slc25a-15

Overview
Nameslc25a-15 (AKN21583.1)
Smed IDSMED30022160
Length (bp)1255
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc25a-15 (SMED30022160) t-SNE clustered cells

Violin plots show distribution of expression levels for slc25a-15 (SMED30022160) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc25a-15 (SMED30022160) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc25a-15 (SMED30022160) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022160

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30022160SMESG000010513.1 dd_Smed_v4_8650_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc25a-15 vs. Ensembl Human
Match: SLC25A44 (solute carrier family 25 member 44 [Source:HGNC Symbol;Acc:HGNC:29036])

HSP 1 Score: 209.92 bits (533), Expect = 3.109e-64
Identity = 117/311 (37.62%), Postives = 170/311 (54.66%), Query Frame = 3
Query:   78 MDSAENFQVIEMHMLKKYMFFPLAGLGTFTVNTILYPISLIRTRLVMQHGNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTYETIRFKLADFDFNPHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQV--KNCKFLKTVSVLWREDRWFMFHKGLSARLTQSITYSFWIILFYEPIKYFCLKEDF 1004
            M+   N Q+IE   L K  F+      T  +   +YP +LIRTRL +Q G +LY G       IL  +G  GLY GF V +  L SG  YV TYE  R  +AD+  +   +S +AGG AS V Q++ VP+DVVSQH+M +  K   +G          +      +   +   I    G+RGFY+GY  S++T+IPNSA+WW FY+ Y ++LS  L   E P ++ Q VS PLA ++A+++ NP+D IR R+QV  KN   L    ++  E  W +  KGLSAR+  +   +  I++ YE +K   L+ + 
Sbjct:    1 MEDKRNIQIIEWEHLDKKKFYVFGVAMTMMIRVSVYPFTLIRTRLQVQKGKSLYHGTFDAFIKILRADGITGLYRGFLVNTFTLISGQCYVTTYELTRKFVADYSQSNTVKSLVAGGSASLVAQSITVPIDVVSQHLM-MQRKGEKMGRFQVRGNPEGQGVVAFGQTKDIIRQILQADGLRGFYRGYVASLLTYIPNSAVWWPFYHFYAEQLSY-LCPKECPHIVFQAVSGPLAAATASILTNPMDVIRTRVQVEGKNSIILTFRQLMAEEGPWGLM-KGLSARIISATPSTIVIVVGYESLKKLSLRPEL 308          
BLAST of slc25a-15 vs. Ensembl Human
Match: SLC25A44 (solute carrier family 25 member 44 [Source:HGNC Symbol;Acc:HGNC:29036])

HSP 1 Score: 204.912 bits (520), Expect = 3.272e-62
Identity = 117/318 (36.79%), Postives = 170/318 (53.46%), Query Frame = 3
Query:   78 MDSAENFQVIEMHMLKKYMFFPLAGLGTFTVNTILYPISLIRTRLVMQHGNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTYETIRFKLADFDFNPHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDK----LSNSLSFL---EIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQV--KNCKFLKTVSVLWREDRWFMFHKGLSARLTQSITYSFWIILFYEPIKYFCLKEDF 1004
            M+   N Q+IE   L K  F+      T  +   +YP +LIRTRL +Q G +LY G       IL  +G  GLY GF V +  L SG  YV TYE  R  +AD+  +   +S +AGG AS V Q++ VP+DVVSQH+M +  K   +G          +      +   +   I    G+RGFY+GY  S++T+IPNSA+WW FY+ Y       +   LS+L   E P ++ Q VS PLA ++A+++ NP+D IR R+QV  KN   L    ++  E  W +  KGLSAR+  +   +  I++ YE +K   L+ + 
Sbjct:    1 MEDKRNIQIIEWEHLDKKKFYVFGVAMTMMIRVSVYPFTLIRTRLQVQKGKSLYHGTFDAFIKILRADGITGLYRGFLVNTFTLISGQCYVTTYELTRKFVADYSQSNTVKSLVAGGSASLVAQSITVPIDVVSQHLM-MQRKGEKMGRFQVRGNPEGQGVVAFGQTKDIIRQILQADGLRGFYRGYVASLLTYIPNSAVWWPFYHFYAAIVFPWIPEQLSYLCPKECPHIVFQAVSGPLAAATASILTNPMDVIRTRVQVEGKNSIILTFRQLMAEEGPWGLM-KGLSARIISATPSTIVIVVGYESLKKLSLRPEL 316          
BLAST of slc25a-15 vs. Ensembl Human
Match: SLC25A23 (solute carrier family 25 member 23 [Source:HGNC Symbol;Acc:HGNC:19375])

HSP 1 Score: 68.5514 bits (166), Expect = 2.258e-12
Identity = 53/202 (26.24%), Postives = 97/202 (48.02%), Query Frame = 3
Query:  111 MHMLKKYMFFPLAGLGTFTVNTILYPISLIRTRLVMQHGNNLYTGMIHCARTILIKEGWKGLYNGFF--VKSIQLFSGMAYVGTYETIR----FKLADFDFNPHTRSFIA-GGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYN 695
            +H+ ++++   LAG    T  TI+YP+ +++TRL ++     Y G++ CAR IL +EG +  Y G+   V  I  ++G+  +  YET++     + +    +P     +A G  +S  GQ    P+ +V   M           + +SI+        P    +G+  HI  + G+RG Y+G A + +  IP  ++ +  Y 
Sbjct:   40 LHVQERFVAGSLAG---ATAQTIIYPMEVLKTRLTLRRTGQ-YKGLLDCARRILEREGPRAFYRGYLPNVLGIIPYAGID-LAVYETLKNWWLQQYSHDSADPGILVLLACGTISSTCGQIASYPLALVRTRMQ----------AQASIE------GGPQLSMLGLLRHILSQEGMRGLYRGIAPNFMKVIPAVSISYVVYE 220          
BLAST of slc25a-15 vs. Ensembl Human
Match: SLC25A23 (solute carrier family 25 member 23 [Source:HGNC Symbol;Acc:HGNC:19375])

HSP 1 Score: 67.3958 bits (163), Expect = 1.788e-11
Identity = 53/196 (27.04%), Postives = 94/196 (47.96%), Query Frame = 3
Query:   99 QVIEMHMLKKYMFFPLAGLGTFTVNTILYPISLIRTRLVMQHGNNLYTGMIHCARTILIKEGWKGLYNGFF--VKSIQLFSGMAYVGTYETIR----FKLADFDFNPHTRSFIA-GGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIP 665
            Q   +H+ ++++   LAG    T  TI+YP+ +++TRL ++     Y G++ CAR IL +EG +  Y G+   V  I  ++G+  +  YET++     + +    +P     +A G  +S  GQ    P+ +V   M           + +SI+        P    +G+  HI  + G+RG Y+G A + +  IP
Sbjct:  273 QQETLHVQERFVAGSLAGA---TAQTIIYPMEVLKTRLTLRR-TGQYKGLLDCARRILEREGPRAFYRGYLPNVLGIIPYAGID-LAVYETLKNWWLQQYSHDSADPGILVLLACGTISSTCGQIASYPLALVRTRMQ----------AQASIE------GGPQLSMLGLLRHILSQEGMRGLYRGIAPNFMKVIP 447          
BLAST of slc25a-15 vs. Ensembl Human
Match: SLC25A39 (solute carrier family 25 member 39 [Source:HGNC Symbol;Acc:HGNC:24279])

HSP 1 Score: 65.0846 bits (157), Expect = 1.836e-11
Identity = 51/183 (27.87%), Postives = 89/183 (48.63%), Query Frame = 3
Query:  144 LAGLGTFTVNTILYPISLIRTRLVMQHGNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQ--LFSGMAYVGTYETIRFKLADFDFNPHTR---SFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSAL 677
            LA LGT TV   + P+ L+RT+L  QH +  Y  +  C RT + + GW+ L+ G+   +++   FS + Y   YE ++  L  F     T    SF+AGG +  V   L +P DVV         +  ++G++ ++++    + +       +   IR E G +G + G+   +I   P+ A+
Sbjct:   38 LARLGTVTV---ISPLELMRTKLQAQHVS--YRELGACVRTAVAQGGWRSLWLGWGPTALRDVPFSAL-YWFNYELVKSWLNGFRPKDQTSVGMSFVAGGISGTVAAVLTLPFDVVK------TQRQVALGAMEAVRVNPLHVDSTWL----LLRRIRAESGTKGLFAGFLPRIIKAAPSCAI 204          
BLAST of slc25a-15 vs. Ensembl Celegans
Match: F13G3.7 (pep chromosome:WBcel235:I:7304918:7307006:1 gene:WBGene00008767.1 transcript:F13G3.7b.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F13G3.7)

HSP 1 Score: 166.007 bits (419), Expect = 3.067e-47
Identity = 104/332 (31.33%), Postives = 176/332 (53.01%), Query Frame = 3
Query:   90 ENFQVIEMHMLKKYMFFPLAGLGTFTVNTILYPISLIRTRLVMQHGNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTYETIRFKLADFDF--NPHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLS--RFIGVCSHIRHEY---GIRGFYKGYAISMITFIPNSALWWG-FYN---------------LYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVKNCKFLKTVSVLWREDRWFMFHKGLSARLTQSITYSFWIILFYEPIKYFCLKEDFKKTI 1016
            +   VI+   L  Y F+P+A   ++T+  +LYP+S++++RL +Q  NN+Y GM      I+ +EG   LY GF++   QL +   Y   YE +R  L       N    S +AGG AS   Q + VP D+V+QHMM+ NN +   G   +I + ++  K  L   R +G+   IR  Y   GI GFY+G+  +++ +IP++ ++W  +YN                Y  K ++     +    L Q VS  + G ++A++ NP++ +R+R+QV    + +T+  LW+ ++  +F KGL+ R+  +  YS  ++L YE +K F +  +FK  I
Sbjct:   38 DKLLVIQWEHLNLYKFYPMALCSSWTIRCMLYPMSVVKSRLQLQRQNNVYNGMRDAFVKIIRQEGIGALYKGFWMTLPQLSASFLYSSAYERVRDLLQTHLHITNHSVVSALAGGIASPCAQLIFVPTDIVAQHMMVHNNPEAFGGGEKNIPVADAIRKDGLEGRRTLGL-RVIRAVYKVDGIFGFYRGFLSAIMLYIPSTMVFWSTYYNSLAVFRMIREKVTELEYGVKPTSPSEVDDRNLFLDQAVSGSIGGVASAMVTNPLEMLRIRLQVHRTTYRETIVRLWKYEKAQVFTKGLAPRMVNNALYSSLVMLAYESVKRFSVLPEFKNKI 368          
BLAST of slc25a-15 vs. Ensembl Celegans
Match: F13G3.7 (pep chromosome:WBcel235:I:7305004:7307010:1 gene:WBGene00008767.1 transcript:F13G3.7b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F13G3.7)

