul... [more]
A0A1S3II054.792e-13148.17tubulin polyglutamylase TTLL7 isoform X1 OS=Lingul... [more]
back to top
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttll71.562e-12243.46tubulin tyrosine ligase like 7 [Source:NCBI gene;A... [more]
ttll78.123e-12243.66tubulin tyrosine ligase like 7 [Source:NCBI gene;A... [more]
ttll79.895e-12243.66tubulin tyrosine ligase like 7 [Source:NCBI gene;A... [more]
ttll71.332e-12143.66tubulin tyrosine ligase like 7 [Source:NCBI gene;A... [more]
ttll65.179e-7833.73tubulin tyrosine ligase like 6 [Source:NCBI gene;A... [more]
back to top
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008895.13.386e-3030.88pep scaffold:Pmarinus_7.0:GL476825:58484:82827:1 g... [more]
ENSPMAT00000004193.14.021e-1337.89pep scaffold:Pmarinus_7.0:GL495833:1191:3921:-1 ge... [more]
TTLL101.088e-1131.25tubulin tyrosine ligase like 10 [Source:HGNC Symbo... [more]
ttll32.486e-1024.03tubulin tyrosine ligase-like family, member 3 [Sou... [more]
ttll33.546e-1024.03tubulin tyrosine ligase-like family, member 3 [Sou... [more]
back to top
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO454102.310e-13746.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343892.335e-7736.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO401461.094e-4730.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO381459.294e-4533.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420606.557e-4433.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tubulin polyglutamylase TTLL7 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttll78.712e-11843.98tubulin tyrosine ligase like 7 [Source:NCBI gene;A... [more]
ttll73.785e-11743.98tubulin tyrosine ligase like 7 [Source:NCBI gene;A... [more]
ttll78.137e-11743.98tubulin tyrosine ligase like 7 [Source:NCBI gene;A... [more]
ttll69.567e-7937.95tubulin tyrosine ligase like 6 [Source:NCBI gene;A... [more]
ttll62.690e-7636.56tubulin tyrosine ligase like 6 [Source:NCBI gene;A... [more]
back to top
BLAST of Tubulin polyglutamylase TTLL7 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000055128.10.000e+099.47SMESG000055128.1[more]
SMESG000055128.10.000e+099.33SMESG000055128.1[more]
SMESG000055128.11.076e-125100.00SMESG000055128.1[more]
SMESG000075764.19.134e-7436.19SMESG000075764.1[more]
SMESG000073336.13.460e-5235.74SMESG000073336.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022163 ID=SMED30022163|Name=Tubulin polyglutamylase TTLL7|organism=Schmidtea mediterranea sexual|type=transcript|length=3003bp
GTTTTCACAATTTATAATTCAAATAATTTTTATCTATTTTTATTTTCTCT
GAACTTTGATTTTAAAGATTAAAAGACACTATTTTTATTTTTAAAAAAAT
GCTTTCAAATAATTATCATCCAAATCTTCAACCAAGACAAGGCCAGAATG