HSP 1 Score: 166.007 bits (419), Expect = 3.067e-47
Identity = 104/332 (31.33%), Postives = 176/332 (53.01%), Query Frame = 3
Query:   90 ENFQVIEMHMLKKYMFFPLAGLGTFTVNTILYPISLIRTRLVMQHGNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTYETIRFKLADFDF--NPHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLS--RFIGVCSHIRHEY---GIRGFYKGYAISMITFIPNSALWWG-FYN---------------LYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVKNCKFLKTVSVLWREDRWFMFHKGLSARLTQSITYSFWIILFYEPIKYFCLKEDFKKTI 1016
            +   VI+   L  Y F+P+A   ++T+  +LYP+S++++RL +Q  NN+Y GM      I+ +EG   LY GF++   QL +   Y   YE +R  L       N    S +AGG AS   Q + VP D+V+QHMM+ NN +   G   +I + ++  K  L   R +G+   IR  Y   GI GFY+G+  +++ +IP++ ++W  +YN                Y  K ++     +    L Q VS  + G ++A++ NP++ +R+R+QV    + +T+  LW+ ++  +F KGL+ R+  +  YS  ++L YE +K F +  +FK  I
Sbjct:   38 DKLLVIQWEHLNLYKFYPMALCSSWTIRCMLYPMSVVKSRLQLQRQNNVYNGMRDAFVKIIRQEGIGALYKGFWMTLPQLSASFLYSSAYERVRDLLQTHLHITNHSVVSALAGGIASPCAQLIFVPTDIVAQHMMVHNNPEAFGGGEKNIPVADAIRKDGLEGRRTLGL-RVIRAVYKVDGIFGFYRGFLSAIMLYIPSTMVFWSTYYNSLAVFRMIREKVTELEYGVKPTSPSEVDDRNLFLDQAVSGSIGGVASAMVTNPLEMLRIRLQVHRTTYRETIVRLWKYEKAQVFTKGLAPRMVNNALYSSLVMLAYESVKRFSVLPEFKNKI 368          
BLAST of slc25a-15 vs. Ensembl Celegans
Match: F13G3.7 (pep chromosome:WBcel235:I:7305004:7307006:1 gene:WBGene00008767.1 transcript:F13G3.7a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F13G3.7)

HSP 1 Score: 166.007 bits (419), Expect = 3.688e-47
Identity = 104/328 (31.71%), Postives = 175/328 (53.35%), Query Frame = 3
Query:  102 VIEMHMLKKYMFFPLAGLGTFTVNTILYPISLIRTRLVMQHGNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTYETIRFKLADFDF--NPHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLS--RFIGVCSHIRHEY---GIRGFYKGYAISMITFIPNSALWWG-FYN---------------LYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVKNCKFLKTVSVLWREDRWFMFHKGLSARLTQSITYSFWIILFYEPIKYFCLKEDFKKTI 1016
            VI+   L  Y F+P+A   ++T+  +LYP+S++++RL +Q  NN+Y GM      I+ +EG   LY GF++   QL +   Y   YE +R  L       N    S +AGG AS   Q + VP D+V+QHMM+ NN +   G   +I + ++  K  L   R +G+   IR  Y   GI GFY+G+  +++ +IP++ ++W  +YN                Y  K ++     +    L Q VS  + G ++A++ NP++ +R+R+QV    + +T+  LW+ ++  +F KGL+ R+  +  YS  ++L YE +K F +  +FK  I
Sbjct:   45 VIQWEHLNLYKFYPMALCSSWTIRCMLYPMSVVKSRLQLQRQNNVYNGMRDAFVKIIRQEGIGALYKGFWMTLPQLSASFLYSSAYERVRDLLQTHLHITNHSVVSALAGGIASPCAQLIFVPTDIVAQHMMVHNNPEAFGGGEKNIPVADAIRKDGLEGRRTLGL-RVIRAVYKVDGIFGFYRGFLSAIMLYIPSTMVFWSTYYNSLAVFRMIREKVTELEYGVKPTSPSEVDDRNLFLDQAVSGSIGGVASAMVTNPLEMLRIRLQVHRTTYRETIVRLWKYEKAQVFTKGLAPRMVNNALYSSLVMLAYESVKRFSVLPEFKNKI 371          
BLAST of slc25a-15 vs. Ensembl Celegans
Match: Y43C5B.3 (pep chromosome:WBcel235:IV:10353167:10355120:1 gene:WBGene00012786.1 transcript:Y43C5B.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y43C5B.3)

HSP 1 Score: 140.969 bits (354), Expect = 4.705e-38
Identity = 90/321 (28.04%), Postives = 155/321 (48.29%), Query Frame = 3
Query:   87 AENFQVIEMHMLKKYMFFPLAGLGTFTVNTILYPISLIRTRLVMQHGNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTYETIRFKLADFDFNPHTRSFIAGG-FASAVGQTLVVPVDVVSQHMMIINNKD--TSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWW-------GFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVKNCKFLKTVSVLWREDRWFMFHKGLSARLTQSITYSFWIILFYEPIKYFCLKEDFKKTIK 1019
            +E   V+    +   +F+P A   ++++ T LYP++++R++L +Q  N +Y    H    I  +EG++GLY GF++   Q+     Y   +E  R  L +             G  AS   Q++ VP D+++Q+MMI  N D  T+    S I    + +K        V   I    GI GFY+G+  S   ++P    +W       G +N      + SL       L  Q V+A L G  + +  NP++  R+R+QV    + KT+  + R+++  +F KGL+ R+  +  YS  +++ YE +K  C KE++K  +K
Sbjct:   27 SEPLTVVGWEHMDLKLFYPSALFSSWSIRTALYPLAVLRSQLQLQKQNTVYRSTFHAYSDISKREGFRGLYRGFWITVPQIGCSFIYSTIFEKCRAVLHEQGIQSVGGVAAVAGGLASFATQSIFVPTDIIAQYMMIYKNTDKLTAGHDKSVIDGVRNHVKNGSGLGTSVIKAIYKTDGILGFYRGFWASTAVYVPQMLTFWPSYYWMLGLFNKLHPATNRSL-------LFDQAVAATLGGVISTVATNPMELFRVRLQVHRGSYSKTLETMLRDEKTAVFTKGLTPRIIANSMYSGLVVVGYEIVKRLCAKEEYKHRVK 340          
BLAST of slc25a-15 vs. Ensembl Celegans
Match: hpo-12 (pep chromosome:WBcel235:IV:12283174:12285065:1 gene:WBGene00016588.1 transcript:C42C1.10.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:hpo-12)

HSP 1 Score: 62.7734 bits (151), Expect = 8.927e-11
Identity = 53/193 (27.46%), Postives = 83/193 (43.01%), Query Frame = 3
Query:  138 FPLAGLGTFTVNTILYPISLIRTRLVMQH-GNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQL--FSGMAYVGTYETIRFKLADFDFNPHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCD 707
            F    L      T   P+ +IRTRLV Q  G+ +YTG +H  + I  KEG  G + G+    +Q+  F+GM +   Y      L  F+      +  +G  A  V +T++ P+D+V   + +   +    G         S     L + IG+       YG+   +KG   S I    NS   + FY ++CD
Sbjct:  123 FACGALSGCLAMTAAMPLDVIRTRLVAQKAGHAVYTGTMHAVKHIWEKEGIAGYFRGWVPSVVQIAPFTGMQFA-LYNCF-MDLWPFNGYESAGALFSGAMAGTVAKTVLYPLDMVRHRLQMNGFERAGFGK-------TSNYSQGLFKTIGMVVKNESWYGL---FKGLWPSQIKAAANSGCAFLFYEIFCD 303          

HSP 2 Score: 57.3806 bits (137), Expect = 6.110e-9
Identity = 60/302 (19.87%), Postives = 119/302 (39.40%), Query Frame = 3
Query:  147 AGLGTFTVNT-ILYPISLIRTRLVMQH------GNNLYTGMIHCARTILIKEGWKGLYNGFF-VKSIQLFSGMAYVGTYETIRFKLA-----DFDFNPHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIIN-NKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVKNCK-------------FLKTVSVLWREDRWFMFHKGLSARLTQSITYSFWIILFYE 971
            AGL +  V   I+ P+ +++ R  +Q        +  Y G++     I  +EG    + G    + +    G+    ++E +  + A     D      T  F  G  +  +  T  +P+DV+   ++          G++ ++K                  HI  + GI G+++G+  S++   P + + +  YN + D      +  E    L    S  +AG+ A  ++ P+D +R R+Q+   +               KT+ ++ + + W+   KGL     ++   S    LFYE
Sbjct:   21 AGLASGIVTRMIIQPLDVLKIRFQLQEEPIRGKKSGKYKGVMQSIFLITREEGAHAFWKGHIPAQGLSATYGLVQFSSFEWLSQQAAKVIPADNQSVRSTSDFACGALSGCLAMTAAMPLDVIRTRLVAQKAGHAVYTGTMHAVK------------------HIWEKEGIAGYFRGWVPSVVQIAPFTGMQFALYNCFMDLW--PFNGYESAGALF---SGAMAGTVAKTVLYPLDMVRHRLQMNGFERAGFGKTSNYSQGLFKTIGMVVKNESWYGLFKGLWPSQIKAAANSGCAFLFYE 299          
BLAST of slc25a-15 vs. Ensembl Fly
Match: CG5805 (gene:FBgn0039223 transcript:FBtr0084743)

HSP 1 Score: 236.884 bits (603), Expect = 1.166e-74
Identity = 124/319 (38.87%), Postives = 192/319 (60.19%), Query Frame = 3
Query:   81 DSAENFQVIEMHMLKKYMFFPLAGLGTFTVNTILYPISLIRTRLVMQHGNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTYETIRFKLADFDFNPHTRSFIAGGFASAVGQTLVVPVDVVSQHMMII--NNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVKNCKFLKTVSV----LWREDRWFMFHKGLSARLTQSITYSFWIILFYEPIKYFCLKEDFKKTIK 1019
            + A   + IE  M+ K  FFPL+ L +F+V   L+P+++I+T+L +QH +++Y GM+ CA  I   EG  GLY GF++ S+Q+ SG+ Y+ TYE +R  L D       ++   GG AS VGQT++VP DV+SQH M++  +    S G ++ + + +   ++ L   + +   I    G RGFY+GY  S++ ++PNSA+WW FY+LY D+L   +  + +  L IQ V+  L G +  ++ NP+D +R R+QV     L ++SV    LW+E++   F KGLSARL QS  +SF IIL YE IK   + E +K  I+
Sbjct:   24 EGATYIRTIEWDMMNKTKFFPLSMLSSFSVRCCLFPLTVIKTQLQVQHKSDVYKGMVDCAMKIYRSEGVPGLYRGFWISSVQIVSGVFYISTYEGVRHVLNDLGAGHRMKALAGGGCASLVGQTIIVPFDVISQHAMVLGMSAHAGSKGDINPLGIKSWPGRSRLHISMDIGREIMRRDGFRGFYRGYTASLMAYVPNSAMWWAFYHLYQDELFR-ICPVWVSHLFIQCVAGSLGGFTTTILTNPLDIVRARLQVHR---LDSMSVAFRELWQEEKLNCFFKGLSARLVQSAAFSFSIILGYETIKRIAVDEQYKHQIR 338          
BLAST of slc25a-15 vs. Ensembl Fly
Match: CG5805 (gene:FBgn0039223 transcript:FBtr0339255)

HSP 1 Score: 236.884 bits (603), Expect = 1.166e-74
Identity = 124/319 (38.87%), Postives = 192/319 (60.19%), Query Frame = 3
Query:   81 DSAENFQVIEMHMLKKYMFFPLAGLGTFTVNTILYPISLIRTRLVMQHGNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTYETIRFKLADFDFNPHTRSFIAGGFASAVGQTLVVPVDVVSQHMMII--NNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVKNCKFLKTVSV----LWREDRWFMFHKGLSARLTQSITYSFWIILFYEPIKYFCLKEDFKKTIK 1019
            + A   + IE  M+ K  FFPL+ L +F+V   L+P+++I+T+L +QH +++Y GM+ CA  I   EG  GLY GF++ S+Q+ SG+ Y+ TYE +R  L D       ++   GG AS VGQT++VP DV+SQH M++  +    S G ++ + + +   ++ L   + +   I    G RGFY+GY  S++ ++PNSA+WW FY+LY D+L   +  + +  L IQ V+  L G +  ++ NP+D +R R+QV     L ++SV    LW+E++   F KGLSARL QS  +SF IIL YE IK   + E +K  I+
Sbjct:   24 EGATYIRTIEWDMMNKTKFFPLSMLSSFSVRCCLFPLTVIKTQLQVQHKSDVYKGMVDCAMKIYRSEGVPGLYRGFWISSVQIVSGVFYISTYEGVRHVLNDLGAGHRMKALAGGGCASLVGQTIIVPFDVISQHAMVLGMSAHAGSKGDINPLGIKSWPGRSRLHISMDIGREIMRRDGFRGFYRGYTASLMAYVPNSAMWWAFYHLYQDELFR-ICPVWVSHLFIQCVAGSLGGFTTTILTNPLDIVRARLQVHR---LDSMSVAFRELWQEEKLNCFFKGLSARLVQSAAFSFSIILGYETIKRIAVDEQYKHQIR 338          
BLAST of slc25a-15 vs. Ensembl Fly
Match: aralar1 (gene:FBgn0028646 transcript:FBtr0306586)

HSP 1 Score: 68.5514 bits (166), Expect = 5.051e-12
Identity = 76/308 (24.68%), Postives = 126/308 (40.91%), Query Frame = 3
Query:  111 MHMLKKYMFFPLAGLGTFTVNTILYPISLIRTRLVMQH-----GNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTY-ETIRFKLADFDFN-PHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVKNCKFLKTVSVLWREDRWFM-------FHKGLSARLTQS--------ITYSFWIILFY 968
            + +L+    F L         T++YPI L++TR+  Q      G   Y     C + ++  EG+ GLY G   + + +    A   T  + +R KL D   N P     +AGG A A       P+++V   + +       + S S I+                 S +R E G+ G YKG    ++  +P SA+++  Y      +++   +     LL    +  +AG  AA ++ P D I+ R+QV       T + +W   +  M       F KG +AR+ +S        +TY     LFY
Sbjct:  349 IQVLESSYRFTLGSFAGAVGATVVYPIDLVKTRMQNQRAGSYIGEVAYRNSWDCFKKVVRHEGFMGLYRGLLPQLMGVAPEKAIKLTVNDLVRDKLTDKKGNIPTWAEVLAGGCAGASQVVFTNPLEIVKIRLQVAGE----IASGSKIR---------------AWSVVR-ELGLFGLYKGARACLLRDVPFSAIYFPTYAHTKAMMADKDGYNHPLTLL---AAGAIAGVPAASLVTPADVIKTRLQVVARSGQTTYTGVWDATKKIMAEEGPRAFWKGTAARVFRSSPQFGVTLVTYELLQRLFY 633          
BLAST of slc25a-15 vs. Ensembl Fly
Match: aralar1 (gene:FBgn0028646 transcript:FBtr0085692)

HSP 1 Score: 68.1662 bits (165), Expect = 5.373e-12
Identity = 76/308 (24.68%), Postives = 126/308 (40.91%), Query Frame = 3
Query:  111 MHMLKKYMFFPLAGLGTFTVNTILYPISLIRTRLVMQH-----GNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTY-ETIRFKLADFDFN-PHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVKNCKFLKTVSVLWREDRWFM-------FHKGLSARLTQS--------ITYSFWIILFY 968
            + +L+    F L         T++YPI L++TR+  Q      G   Y     C + ++  EG+ GLY G   + + +    A   T  + +R KL D   N P     +AGG A A       P+++V   + +       + S S I+                 S +R E G+ G YKG    ++  +P SA+++  Y      +++   +     LL    +  +AG  AA ++ P D I+ R+QV       T + +W   +  M       F KG +AR+ +S        +TY     LFY
Sbjct:  337 IQVLESSYRFTLGSFAGAVGATVVYPIDLVKTRMQNQRAGSYIGEVAYRNSWDCFKKVVRHEGFMGLYRGLLPQLMGVAPEKAIKLTVNDLVRDKLTDKKGNIPTWAEVLAGGCAGASQVVFTNPLEIVKIRLQVAGE----IASGSKIR---------------AWSVVR-ELGLFGLYKGARACLLRDVPFSAIYFPTYAHTKAMMADKDGYNHPLTLL---AAGAIAGVPAASLVTPADVIKTRLQVVARSGQTTYTGVWDATKKIMAEEGPRAFWKGTAARVFRSSPQFGVTLVTYELLQRLFY 621          
BLAST of slc25a-15 vs. Ensembl Fly
Match: aralar1 (gene:FBgn0028646 transcript:FBtr0330290)

HSP 1 Score: 68.1662 bits (165), Expect = 6.130e-12
Identity = 76/308 (24.68%), Postives = 126/308 (40.91%), Query Frame = 3
Query:  111 MHMLKKYMFFPLAGLGTFTVNTILYPISLIRTRLVMQH-----GNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTY-ETIRFKLADFDFN-PHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVKNCKFLKTVSVLWREDRWFM-------FHKGLSARLTQS--------ITYSFWIILFY 968
            + +L+    F L         T++YPI L++TR+  Q      G   Y     C + ++  EG+ GLY G   + + +    A   T  + +R KL D   N P     +AGG A A       P+++V   + +       + S S I+                 S +R E G+ G YKG    ++  +P SA+++  Y      +++   +     LL    +  +AG  AA ++ P D I+ R+QV       T + +W   +  M       F KG +AR+ +S        +TY     LFY
Sbjct:  324 IQVLESSYRFTLGSFAGAVGATVVYPIDLVKTRMQNQRAGSYIGEVAYRNSWDCFKKVVRHEGFMGLYRGLLPQLMGVAPEKAIKLTVNDLVRDKLTDKKGNIPTWAEVLAGGCAGASQVVFTNPLEIVKIRLQVAGE----IASGSKIR---------------AWSVVR-ELGLFGLYKGARACLLRDVPFSAIYFPTYAHTKAMMADKDGYNHPLTLL---AAGAIAGVPAASLVTPADVIKTRLQVVARSGQTTYTGVWDATKKIMAEEGPRAFWKGTAARVFRSSPQFGVTLVTYELLQRLFY 608          
BLAST of slc25a-15 vs. Ensembl Zebrafish
Match: slc25a44b (solute carrier family 25 member 44b [Source:ZFIN;Acc:ZDB-GENE-050320-89])

HSP 1 Score: 217.624 bits (553), Expect = 2.095e-67
Identity = 121/318 (38.05%), Postives = 182/318 (57.23%), Query Frame = 3
Query:   78 MDSAENFQVIEMHMLKKYMFFPLAGLGTFTVNTILYPISLIRTRLVMQHGNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTYETIRFKLADFDFNPHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPL----SRFIG----VCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVK-NCKFLKTVSVLWREDRWFMFHKGLSARLTQSITYSFWIILFYEPIKYFCLKEDF 1004
            M    N Q+IE   L K  F+      T T+   +YP +LIRTRL +Q G +LYTG     R IL  EG +GLY GF V +  L SG AY+ TYE +R  ++ +  +   +S +AGG AS V Q++ VP+DVVSQ +M+    +     L+  K+   + KTP     S F G    +   I    GIRGFY+GY  S++T+IPNSA+WW FY+ Y ++LS  ++    P L++Q ++ PLA ++A+ + NP+D IR R+QV+     ++T   L RE+ ++   KGLSAR+  S   +  +++ YE +K   L+ + 
Sbjct:    1 MQQKRNIQIIEWEDLDKRKFYSFGLFMTMTIRATVYPATLIRTRLQVQKGKSLYTGTYDAFRKILRTEGLRGLYRGFMVTTFTLISGQAYITTYELVRKYVSSYSKDNTLKSLVAGGSASLVAQSITVPIDVVSQQLMMQGQGE----HLTRFKV---KPKTPSGAKHSVFFGQTRDIIGQIFAADGIRGFYRGYVASLLTYIPNSAVWWPFYHFYAEQLSK-MAPSNCPHLVLQAMAGPLAAATASTVTNPMDVIRARVQVEGRTSVIETFYQLIREEGFWGLTKGLSARIISSAPTAIVMVVGYETLKKLSLRPEL 310          
BLAST of slc25a-15 vs. Ensembl Zebrafish
Match: slc25a44a (solute carrier family 25 member 44a [Source:ZFIN;Acc:ZDB-GENE-041114-38])

HSP 1 Score: 214.542 bits (545), Expect = 5.729e-66
Identity = 117/321 (36.45%), Postives = 176/321 (54.83%), Query Frame = 3
Query:   78 MDSAENFQVIEMHMLKKYMFFPLAGLGTFTVNTILYPISLIRTRLVMQHGNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTYETIRFKLADFDFNPHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIG-----------VCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVK-NCKFLKTVSVLWREDRWFMFHKGLSARLTQSITYSFWIILFYEPIKYFCLKEDF 1004
            M    N Q+IE   L K  F+ L    T T    +YP +LIRTRL +Q G +LY G       IL  EG +GLY GF + +  L SG AY+ TYE +R  ++ +  N   +S +AGG AS V Q++ VP+DVVSQ +M+              +LT  +LK  ++   G           +   I H  G RGFY+GY  S++T+IPNSA+WW FY+ Y ++LS  L+  + P L++Q ++ P+A ++A+ + NP+D +R R+QV+     ++T   L  E+  +   KGLSAR+  S   S  I++ YE +K   L+ + 
Sbjct:    8 MQQKRNIQIIEWEDLDKRKFYSLGVFMTMTTRAAVYPFTLIRTRLQVQKGKSLYNGTFDAFCKILKVEGARGLYRGFMINTFTLISGQAYITTYELVRKYVSWYSSNNTVKSLVAGGAASLVAQSITVPIDVVSQQLMVQGQ---------GCQLTRFKLKPKMAMATGKHKYTFGQTRDIVVQIFHADGFRGFYRGYVASLLTYIPNSAVWWPFYHFYGEQLSR-LAPADCPHLILQAIAGPMAAATASTLTNPMDVVRARVQVEGRSSVIETFKQLMAEEGIWGLTKGLSARIISSTPTSIMIVIGYETLKRLSLRPEL 318          
BLAST of slc25a-15 vs. Ensembl Zebrafish
Match: slc25a15a (solute carrier family 25 member 15a [Source:ZFIN;Acc:ZDB-GENE-070112-1072])

HSP 1 Score: 66.2402 bits (160), Expect = 1.299e-11
Identity = 64/284 (22.54%), Postives = 124/284 (43.66%), Query Frame = 3
Query:  204 TRLVMQHGNNLYTGMIHCARTILIKEGWKGLYNGF-------FVKSIQLFSGMAYVGTYETIRFKLADFDFNPH---TRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNL----YCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQV-----KNCKFLKTVSVLWREDRWFMFHKGLSARLTQSITYSFWIILFYEPIKYFCLKE 998
             ++ MQ    LY G +HC  ++  + G +GLY G          ++  LF  M+Y      +RF L+  D N      +   +G  AS      + P ++V   +  ++  +      +S K+ + +  T  S    V  ++    G  GFY+G+  +++  +P    ++G Y L    +   ++     + +  L+    S    G+   L++ PIDC++ RIQV     K   F+KT+  + R +     + GL+  + ++   +  + L YE  + F +K+
Sbjct:   33 AKVKMQTFPGLYRGFVHCFVSVYKQVGLRGLYQGTTPALIANIAENAVLF--MSYGFCQNVVRF-LSGLDRNTELSDVQKACSGSVASVFSSLALCPTELVKCRLQAMHEME------ASGKIASGQKSTVWS----VVRNVLRTNGPLGFYQGFTTTIVRELPGYFCFFGGYELSRSIFAHHMATDKEHIGVVPLMF---SGGFGGACLWLVVYPIDCVKSRIQVLSLAGKQEGFIKTLMGILRNEGVAPLYSGLTPTMIRTFPANGALFLAYEVSRKFMMKQ 300          
BLAST of slc25a-15 vs. Ensembl Zebrafish
Match: slc25a15a (solute carrier family 25 member 15a [Source:ZFIN;Acc:ZDB-GENE-070112-1072])