GAATTGGGAATCTAGAGCATGATCATATCGTTTCGTATTTGAATCACAGC
AAACGATTGAATGGGGTTCCGATTTCTGAAAAAGATAGAGCAGAAAGAGA
GAAAAGAATTCAAAAGAAAAAAGCTAAGAAGCGCCAGAAACATCAAATGA
CCGCCAATGTCAATGGTACAAGATTTGAAATTGTAAAAAAAATTTTGGAG
TCAGTTGGATTTACTTTGAGGGATGATGAAGTTTTCAAGACATGCTATTT
GATCTGGACCGACAGCTTCATATCCCAAGAAAGAATTACAGAACTAAAAT
CCTATCAACGTATTAATCACTTCATGGGTATGGTAGAGATAAGTAGGAAG
GATTTCCTCACTAAAAAGTTTTCCAAAATGCAAAAGCTTCGTCCAAAAGA
TTATAATTATTTCCCGAAAACCTGGCTGTTTCCACAGGAAAGCAATTTAT
TGTATAAGTACATTAAAGAAACGAAGAAACCAACCAAAAAGAAATATTTC
ATTTTGAAACCCGCAAATGGTGCAATGGGAATGGGAATCCGACTGTTTTC
CGAAGATGACATAATCAAGAGCAACGAACCATCAATTGTACAAGAATACA
TAGATAAACCATGTCTTCTTGATGGTTATAAAAATGATTTCAGAATTTAT
GTATTGATAACATGCTGTGACCCTCTTAGAGCATTTATCTATCGTGAAGG
TCTAGTGAGATTGAGCACGGAAAAGTACGCGATGACTTCTGATTTGAAAA
TGGATTCAATTTTCAAACATCTTACTAACTATTCTGTGAACAAAAAGAAT
TCTAACTATACCAGGGGCGTTGATGAATCAAGTGGCAGTAAACAGTCGCT
TTCATCATTAATGAATAGATTCAAAACCAAATTTAATATTAATACGGATG
CGCTCTGGAAACAAATCATAGACATAGTAGTCAAAACTCTTGTATTGGTG
CAACCTCATCTCATTCATAACTACCGAATGTGTAGAACTGGACAGTTGCA
AAATTTTGATTCTGTCAGTTTTGAAATTTTGGGATTTGACATACTTCTTG
ATGAAAATCTATGCCCATGGTTACTTGAAGTGAATCGGTCTCCAAGTTTT
GGAATGGACGAAACTCTTGATAGAAAAGTTAAAGGATCATTGCTAGTGGA
CACCTTCAGATTATTAAATATCAAACCGAGTAATAAACAAAAAAGTCTTT
ATTTTCAAAAGCAAAAGGCTCAACGGCGTTTGACTTTAGCAGCTTTTCGT
TCCAAAATTGAGCCCCATCTCGATAACGAAACTTTGAAAAAACGAAAAGA
CATTGAAAAACGAAAACAAGATTTGATTGACCTTTTGGTTCGAGTTCAAG
CCAGTTCTTCAAGAGAATATTTCGAAAACAGACACGTTGGTAATTTTTTG
AGAGTTTTCCCACCGGATGACAAAACCGTATACGATTATTACGCTGAATT
ATTGGTCGACAGTTTTACTCTTTTCAATCAATTGAATTATCAAAACTGCT
CTACAGATTCTACTCAAGCCACCCAACAAATGCTACAAAGTTTTATGCCT
AATCAATTTCGAGAAGAAGATATAATGGAGCAGATTAAGCAATGCGAGGC
TGAAGAAAACGCGCTGTTAGAAAAATGGAAATTACCTCAGAATGCTGAGT
TAACAACTATAATTCCATCTGTGAATTACTACGAAACATCATCAGAAGAA
GATACAACATCATCTAACGAATCAGCATCAGACAGTGATGCGAATAATTT
GTCTGATGATATCATTGGAGAATACGAATCTTATAGTGCAAATAAAAAAC
CTACGAACATTCAACTGAATAATACTAATAGAAAAAATGCTAACTCTAAA
CCAATTAATAACAATAATTTCCGTCCAAAATCTGTCTTGCGTCCCTCAAC
TTCGACACCAAGACCAAATAGCAATTCAGAACACACTTTGAAATATTCAG
ATTTAAACAAAGCAAAACCATTTAAAAAGACCAAGTTACCGAATAAAGCT
TTAAAGTCTAAAGAAAGCTCTCGAGTGCATTCCCCTTTTAGTCAAAGTTC
ACAGATTTCATCTCGATCAAAGGATTTTAATAAAACTGATGAAGAGGTTC
CCAGTAAATATGACCTATGCTACCTTTCAGATAGTCCTGCGCCCTTAAAG
GATAATTTTTCAAGGTCTCCAATATATGAAGAACTGTTAAAGATTTTACT
AACTTCTCTCACCACTTTGACAATTAGATATCCAGGCCAAACTGATGTGG
AAACAAAGTCAATGCTTGCTAAAATATTTTCAAATTGGGAGCATCAAAGA
CATTCTGTGGCTACATATTGGTTGGCCACTCTTAATGCTAAAAAGCGTGA
TAAAATTATTCAAATAGTCAGAAATAACGTGGACAAAATCATAAATGATA
ATTTTAAATTCTCAGCAGATATCAGTGCAGCCCGAGTCAACCGATTGATT
TCCAAGGTGTACAACCGGTTATTGTGGAACCGTGGAAATGGCTTGATTCA
ATGCTTTAGTCATTTCAAATCGTGGCAGCTGATATTTTCACACAGTGGGG
ACCTCATCAAACCGCTAGAATTGGACATATGTTCCAGAGTTGTTCAACTG
TGTCTCGACTGTGTACTTATTGTCTATCAGTTCTCGATCTCGTTGTCCCA