HSP 1 Score: 66.2402 bits (160), Expect = 1.299e-11
Identity = 64/284 (22.54%), Postives = 124/284 (43.66%), Query Frame = 3
Query:  204 TRLVMQHGNNLYTGMIHCARTILIKEGWKGLYNGF-------FVKSIQLFSGMAYVGTYETIRFKLADFDFNPH---TRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNL----YCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQV-----KNCKFLKTVSVLWREDRWFMFHKGLSARLTQSITYSFWIILFYEPIKYFCLKE 998
             ++ MQ    LY G +HC  ++  + G +GLY G          ++  LF  M+Y      +RF L+  D N      +   +G  AS      + P ++V   +  ++  +      +S K+ + +  T  S    V  ++    G  GFY+G+  +++  +P    ++G Y L    +   ++     + +  L+    S    G+   L++ PIDC++ RIQV     K   F+KT+  + R +     + GL+  + ++   +  + L YE  + F +K+
Sbjct:   33 AKVKMQTFPGLYRGFVHCFVSVYKQVGLRGLYQGTTPALIANIAENAVLF--MSYGFCQNVVRF-LSGLDRNTELSDVQKACSGSVASVFSSLALCPTELVKCRLQAMHEME------ASGKIASGQKSTVWS----VVRNVLRTNGPLGFYQGFTTTIVRELPGYFCFFGGYELSRSIFAHHMATDKEHIGVVPLMF---SGGFGGACLWLVVYPIDCVKSRIQVLSLAGKQEGFIKTLMGILRNEGVAPLYSGLTPTMIRTFPANGALFLAYEVSRKFMMKQ 300          
BLAST of slc25a-15 vs. Ensembl Zebrafish
Match: slc25a22a (solute carrier family 25 member 22a [Source:ZFIN;Acc:ZDB-GENE-110408-61])

HSP 1 Score: 65.855 bits (159), Expect = 1.981e-11
Identity = 63/254 (24.80%), Postives = 111/254 (43.70%), Query Frame = 3
Query:  174 TILYPISLIRTRLV-MQHGNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTYETIRFKLADFDFNPH-----------TRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGS-LSSIKLTNS-------------------ELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWG-FYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQ 836
            T ++PI L +TRL   Q+G+ LYT M  C    +  EG+ G+Y G  V        +  V   + I+    DF F  H            +  +AG  A      +  P++++   +      DT++ S L+ + +  +                   E+K+P +  + +   +  E GI G YKG   +++  +P S +++  F NL  + L         P   +  +S  +AGS+AA+ +NP+D I+ R+Q
Sbjct:   24 TCVFPIDLAKTRLQNQQNGSRLYTSMSDCLIKTIRSEGYFGMYRGAAVN-------LTLVTPEKAIKLAANDF-FRHHFSKDGWQKLTLLKEMLAGCGAGTCQVIVTTPMEMLKIQLQDAGRIDTNIKSPLAELNINLNITAAQRKLMPQAVTPGGPVEMKSPTA--MQLTRQLLKEKGIAGLYKGLGATLLRDVPFSIIYFPLFANL--NNLGKKGGDGPAP-FYVSFISGCIAGSTAAVAVNPVDVIKTRLQ 264          
BLAST of slc25a-15 vs. Ensembl Xenopus
Match: slc25a44 (solute carrier family 25 member 44 [Source:NCBI gene;Acc:493443])

HSP 1 Score: 211.846 bits (538), Expect = 8.641e-65
Identity = 118/310 (38.06%), Postives = 172/310 (55.48%), Query Frame = 3
Query:   78 MDSAENFQVIEMHMLKKYMFFPLAGLGTFTVNTILYPISLIRTRLVMQHGNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTYETIRFKLADFDFNPHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVK-NCKFLKTVSVLWREDRWFMFHKGLSARLTQSITYSFWIILFYEPIKYFCLKEDF 1004
            M+   N Q+IE   L K  F+      T  +   +YP +LIRTRL +Q G +LY G       IL  EG  G Y GF V +  L SG  YV TYE  R  ++ +  +   +S +AGG AS V Q++ VP+DVVSQH+M +  K  S+G    +  T+ +      +   +   I    G RGFY+GY  S++T+IPNSA+WW FY+LY ++LS  LS  + P LL+Q ++ PLA ++A+ I NP+D IR R+QV+     + T   L  E+  +   KGLSAR+  S   +  I++ YE +K   L+ + 
Sbjct:   20 MEDKRNIQIIEWEHLDKKKFYVFGVCMTMIIRVSVYPFTLIRTRLQVQKGKSLYNGTFDAFVKILRTEGAAGFYRGFLVNTFTLISGQCYVTTYELTRKYVSKYSSSNTVKSLVAGGSASLVAQSITVPIDVVSQHLM-MQRKGESMGRF-RVHATDGKQPVMFGQTKDIILQIFRADGFRGFYRGYVASLLTYIPNSAVWWPFYHLYAEQLSR-LSPNDCPHLLLQAIAGPLAAATASTITNPMDVIRARVQVEGKSSIINTFRQLMAEEGPWGLTKGLSARIISSTPSTIVIVVGYETLKKLSLRPEL 326          
BLAST of slc25a-15 vs. Ensembl Xenopus
Match: slc25a45 (solute carrier family 25 member 45 [Source:NCBI gene;Acc:100127755])

HSP 1 Score: 65.0846 bits (157), Expect = 3.300e-11
Identity = 67/277 (24.19%), Postives = 121/277 (43.68%), Query Frame = 3
Query:  183 YPISLIRTRLVMQHGNNLYTGMIHCARTILIKEGWKGLYNG--FFVKSIQLFSGMAYVGTYETIRFKLADFDFN-----PHT-RSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVKNCKFLKTVSVL------WREDRWFMFHKGLSARLTQSITYSFWIILFYE 971
            +P+  ++ RL  Q   + Y G++ C       E   G + G  F V S+ + + +A+ G+Y      L+D +       PH    F+AG F+  V  +   PVD+V   +    N+  S G+ +      +  + P+     VC  I  E GI G Y+G     +  IP+  L++  Y + C  ++ S   L+ P     + +   AG+      NP+D I+ R+Q+     ++ + +L       R++   +F KGL+    ++   +    L YE
Sbjct:   21 HPVDTVKVRLQTQ---SRYRGILDCVIQTYRNETIFGFFKGMSFPVGSVAISNSLAF-GSYSNALLYLSDQEIKNWKNPPHNCHVFMAGCFSGIVQLSFSAPVDLVKVRL---QNQTESFGNQARPGHLQARYQGPVH--CAVC--IFREEGIFGLYRGCLALALRDIPSMGLYFLTYEVLCKWMTKS---LDEPSAWTMLFAGGCAGTVGWAFANPMDVIKARLQMDGMHGVQYLGMLDCIRKSIRQEGVKVFLKGLTINSLRAFPVNAVTFLSYE 283          
BLAST of slc25a-15 vs. Ensembl Xenopus
Match: slc25a16 (solute carrier family 25 member 16 [Source:NCBI gene;Acc:100216243])

HSP 1 Score: 63.929 bits (154), Expect = 1.071e-10
Identity = 57/196 (29.08%), Postives = 87/196 (44.39%), Query Frame = 3
Query:  183 YPISLIRTRLVMQ-HGNNLYTGMIHCARTILIKEGW-KGLYNGFFVKSIQLFSGMA-YVG----TYETIRFKLADFDFNPHT-----------------RSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIR-GFYKGYAISMITFIPNSALWWGFYN 695
            YP+ ++R RL  Q  G + Y G+IH  +TI +KEG  +G Y G     +    GMA Y G    T+ET+  K A     P                    S + GG A A+ Q++  P+DV  + M            LS+I   + + +T       VC     ++GIR G Y+G +++ I  IP+ A+ +  Y 
Sbjct:  138 YPLDMVRARLAFQVKGEHRYNGIIHAFKTIYLKEGGIRGYYRGL----VPTIVGMAPYAGFSFFTFETL--KTAGLRHAPELLGKPSSDNPDVMVLKTHASLLCGGIAGAIAQSISYPLDVTRRRM-----------QLSAILPDSDKCRTMFQTLKYVCM----QHGIRRGLYRGLSLNYIRCIPSQAVAFTTYE 312          
BLAST of slc25a-15 vs. Ensembl Xenopus
Match: slc25a22l (solute carrier family 25 (mitochondrial carrier: glutamate), member 22 like [Source:NCBI gene;Acc:447993])

HSP 1 Score: 63.1586 bits (152), Expect = 1.730e-10
Identity = 63/246 (25.61%), Postives = 110/246 (44.72%), Query Frame = 3
Query:  174 TILYPISLIRTRLVMQ-HGNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTYETIRFKLADFDFNPH----------TRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKL-------------TNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWG-FYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQ 836
            T ++PI L +TRL  Q +G  +Y  M  C R  L  +G+ G+Y G  V        +  V   + I+    D+ F  H          ++  +AG  A      +  P++     M+ I  +D   G L++ K              T++  K   ++   + S +    GI+G YKG   +++  +P S +++  F NL  +KL  + S  + P  L    +  +AGS+AA+ ++P D I+ R+Q
Sbjct:   24 TCVFPIDLAKTRLQNQRNGQQIYKSMWDCLRKTLRSDGYFGMYRGAAVN-------LTLVTPEKAIKLAANDY-FRYHLSKTGSPLTLSKEMLAGCGAGVCQVIITTPME-----MLKIQLQD--AGRLAAQKTVKGIQCMAYNVGPTSAARKVSATQ---IASELLRTEGIKGLYKGLGATLLRDVPFSVIYFPLFANL--NKLGKASSDDKAP-FLYSFTAGCIAGSTAAVAVSPCDVIKTRLQ 248          
BLAST of slc25a-15 vs. Ensembl Xenopus
Match: pdgfd (platelet derived growth factor D [Source:Xenbase;Acc:XB-GENE-985911])

HSP 1 Score: 62.3882 bits (150), Expect = 3.698e-10
Identity = 68/274 (24.82%), Postives = 109/274 (39.78%), Query Frame = 3
Query:  174 TILYPISLIRTRLV-MQHGNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTYETIRFKLADFDFNPHT-----------RSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNS---ELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWG-FYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVKN--------CKFLKTVSVLWREDRWFMFHKGLSAR 923
            T ++PI L +TRL   Q+G  +YT M  C    +  EG+ G+Y G  V        +  V   + I  KLA  DF  H            +  +AG  A      +  P++++   +            L+S    NS   E  T     + +   +    GI G YKG   +++  +P S +++  F NL  +KL       + P   +  +S   AG +AA+ +NP D I+ R+Q              +     +WR +    F KG   R
Sbjct:   63 TCVFPIDLAKTRLQNQQNGQRMYTSMSDCLIKTIRSEGYFGMYRGAAVN-------LTLVTPEKAI--KLAANDFFRHALSKDGKKLTLLKEMLAGCGAGTCQVIVTTPMEMLKIQLQDAGRLAAQRKLLASQAGPNSAVAESITARPTAMQISRELLRSDGIAGLYKGLGATLLRDVPFSIIYFPLFANL--NKLGQKTPDGKSP-FYVSFLSGCAAGCTAAVAVNPCDVIKTRLQSLQRGINEDTYSGIIDCTRKIWRSEGPAAFLKGAYCR 324          
BLAST of slc25a-15 vs. Ensembl Mouse
Match: Slc25a44 (solute carrier family 25, member 44 [Source:MGI Symbol;Acc:MGI:2444391])

HSP 1 Score: 207.608 bits (527), Expect = 1.578e-63
Identity = 115/311 (36.98%), Postives = 170/311 (54.66%), Query Frame = 3
Query:   78 MDSAENFQVIEMHMLKKYMFFPLAGLGTFTVNTILYPISLIRTRLVMQHGNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTYETIRFKLADFDFNPHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQV--KNCKFLKTVSVLWREDRWFMFHKGLSARLTQSITYSFWIILFYEPIKYFCLKEDF 1004
            M+   N Q+IE   L K  F+      T  +   +YP +LIRTRL +Q G +LY G       IL  +G  GLY GF V +  L SG  YV TYE  R  +AD+  +   +S +AGG AS V Q++ VP+DVVSQH+M +  K   +G          +      +   +   I    G+RGFY+GY  S++T+IPNSA+WW FY+ Y ++LS  L   E P ++ Q +S PLA ++A+++ NP+D IR R+QV  K+   L    ++  E  W +  KGLSAR+  +   +  I++ YE +K   L+ + 
Sbjct:    1 MEDKRNIQIIEWEHLDKKKFYVFGVAMTMMIRVSVYPFTLIRTRLQVQKGKSLYHGTFDAFVKILRADGVAGLYRGFLVNTFTLISGQCYVTTYELTRKFVADYSQSNTVKSLVAGGSASLVAQSITVPIDVVSQHLM-MQRKGEKMGRFQVHGNLEGQGVIAFGQTKDIIRQILRADGLRGFYRGYVASLLTYIPNSAVWWPFYHFYAEQLSR-LCPQECPHIVFQAISGPLAAATASILTNPMDVIRTRVQVEGKSSIVLTFRQLMAEEGPWGLM-KGLSARIISATPSTIVIVVGYESLKKLSLRPEL 308          
BLAST of slc25a-15 vs. Ensembl Mouse
Match: Slc25a44 (solute carrier family 25, member 44 [Source:MGI Symbol;Acc:MGI:2444391])

HSP 1 Score: 207.608 bits (527), Expect = 1.578e-63
Identity = 115/311 (36.98%), Postives = 170/311 (54.66%), Query Frame = 3
Query:   78 MDSAENFQVIEMHMLKKYMFFPLAGLGTFTVNTILYPISLIRTRLVMQHGNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTYETIRFKLADFDFNPHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQV--KNCKFLKTVSVLWREDRWFMFHKGLSARLTQSITYSFWIILFYEPIKYFCLKEDF 1004
            M+   N Q+IE   L K  F+      T  +   +YP +LIRTRL +Q G +LY G       IL  +G  GLY GF V +  L SG  YV TYE  R  +AD+  +   +S +AGG AS V Q++ VP+DVVSQH+M +  K   +G          +      +   +   I    G+RGFY+GY  S++T+IPNSA+WW FY+ Y ++LS  L   E P ++ Q +S PLA ++A+++ NP+D IR R+QV  K+   L    ++  E  W +  KGLSAR+  +   +  I++ YE +K   L+ + 
Sbjct:    1 MEDKRNIQIIEWEHLDKKKFYVFGVAMTMMIRVSVYPFTLIRTRLQVQKGKSLYHGTFDAFVKILRADGVAGLYRGFLVNTFTLISGQCYVTTYELTRKFVADYSQSNTVKSLVAGGSASLVAQSITVPIDVVSQHLM-MQRKGEKMGRFQVHGNLEGQGVIAFGQTKDIIRQILRADGLRGFYRGYVASLLTYIPNSAVWWPFYHFYAEQLSR-LCPQECPHIVFQAISGPLAAATASILTNPMDVIRTRVQVEGKSSIVLTFRQLMAEEGPWGLM-KGLSARIISATPSTIVIVVGYESLKKLSLRPEL 308          
BLAST of slc25a-15 vs. Ensembl Mouse
Match: Slc25a44 (solute carrier family 25, member 44 [Source:MGI Symbol;Acc:MGI:2444391])

HSP 1 Score: 207.994 bits (528), Expect = 2.631e-63
Identity = 115/311 (36.98%), Postives = 170/311 (54.66%), Query Frame = 3
Query:   78 MDSAENFQVIEMHMLKKYMFFPLAGLGTFTVNTILYPISLIRTRLVMQHGNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTYETIRFKLADFDFNPHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQV--KNCKFLKTVSVLWREDRWFMFHKGLSARLTQSITYSFWIILFYEPIKYFCLKEDF 1004
            M+   N Q+IE   L K  F+      T  +   +YP +LIRTRL +Q G +LY G       IL  +G  GLY GF V +  L SG  YV TYE  R  +AD+  +   +S +AGG AS V Q++ VP+DVVSQH+M +  K   +G          +      +   +   I    G+RGFY+GY  S++T+IPNSA+WW FY+ Y ++LS  L   E P ++ Q +S PLA ++A+++ NP+D IR R+QV  K+   L    ++  E  W +  KGLSAR+  +   +  I++ YE +K   L+ + 
Sbjct:   20 MEDKRNIQIIEWEHLDKKKFYVFGVAMTMMIRVSVYPFTLIRTRLQVQKGKSLYHGTFDAFVKILRADGVAGLYRGFLVNTFTLISGQCYVTTYELTRKFVADYSQSNTVKSLVAGGSASLVAQSITVPIDVVSQHLM-MQRKGEKMGRFQVHGNLEGQGVIAFGQTKDIIRQILRADGLRGFYRGYVASLLTYIPNSAVWWPFYHFYAEQLSR-LCPQECPHIVFQAISGPLAAATASILTNPMDVIRTRVQVEGKSSIVLTFRQLMAEEGPWGLM-KGLSARIISATPSTIVIVVGYESLKKLSLRPEL 327          
BLAST of slc25a-15 vs. Ensembl Mouse
Match: Slc25a44 (solute carrier family 25, member 44 [Source:MGI Symbol;Acc:MGI:2444391])

HSP 1 Score: 152.14 bits (383), Expect = 3.250e-43
Identity = 81/209 (38.76%), Postives = 112/209 (53.59%), Query Frame = 3
Query:   78 MDSAENFQVIEMHMLKKYMFFPLAGLGTFTVNTILYPISLIRTRLVMQHGNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTYETIRFKLADFDFNPHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYC 704
            M+   N Q+IE   L K  F+      T  +   +YP +LIRTRL +Q G +LY G       IL  +G  GLY GF V +  L SG  YV TYE  R  +AD+  +   +S +AGG AS V Q++ VP+DVVSQH+M +  K   +G          +      +   +   I    G+RGFY+GY  S++T+IPNSA+WW FY+ Y 
Sbjct:   20 MEDKRNIQIIEWEHLDKKKFYVFGVAMTMMIRVSVYPFTLIRTRLQVQKGKSLYHGTFDAFVKILRADGVAGLYRGFLVNTFTLISGQCYVTTYELTRKFVADYSQSNTVKSLVAGGSASLVAQSITVPIDVVSQHLM-MQRKGEKMGRFQVHGNLEGQGVIAFGQTKDIIRQILRADGLRGFYRGYVASLLTYIPNSAVWWPFYHFYA 227          
BLAST of slc25a-15 vs. Ensembl Mouse
Match: Slc25a20 (solute carrier family 25 (mitochondrial carnitine/acylcarnitine translocase), member 20 [Source:MGI Symbol;Acc:MGI:1928738])

HSP 1 Score: 63.1586 bits (152), Expect = 1.332e-10
Identity = 66/293 (22.53%), Postives = 124/293 (42.32%), Query Frame = 3
Query:  147 AGLGTFTVNTILYPISLIRTRLVMQHGN-----NLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYV----GTYETIRFKLADFDFNPHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFY----NLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVKNC-----KFLKTVSVLWREDRWFMFHKGLSARLTQSITYSFWIILFYE 971
             G G   +  + +P+  ++ RL  Q  +      +Y+G + C R  L++EG  GLY G     I +    A      G  + ++ K  + + + + + F AG  +      ++ P + +                L  I+ ++ E K   S  +     +  E+GIRGFYKG  ++++  +P S +++  Y    NL+  +   S+S L +PR+L   V+   AG     +  P D ++ R Q          F   +  L RE+     +KG +A + ++   +    L +E
Sbjct:   17 GGFGGMCLVFVGHPLDTVKVRLQTQPPSLSGQPPMYSGTLDCFRKTLMREGITGLYRGMAAPIIGVTPMFAVCFFGFGLGKKLQQKSPEDELS-YPQLFTAGMLSGVFTTGIMTPGERIK--------------CLLQIQASSGENK--YSGTLDCAKKLYQEFGIRGFYKGTVLTLMRDVPASGMYFMTYEWLKNLFTPE-GKSVSDLSVPRIL---VAGGFAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIREEGVTSLYKGFNAVMIRAFPANAACFLGFE 288          
BLAST of slc25a-15 vs. UniProt/SwissProt
Match: sp|Q96H78|S2544_HUMAN (Solute carrier family 25 member 44 OS=Homo sapiens OX=9606 GN=SLC25A44 PE=2 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 1.493e-63
Identity = 117/311 (37.62%), Postives = 170/311 (54.66%), Query Frame = 3
Query:   78 MDSAENFQVIEMHMLKKYMFFPLAGLGTFTVNTILYPISLIRTRLVMQHGNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTYETIRFKLADFDFNPHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQV--KNCKFLKTVSVLWREDRWFMFHKGLSARLTQSITYSFWIILFYEPIKYFCLKEDF 1004
            M+   N Q+IE   L K  F+      T  +   +YP +LIRTRL +Q G +LY G       IL  +G  GLY GF V +  L SG  YV TYE  R  +AD+  +   +S +AGG AS V Q++ VP+DVVSQH+M +  K   +G          +      +   +   I    G+RGFY+GY  S++T+IPNSA+WW FY+ Y ++LS  L   E P ++ Q VS PLA ++A+++ NP+D IR R+QV  KN   L    ++  E  W +  KGLSAR+  +   +  I++ YE +K   L+ + 
Sbjct:    1 MEDKRNIQIIEWEHLDKKKFYVFGVAMTMMIRVSVYPFTLIRTRLQVQKGKSLYHGTFDAFIKILRADGITGLYRGFLVNTFTLISGQCYVTTYELTRKFVADYSQSNTVKSLVAGGSASLVAQSITVPIDVVSQHLM-MQRKGEKMGRFQVRGNPEGQGVVAFGQTKDIIRQILQADGLRGFYRGYVASLLTYIPNSAVWWPFYHFYAEQLSY-LCPKECPHIVFQAVSGPLAAATASILTNPMDVIRTRVQVEGKNSIILTFRQLMAEEGPWGLM-KGLSARIISATPSTIVIVVGYESLKKLSLRPEL 308          
BLAST of slc25a-15 vs. UniProt/SwissProt
Match: sp|Q5RD67|S2544_PONAB (Solute carrier family 25 member 44 OS=Pongo abelii OX=9601 GN=SLC25A44 PE=2 SV=2)