ATCTAGCACTCCGAGATCAGACAAATCGTTTGCGTCTCAGTCAGTAATTA
GTGACTACAAGGAGTCAGATTTAACAAGTTCCTTCTCGGTCAATTCAGTG
ACGGCATAATTGAAACAAATTGAAAAGGCAGATTCAATATATATGTATAT
TTATATATTTAAATCAGATTCAATTACATAATTTATATTTACTTCATGTC
GAG
back to top

protein sequence of SMED30022163-orf-1

>SMED30022163-orf-1 ID=SMED30022163-orf-1|Name=SMED30022163-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=937bp
MLSNNYHPNLQPRQGQNGIGNLEHDHIVSYLNHSKRLNGVPISEKDRAER
EKRIQKKKAKKRQKHQMTANVNGTRFEIVKKILESVGFTLRDDEVFKTCY
LIWTDSFISQERITELKSYQRINHFMGMVEISRKDFLTKKFSKMQKLRPK
DYNYFPKTWLFPQESNLLYKYIKETKKPTKKKYFILKPANGAMGMGIRLF
SEDDIIKSNEPSIVQEYIDKPCLLDGYKNDFRIYVLITCCDPLRAFIYRE
GLVRLSTEKYAMTSDLKMDSIFKHLTNYSVNKKNSNYTRGVDESSGSKQS
LSSLMNRFKTKFNINTDALWKQIIDIVVKTLVLVQPHLIHNYRMCRTGQL
QNFDSVSFEILGFDILLDENLCPWLLEVNRSPSFGMDETLDRKVKGSLLV
DTFRLLNIKPSNKQKSLYFQKQKAQRRLTLAAFRSKIEPHLDNETLKKRK
DIEKRKQDLIDLLVRVQASSSREYFENRHVGNFLRVFPPDDKTVYDYYAE
LLVDSFTLFNQLNYQNCSTDSTQATQQMLQSFMPNQFREEDIMEQIKQCE
AEENALLEKWKLPQNAELTTIIPSVNYYETSSEEDTTSSNESASDSDANN
LSDDIIGEYESYSANKKPTNIQLNNTNRKNANSKPINNNNFRPKSVLRPS
TSTPRPNSNSEHTLKYSDLNKAKPFKKTKLPNKALKSKESSRVHSPFSQS
SQISSRSKDFNKTDEEVPSKYDLCYLSDSPAPLKDNFSRSPIYEELLKIL
LTSLTTLTIRYPGQTDVETKSMLAKIFSNWEHQRHSVATYWLATLNAKKR
DKIIQIVRNNVDKIINDNFKFSADISAARVNRLISKVYNRLLWNRGNGLI
QCFSHFKSWQLIFSHSGDLIKPLELDICSRVVQLCLDCVLIVYQFSISLS
QSSTPRSDKSFASQSVISDYKESDLTSSFSVNSVTA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR013815ATP_grasp_subdomain_1
IPR004344TTL/TTLL_fam
Vocabulary: biological process
TermDefinition
GO:0006464cellular protein modification process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 539..559
NoneNo IPR availableGENE3DG3DSA:3.30.470.20coord: 131..384
e-value: 1.9E-68
score: 232.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 39..67
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 579..601
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 579..714
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 691..707
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 613..665
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 39..53
NoneNo IPR availablePANTHERPTHR12241TUBULIN TYROSINE LIGASE-RELATEDcoord: 45..901
NoneNo IPR availablePANTHERPTHR12241:SF156TUBULIN POLYGLUTAMYLASE TTLL7coord: 45..901
NoneNo IPR availableSUPERFAMILYSSF56059Glutathione synthetase ATP-binding domain-likecoord: 131..404
IPR004344Tubulin-tyrosine ligase/Tubulin polyglutamylasePFAMPF03133TTLcoord: 117..414
e-value: 1.8E-69
score: 234.1
IPR004344Tubulin-tyrosine ligase/Tubulin polyglutamylasePROSITEPS51221TTLcoord: 64..418
score: 47.852
IPR013815ATP-grasp fold, subdomain 1GENE3DG3DSA:3.30.1490.20coord: 157..219
e-value: 1.9E-68
score: 232.7