HSP 1 Score: 209.92 bits (533), Expect = 1.889e-63
Identity = 117/311 (37.62%), Postives = 170/311 (54.66%), Query Frame = 3
Query:   78 MDSAENFQVIEMHMLKKYMFFPLAGLGTFTVNTILYPISLIRTRLVMQHGNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTYETIRFKLADFDFNPHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQV--KNCKFLKTVSVLWREDRWFMFHKGLSARLTQSITYSFWIILFYEPIKYFCLKEDF 1004
            M+   N Q+IE   L K  F+      T  +   +YP +LIRTRL +Q G +LY G       IL  +G  GLY GF V +  L SG  YV TYE  R  +AD+  +   +S +AGG AS V Q++ VP+DVVSQH+M +  K   +G          +      +   +   I    G+RGFY+GY  S++T+IPNSA+WW FY+ Y ++LS  L   E P ++ Q VS PLA ++A+++ NP+D IR R+QV  KN   L    ++  E  W +  KGLSAR+  +   +  I++ YE +K   L+ + 
Sbjct:    1 MEDKRNIQIIEWEHLDKKKFYVFGVAMTMMIRVSVYPFTLIRTRLQVQKGKSLYHGTFDAFIKILRADGITGLYRGFLVNTFTLISGQCYVTTYELTRKFVADYSQSNTVKSLVAGGSASLVAQSITVPIDVVSQHLM-MQRKGEKMGRFQVRGNPEGQGVVAFGQTKDIIRQILRADGLRGFYRGYVASLLTYIPNSAVWWPFYHFYAEQLSY-LCPKECPHIVFQAVSGPLAAATASILTNPMDVIRTRVQVEGKNSIILTFRQLMAEEGPWGLM-KGLSARIISATPSTIVIVVGYESLKKLSLRPEL 308          
BLAST of slc25a-15 vs. UniProt/SwissProt
Match: sp|Q8BGF9|S2544_MOUSE (Solute carrier family 25 member 44 OS=Mus musculus OX=10090 GN=Slc25a44 PE=1 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 1.104e-62
Identity = 115/311 (36.98%), Postives = 170/311 (54.66%), Query Frame = 3
Query:   78 MDSAENFQVIEMHMLKKYMFFPLAGLGTFTVNTILYPISLIRTRLVMQHGNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTYETIRFKLADFDFNPHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQV--KNCKFLKTVSVLWREDRWFMFHKGLSARLTQSITYSFWIILFYEPIKYFCLKEDF 1004
            M+   N Q+IE   L K  F+      T  +   +YP +LIRTRL +Q G +LY G       IL  +G  GLY GF V +  L SG  YV TYE  R  +AD+  +   +S +AGG AS V Q++ VP+DVVSQH+M +  K   +G          +      +   +   I    G+RGFY+GY  S++T+IPNSA+WW FY+ Y ++LS  L   E P ++ Q +S PLA ++A+++ NP+D IR R+QV  K+   L    ++  E  W +  KGLSAR+  +   +  I++ YE +K   L+ + 
Sbjct:    1 MEDKRNIQIIEWEHLDKKKFYVFGVAMTMMIRVSVYPFTLIRTRLQVQKGKSLYHGTFDAFVKILRADGVAGLYRGFLVNTFTLISGQCYVTTYELTRKFVADYSQSNTVKSLVAGGSASLVAQSITVPIDVVSQHLM-MQRKGEKMGRFQVHGNLEGQGVIAFGQTKDIIRQILRADGLRGFYRGYVASLLTYIPNSAVWWPFYHFYAEQLSR-LCPQECPHIVFQAISGPLAAATASILTNPMDVIRTRVQVEGKSSIVLTFRQLMAEEGPWGLM-KGLSARIISATPSTIVIVVGYESLKKLSLRPEL 308          
BLAST of slc25a-15 vs. UniProt/SwissProt
Match: sp|Q54VX4|MCFJ_DICDI (Mitochondrial substrate carrier family protein J OS=Dictyostelium discoideum OX=44689 GN=mcfJ PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 2.277e-20
Identity = 91/337 (27.00%), Postives = 138/337 (40.95%), Query Frame = 3
Query:  123 KKYMF--FPLAGLGTFTVNTILYPISLIRTRLVMQHGNNL------YTGMIHCARTILIKEGWKGLYNGFFVKSIQ-LFSGMAYVGTYETIRFKL----ADFDFNPHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKL---------------SNSLSF------------LEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQV------KNCKFLKTVSVLWREDRWFMFHKGLSARLTQSITYSFWIILFYEPIKYFCLK 995
            K+Y F  F L G    +++ +++P+ +IRTRL +Q   N+      Y G     + ++  EG + LY GF       L S   Y G+YE ++       +D D +    + I+G  + A+   + VP DV +Q + I        GSLS  K               V   I  E GI+G YKG+  ++I  +P S +WWG Y +   KL               S+SL+             +E    +I  +S   A   A  I NP+D  + R+Q       +   F   +    R++      KGL   L  S  YS   I  YE +K   LK
Sbjct:   29 KRYYFYNFLLGG----SIDLLMFPLDVIRTRLQVQGSQNVIQSFPQYNGTFDGFKKLIRLEGKRALYKGFLTSECGYLCSRAIYFGSYEFVKQGFLKGRSDSDSDLLFVTTISGAISEALASVIWVPFDVATQSVQI-------QGSLSKPKYKGGS---------DVFKKIYGERGIKGLYKGFGATIIRNVPYSGIWWGTYEISKSKLTQFNIRQKLGLKERSSHSLAVSAEIDKNNPSHEVENEDPIIHFISGFFAAVFATSITNPLDVAKTRLQTGVFPENEKPNFYTIIKSTIRKEGIRALWKGLVPSLLTSTPYSMISIFLYEEVKKLSLK 345          
BLAST of slc25a-15 vs. UniProt/SwissProt
Match: sp|Q55E45|MCFE_DICDI (Mitochondrial substrate carrier family protein E OS=Dictyostelium discoideum OX=44689 GN=mcfE PE=3 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 1.652e-12
Identity = 75/298 (25.17%), Postives = 129/298 (43.29%), Query Frame = 3
Query:  168 VNTILYPISLIRTRLVMQH-GNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQL-------FSGMAYVGTYETIRFKLADFDFNPHTRSFIAGGF-ASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSH----IRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLS-----FLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVKNCKFLKTVSVLW-------REDRWFMFHKGLSARLTQSITYSFWIILFYEPIKYF 986
             ++I++P+  +R R+ ++  G + Y G  +    I+  EG   LY GF + +          F G  Y   + T R+      +   T +  + GF A A+G  + VP+D++ Q + +                TN++   P   +     H    I  E GIRG Y+G+  ++ T+ P   +++  Y      +S+ LS     +L IP    Q+ S   AG+ AA +  P+D I+ RIQV+     +    +W       +E+    F KG+ AR+      +   I  YE +KY 
Sbjct:   22 ADSIMHPVDTVRARVQIEKVGKSQYKGTFNALNQIIKNEGVSYLYKGFPIVATATVPAHALYFLGYEYSKQWVTDRY---GKKWGESTITHFSAGFVADALGSLIWVPMDIIKQRLQV---------------QTNTQKLNPNQTYYKGSFHAGKIILQEEGIRGLYRGFMPALATYGPFVGIYFSVYEKCKSTISSLLSKEKDQYLPIP---YQLGSGFFAGAFAAAVTCPLDVIKTRIQVQRSTEKQIYKGMWDSFKTILKEEGPKAFVKGMGARIWWIAPGNALTIASYEQLKYL 298          
BLAST of slc25a-15 vs. TrEMBL
Match: A0A0H3YKB3 (Slc25a-15 OS=Schmidtea mediterranea OX=79327 GN=slc25a-15 PE=2 SV=1)

HSP 1 Score: 654.44 bits (1687), Expect = 0.000e+0
Identity = 315/315 (100.00%), Postives = 315/315 (100.00%), Query Frame = 3
Query:   78 MDSAENFQVIEMHMLKKYMFFPLAGLGTFTVNTILYPISLIRTRLVMQHGNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTYETIRFKLADFDFNPHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVKNCKFLKTVSVLWREDRWFMFHKGLSARLTQSITYSFWIILFYEPIKYFCLKEDFKKTIKI 1022
            MDSAENFQVIEMHMLKKYMFFPLAGLGTFTVNTILYPISLIRTRLVMQHGNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTYETIRFKLADFDFNPHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVKNCKFLKTVSVLWREDRWFMFHKGLSARLTQSITYSFWIILFYEPIKYFCLKEDFKKTIKI
Sbjct:    1 MDSAENFQVIEMHMLKKYMFFPLAGLGTFTVNTILYPISLIRTRLVMQHGNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTYETIRFKLADFDFNPHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVKNCKFLKTVSVLWREDRWFMFHKGLSARLTQSITYSFWIILFYEPIKYFCLKEDFKKTIKI 315          
BLAST of slc25a-15 vs. TrEMBL
Match: A0A4S2L471 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009933 PE=3 SV=1)

HSP 1 Score: 310.071 bits (793), Expect = 3.697e-99
Identity = 156/359 (43.45%), Postives = 229/359 (63.79%), Query Frame = 3
Query:   90 ENFQVIEMHMLKKYMFFPLAGLGTFTVNTILYPISLIRTRLVMQHGNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTYETIRFKLADFDFNPHT-RSFIAGGFASAVGQTLVVPVDVVSQHMMIINN----------------------------------KDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLE----------------IPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVKNCKFLKTVSVLWRED--RWFMFHKGLSARLTQSITYSFWIILFYEPIKYFCLKEDFK 1007
            + F+VIE+ ML K  F+PL+GLG+FTV+++LYP+ L+R RL +Q G +LYTG+ H    IL +EG++GLY+G+FVKS Q+ S + Y  TYET+R   +       T RSFI GG AS + QT++VPVDV+SQH+M+++                                   +   V SLS I+L+ SEL T  +RF  V S++ H++GIRGFY GY IS+ TF+P+SA+WW FY+ +C  +++++S L+                +PRL IQ+++APLAG ++A ++NPIDC+R+R+QV N  F +T  +LW ++  RWF   KGLSARL Q+  +SFW+IL YEP+K FCLK +++
Sbjct:    6 DEFEVIELSMLDKRKFYPLSGLGSFTVHSMLYPLVLLRIRLQLQEGAHLYTGLAHATSCILREEGFRGLYSGYFVKSAQIISSVFYASTYETVRHMSSGIPGLSQTQRSFIGGGVASMLLQTVLVPVDVISQHLMVLSRTSSISPCSSSAPQAIAPTVKLKAKSSVQSVMTDVRLEQVRSLSPIRLSASELSTSWARFRAVTSYVAHKHGIRGFYNGYVISLFTFVPSSAMWWAFYDKFCRLIASTVSKLDDALFASNATNSSGSPLVPRLAIQLIAAPLAGIASAALVNPIDCVRVRMQVGNLSFRETTRILWAKEGIRWFA--KGLSARLLQTSVFSFWLILIYEPVKLFCLKNEYR 362          
BLAST of slc25a-15 vs. TrEMBL
Match: A0A4Z2DF95 (Solute carrier family 25 member 44 isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_001562 PE=3 SV=1)

HSP 1 Score: 304.294 bits (778), Expect = 4.241e-97
Identity = 151/350 (43.14%), Postives = 222/350 (63.43%), Query Frame = 3
Query:   93 NFQVIEMHMLKKYMFFPLAGLGTFTVNTILYPISLIRTRLVMQHGNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTYETIRFKLADFD-FNPHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIIN------------------NKDTSVGS-----LSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCD------------------KLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVKNCKFLKTVSVLWRED--RWFMFHKGLSARLTQSITYSFWIILFYEPIKYFCLKEDFKK 1010
            NF+V+E+ MLKK+MFFPL+GLG FT  T+LYP  L+RTRL +Q G  +Y G++H   +++ +EG++GLY+G+ ++S+ +FSG  YV TYE  R     F   +P  RSF+ G  AS V Q+  VP+DV+SQH+M++N                  N + S  S     L+ ++LT  E+ +   R  GV  +I+  +G++GFYKGY ISM TF+P+SALWW FY+ +C                    LS++     +PRL+IQ++SAPLAG S+A+I+NP+D  R+R+QV +  F ++V  LW+ D  RWF   KGLS RL Q+I +SFW++L YEP+K FCLK+D+++
Sbjct:    7 NFEVVELSMLKKHMFFPLSGLGNFTAQTVLYPFVLLRTRLQLQEGAQVYRGLVHAISSVVKEEGFRGLYSGYLIRSLHIFSGTIYVSTYEVARQACTVFPALSPVHRSFVGGAVASCVAQSFFVPIDVISQHLMVVNRNRVHAAMVSNFDSIKKRNPNLSFNSNHFHPLTPVQLTQKEMSSNWGRLRGVIRYIKQTHGLQGFYKGYVISMCTFVPSSALWWSFYDKFCSLIHFISKKIWVEPIQDSIVLSSNNESSPVPRLIIQLISAPLAGVSSAIIVNPLDVARVRMQVSHIPFKQSVINLWQSDGIRWFA--KGLSPRLVQTIFHSFWVVLVYEPMKLFCLKDDYRE 354          
BLAST of slc25a-15 vs. TrEMBL
Match: G4LUL1 (Mitochondrial carrier protein-related OS=Schistosoma mansoni OX=6183 GN=Smp_038840 PE=3 SV=1)

HSP 1 Score: 296.59 bits (758), Expect = 3.686e-94
Identity = 151/343 (44.02%), Postives = 222/343 (64.72%), Query Frame = 3
Query:   93 NFQVIEMHMLKKYMFFPLAGLGTFTVNTILYPISLIRTRLVMQHGNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTYETIRFKLADFD-FNPHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINN---------KDTSVGS-------LSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYC------------DKLSNSL------SFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVKNCKFLKTVSVLWRED--RWFMFHKGLSARLTQSITYSFWIILFYEPIKYFCLKEDFKK 1010
            NF+VIE+ MLKK+MFFPL+GLG FT  T+LYP  L+RTRL +Q G  +Y G++H   +++ +EG++GLY+G+ V+S  +FSG  YV TYE  R     F   +P  RSF+ G  AS V Q   VP+DVVSQH+M++N          K++++ S       L+ + LT +E+ +   R  GV  +I+  +G++GFYKG  ISM TF+P+SALWW FY+ +C            + + +S+          +PRLLIQ++SAPLAG S+A+I+NP+D +R+R+QV +  F ++V  LW+ +  RW  F KGLSARL Q+  +SFW++L YEP+K FCLK+D++ 
Sbjct:    7 NFEVIELSMLKKHMFFPLSGLGNFTAQTLLYPFVLLRTRLQLQEGAQVYRGLVHAISSVVKEEGFRGLYSGYLVRSFHIFSGTIYVSTYEVARQACTVFPTLSPIHRSFVGGAVASCVAQGFFVPIDVVSQHLMVVNCNRIHTNMVYKNSNLSSNPHRFRPLTPVHLTENEMNSNWGRLCGVIRYIKQTHGLKGFYKGCLISMCTFVPSSALWWSFYDKFCGLIHFISKKMCKEHVQDSVLLPSNDDSAPVPRLLIQLISAPLAGISSAIIVNPLDVVRVRMQVSHIPFKQSVIHLWQFEGIRW--FSKGLSARLIQTTFHSFWVVLVYEPMKLFCLKDDYRN 347          
BLAST of slc25a-15 vs. TrEMBL
Match: A0A2C9JCK2 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106079138 PE=3 SV=1)

HSP 1 Score: 269.24 bits (687), Expect = 8.623e-84
Identity = 149/330 (45.15%), Postives = 200/330 (60.61%), Query Frame = 3
Query:   84 SAENFQVIEMHMLKKYMFFPLAGLGTFTVNTILYPISLIRTRLVMQHGNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTYETIRFKLADF--DFNPHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKD--------TSVGSLSSIKLTNSE-----LKTPLSRFIGVCSHIRHEY---GIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVKNCKFLKTVSVLWREDRWFMFHKGLSARLTQSITYSFWIILFYEPIKYFCLKEDFKKTIK 1019
              E  QVIE+HM+ K  +FPL  L   T+ T+LYP  LI+TRL +Q GN +Y G       I+  EG  GLY GF+V  +QLF  MAY+ TYE  R  L +         RSF+ GG AS  GQTL VP+D++SQH+M++  ++        +     + IKL+N +      +  +SRF  V + IR  Y   G+ GFYKGY +S+  F PNSALWW FY+ Y    +  +    IPRL IQVV+APL+G SAALI NPID IR RIQV+  KF +TV  LW E+ +++  KGLSARL QS+T+S +IIL YE IK + + E +K  ++
Sbjct:    4 EVEEIQVIELHMMDKRKYFPLTLLSGLTIRTMLYPFVLIKTRLQIQKGNTVYRGTFDAFVKIVRNEGRTGLYRGFWVSCLQLFPSMAYISTYEGTRHYLKEHLGVTENSIRSFVGGGLASVTGQTLAVPIDIISQHLMLMGRREKCKDFSEWSKEERRAQIKLSNLQNIHLNERVSMSRFGAVNAIIRTIYKRDGLLGFYKGYFVSLACFAPNSALWWFFYDSYTVLFAGVIPTY-IPRLAIQVVAAPLSGVSAALITNPIDVIRARIQVEGTKFGETVRTLWTEEGYWLVTKGLSARLVQSVTFSIFIILGYETIKRWSILEQYKDKVR 332          
BLAST of slc25a-15 vs. Ensembl Cavefish
Match: slc25a44a (solute carrier family 25 member 44 [Source:NCBI gene;Acc:103036580])

HSP 1 Score: 217.238 bits (552), Expect = 3.227e-67
Identity = 119/315 (37.78%), Postives = 175/315 (55.56%), Query Frame = 3
Query:   78 MDSAENFQVIEMHMLKKYMFFPLAGLGTFTVNTILYPISLIRTRLVMQHGNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTYETIRFKLADFDFNPHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKD--TSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVK-NCKFLKTVSVLWREDRWFMFHKGLSARLTQSITYSFWIILFYEPIKYFCLKEDFKKT 1013
            M    N ++IE   L K  F+ L    T T    +YP +LIRTRL +Q G +LY G       IL  EG +GLY GF V +  L SG AY+ TYE +R  ++ +  +   +S +AGG AS V Q++ VP+DVVSQ +M+    +  T     S + +  S+ K    +   +   I    G RGFY+GY  S++T+IPNSALWW FY+ Y ++LS  L+    P LL+Q V+ P+A ++A+ I NP+D +R R+QV+     ++T   L  E+  +   KGLSAR+  S   S  I++ YE +K   L+ +   T
Sbjct:    1 MQQKRNIRIIEWEDLDKRKFYSLGVFMTLTTRATVYPFTLIRTRLQIQKGKSLYNGTFDAFCKILKAEGMQGLYRGFMVNTFTLISGQAYITTYELVRKYVSQYSSSNTLKSLVAGGSASLVAQSITVPIDVVSQQLMMQGQGEHLTRFKLKSKMVVATSKHKVTFGQTKDIMVQIFAADGFRGFYRGYVASLLTYIPNSALWWPFYHFYAEQLSR-LAPSNCPHLLLQAVAGPMAAATASTITNPMDVVRARVQVEGRSSVIETFKQLLAEEGMWGLTKGLSARIISSTPTSILIVIGYETLKRLSLRPELVHT 314          
BLAST of slc25a-15 vs. Ensembl Cavefish
Match: slc25a44b (solute carrier family 25 member 44b [Source:ZFIN;Acc:ZDB-GENE-050320-89])

HSP 1 Score: 196.823 bits (499), Expect = 1.200e-59
Identity = 96/255 (37.65%), Postives = 150/255 (58.82%), Query Frame = 3
Query:   78 MDSAENFQVIEMHMLKKYMFFPLAGLGTFTVNTILYPISLIRTRLVMQHGNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTYETIRFKLADFDFNPHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVK 842
            M    N Q+IE   L K  F+      T T+   +YP  LIRTRL +Q G +LY+G     R IL  EG +GLY GF V +  L SG AY+ TYE +R  ++++  +   +S +AGG AS V Q++ VP+DV+SQ +M+    +         K + ++ K    +   + + I    G RGFY+GY  S++T+IPNSA+WW FY+ Y ++LS  ++  + P L++Q ++ PLA ++A+ + NP+D +R R+QV+
Sbjct:    1 MQQKRNIQIIEWEDLDKRKFYSFGVFMTMTIRATVYPAMLIRTRLQVQKGKSLYSGTYDAFRKILRAEGVRGLYRGFMVNTFTLISGQAYITTYELVRKYVSNYSKDNTLKSLVAGGSASLVAQSITVPIDVISQQLMMQGQGEHLTRFKLKPKASGAKHKVTFCQTRDIIAQIFAADGFRGFYRGYVASLLTYIPNSAVWWPFYHFYAEQLSK-MAPSDCPHLILQAMAGPLAAATASTVTNPMDVVRARVQVE 254          
BLAST of slc25a-15 vs. Ensembl Cavefish
Match: slc25a44b (solute carrier family 25 member 44b [Source:ZFIN;Acc:ZDB-GENE-050320-89])

HSP 1 Score: 195.667 bits (496), Expect = 4.391e-58
Identity = 96/255 (37.65%), Postives = 150/255 (58.82%), Query Frame = 3
Query:   78 MDSAENFQVIEMHMLKKYMFFPLAGLGTFTVNTILYPISLIRTRLVMQHGNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTYETIRFKLADFDFNPHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVK 842
            M    N Q+IE   L K  F+      T T+   +YP  LIRTRL +Q G +LY+G     R IL  EG +GLY GF V +  L SG AY+ TYE +R  ++++  +   +S +AGG AS V Q++ VP+DV+SQ +M+    +         K + ++ K    +   + + I    G RGFY+GY  S++T+IPNSA+WW FY+ Y ++LS  ++  + P L++Q ++ PLA ++A+ + NP+D +R R+QV+
Sbjct:    1 MQQKRNIQIIEWEDLDKRKFYSFGVFMTMTIRATVYPAMLIRTRLQVQKGKSLYSGTYDAFRKILRAEGVRGLYRGFMVNTFTLISGQAYITTYELVRKYVSNYSKDNTLKSLVAGGSASLVAQSITVPIDVISQQLMMQGQGEHLTRFKLKPKASGAKHKVTFCQTRDIIAQIFAADGFRGFYRGYVASLLTYIPNSAVWWPFYHFYAEQLSK-MAPSDCPHLILQAMAGPLAAATASTVTNPMDVVRARVQVE 254          
BLAST of slc25a-15 vs. Ensembl Cavefish
Match: slc25a44b (solute carrier family 25 member 44b [Source:ZFIN;Acc:ZDB-GENE-050320-89])

HSP 1 Score: 196.052 bits (497), Expect = 1.720e-57
Identity = 96/255 (37.65%), Postives = 150/255 (58.82%), Query Frame = 3
Query:   78 MDSAENFQVIEMHMLKKYMFFPLAGLGTFTVNTILYPISLIRTRLVMQHGNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTYETIRFKLADFDFNPHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVK 842
            M    N Q+IE   L K  F+      T T+   +YP  LIRTRL +Q G +LY+G     R IL  EG +GLY GF V +  L SG AY+ TYE +R  ++++  +   +S +AGG AS V Q++ VP+DV+SQ +M+    +         K + ++ K    +   + + I    G RGFY+GY  S++T+IPNSA+WW FY+ Y ++LS  ++  + P L++Q ++ PLA ++A+ + NP+D +R R+QV+
Sbjct:    1 MQQKRNIQIIEWEDLDKRKFYSFGVFMTMTIRATVYPAMLIRTRLQVQKGKSLYSGTYDAFRKILRAEGVRGLYRGFMVNTFTLISGQAYITTYELVRKYVSNYSKDNTLKSLVAGGSASLVAQSITVPIDVISQQLMMQGQGEHLTRFKLKPKASGAKHKVTFCQTRDIIAQIFAADGFRGFYRGYVASLLTYIPNSAVWWPFYHFYAEQLSK-MAPSDCPHLILQAMAGPLAAATASTVTNPMDVVRARVQVE 254          
BLAST of slc25a-15 vs. Ensembl Cavefish
Match: SLC25A12 (solute carrier family 25 member 12 [Source:NCBI gene;Acc:103036993])

HSP 1 Score: 70.8626 bits (172), Expect = 8.448e-13
Identity = 72/283 (25.44%), Postives = 114/283 (40.28%), Query Frame = 3
Query:  138 FPLAGLGTFTVNTILYPISLIRTRLVMQH------GNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTYET-IRFKLADFDFN-PHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTS--VGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVKNCKFLKTVS-------VLWREDRWFMFHKGLSARLTQS 935
            F L  +   T  T +YPI L++TR+  Q       G  +Y     CA+ +L  EG+ G Y G   + I +    A   T    +R K  D D   P     +AGG A         P+++V   + +     T   V +L+ ++                      + G  G YKG     +  IP SA+++  Y     +L++    L   +LL    +  +AG  AA ++ P D I+ R+QV       T S        + RE+ +  F KG  AR+ +S
Sbjct:  230 FTLGSIAGATGATAVYPIDLVKTRMQNQRSTGSFVGELMYKNSFDCAKKVLRYEGFIGFYRGLLPQLIGVAPEKAIKLTVNDFVRDKFTDKDDTIPLAAEILAGGCAGGSQVIFTNPLEIVKIRLQVAGEIATGPRVSALTVVR----------------------DLGFLGLYKGAKACFLRDIPFSAIYFPVYAHAKIQLTDEEGRLGALQLL---TAGAIAGVPAASLVTPADVIKTRLQVAARAGQTTYSGVIDCFRKILREEGFSAFWKGAGARVCRS 487          
BLAST of slc25a-15 vs. Ensembl Sea Lamprey
Match: slc25a44a (solute carrier family 25 member 44a [Source:ZFIN;Acc:ZDB-GENE-041114-38])

HSP 1 Score: 214.542 bits (545), Expect = 7.756e-67
Identity = 116/316 (36.71%), Postives = 174/316 (55.06%), Query Frame = 3
Query:   78 MDSAENFQVIEMHMLKKYMFFPLAGLGTFTVNTILYPISLIRTRLVMQHGNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTYETIRFKLADFDFNPHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRF---IGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVKN-CKFLKTVSVLWREDRWFMFHKGLSARLTQSITYSFWIILFYEPIKYFCLKEDFKKT 1013
            M    N +VIE   L K  F+ L      +V   +YP +LIRTRL +Q G + Y G       IL +EG  GLY GF V ++ L SG  Y+ TYE +R + +    +   +S   GG AS V Q++ VP+DVVSQH+M+        G           L    ++F     +   IR   G+RGFY+GY  S++T+IP+SA+WW FY+LY ++LS S++    P L++Q V+ P+A  +A+++ NP+D IR R+QV+     L+ +  LW ++  + F KGLSAR+  S   S  ++L YE +K   L+ +   T
Sbjct:    1 MQEKRNIRVIEWADLDKRKFYSLGVFMMLSVRATVYPFTLIRTRLQVQRGRSQYRGTADAFIKILQREGVLGLYRGFAVNALTLVSGQFYITTYELVRDQASRLGADNTLKSVAGGGVASLVAQSITVPIDVVSQHLMMQGQAGEGGGRFKVQDHPKRGLNAHAAQFGQARDIVRQIRQVDGMRGFYRGYLASLLTYIPSSAVWWPFYHLYAEQLS-SMAPSNCPHLVLQAVAGPMASVTASVLTNPMDVIRTRLQVEGRSSILEALRQLWAQEGMWGFTKGLSARIASSAPTSMLVVLGYETLKRLSLRTELVHT 315          
BLAST of slc25a-15 vs. Ensembl Sea Lamprey
Match: slc25a23a (solute carrier family 25 member 23a [Source:ZFIN;Acc:ZDB-GENE-121214-154])

HSP 1 Score: 57.3806 bits (137), Expect = 3.293e-9
Identity = 50/204 (24.51%), Postives = 92/204 (45.10%), Query Frame = 3
Query:  105 IEMHMLKKYMFFPLAGLGTFTVNTILYPISLIRTRLVMQHGNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQL--FSGMAYVGTYETIR----FKLADFDFNPHTRSFIA-GGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYN 695
            + + + +++M   LAG    T  TI+YP+ +++TRL ++     Y+GM+ CA+ I +KEG    Y G+    I +  ++G+  +  YET++     K A    +P     +A G  +S+ GQ    P+ ++   M                +   S    P    +G+  +I    G  G Y+G A + +  IP  ++ +  Y 
Sbjct:  300 VSLGIHERFMAGSLAGA---TAQTIIYPMEVMKTRLTLRK-TGQYSGMMDCAKKIFMKEGVIAFYKGYVPNIIGIIPYAGID-LAIYETLKNTWLTKYAKDTADPGILVLLACGTVSSSCGQVASYPLALIRTRM----------------QAQASMEGGPQLSMVGLFRNIVKNDGPLGLYRGIAPNFMKVIPAVSISYVVYE 482          
BLAST of slc25a-15 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008980.1 (pep scaffold:Pmarinus_7.0:GL478832:29230:40541:-1 gene:ENSPMAG00000008118.1 transcript:ENSPMAT00000008980.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 1.920e-8
Identity = 68/286 (23.78%), Postives = 110/286 (38.46%), Query Frame = 3
Query:  174 TILYPISLIRTRLVMQH------GNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTY-ETIRFKLADFDFN-PHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVK------------NCKFLKTVSVLWREDRWFMFHKGLSARLTQSITYSFWIILFYE 971
            T +YPI L++TR+  Q       G  +Y     C + ++  EG  GLY G   + + +    A   T  + IR K    D + P     IAGG A         P+++V   + +              ++T     + L        ++  + G  G YKG     +  IP SA+++  Y       ++    +    LL    +  +AG  AA ++ P D I+ R+QV             +C F K +S       W    KG  AR+ +S       +L YE
Sbjct:    5 TAVYPIDLVKTRMQNQRSTGSFVGELMYKNSFDCFKKVVRYEGVFGLYRGLIPQLLGVAPEKAIKLTMNDLIRDKFTKRDKSIPLIGEIIAGGCAGGSQVIFTNPLEIVKIRLQVAG------------EITTGPRVSAL--------NVLRDLGFLGLYKGAKACFLRDIPFSAIYFPVYAHTKSSFADEKGHVGPLHLL---TAGAIAGMPAASLVTPADVIKTRLQVAARAGQTTYSGVIDC-FRKILSEEGPRALW----KGAGARVCRSSPQFGVTLLTYE 262          

HSP 2 Score: 46.9802 bits (110), Expect = 4.441e-6
Identity = 45/174 (25.86%), Postives = 78/174 (44.83%), Query Frame = 3
Query:  438 AVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVKN----CKFLKTVSVLWREDRWFMFHKGLSARLTQSITYS 947
            AVG T V P+D+V   M    +  + VG L          K     F  V   +R+E G+ G Y+G    ++   P  A+     +L  DK +       IP L+ ++++   AG S  +  NP++ +++R+QV         +  ++VL R+  +   +KG  A   + I +S
Sbjct:    1 AVGATAVYPIDLVKTRMQNQRSTGSFVGELM--------YKNSFDCFKKV---VRYE-GVFGLYRGLIPQLLGVAPEKAIKLTMNDLIRDKFTKRDK--SIP-LIGEIIAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSALNVL-RDLGFLGLYKGAKACFLRDIPFS 158          
BLAST of slc25a-15 vs. Ensembl Sea Lamprey
Match: slc25a4 (solute carrier family 25 member 4 [Source:ZFIN;Acc:ZDB-GENE-030131-5275])

HSP 1 Score: 52.373 bits (124), Expect = 4.895e-8
Identity = 45/158 (28.48%), Postives = 67/158 (42.41%), Query Frame = 3
Query:  180 LYPISLIRTRLVMQHG----NNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQ--LFSGMAYVGTYETIRFKLADFDFNPHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKG 635
            +YP+   RTRL    G       +TG+  C   I   +G++GLY GF V S+Q  +    AY G Y+T +  L D    P   S++     +AV      P D V + MM+ + +       + I  T +         I     I  + G R F+KG
Sbjct:   97 VYPLDFARTRLGADVGKGNAQREFTGLGDCLTKIFKSDGFRGLYQGFNV-SVQGIIIYRAAYFGIYDTAKGMLPDPKNTPIVVSWMIAQTVTAVSGFASYPFDTVRRRMMMQSGRKA-----ADIMYTGT---------IDCWRKIARQEGTRAFFKG 239          
BLAST of slc25a-15 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004577.1 (pep scaffold:Pmarinus_7.0:GL479453:699:15637:1 gene:ENSPMAG00000004140.1 transcript:ENSPMAT00000004577.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.373 bits (124), Expect = 7.475e-8
Identity = 45/188 (23.94%), Postives = 80/188 (42.55%), Query Frame = 3
Query:  153 LGTFTVNTILYPISLIRTRLVMQHGNNLYTGMIHCARTILIKEGWKGLYNGFF--VKSIQLFSGMAYVGTYETIR----FKLADFDFNPHTRSFI-AGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYN 695
            L   T  T++YP+ +++TRL +      Y+ M+ CAR I  +EG +  + G+   V  I  ++G+  + TYET++     K      NP     +     +S  GQ    P+ +V   M        S+G   + +             +G+   I  + G+ G Y+G A + +  IP   + +  Y 
Sbjct:  127 LAGATAQTVIYPMEVVKTRLALGK-TGQYSSMVDCARKIAKREGLRAFFKGYLPNVLGIIPYAGID-LATYETLKNWWLQKHGAEGANPGIAVLLCCATTSSTCGQLASYPLALVRTRM----QAAASIGGPGASQ----------PGMVGLMRSIVQQDGLLGLYRGIAPNFMKVIPAVGISYVVYE 298          

HSP 2 Score: 48.1358 bits (113), Expect = 1.777e-6
Identity = 40/201 (19.90%), Postives = 87/201 (43.28%), Query Frame = 3
Query:  408 RSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQV-KNCKFLKTVSV---LWREDRWFMFHKGLSARLTQSITYSFWIILFYEPIKYFCLKE 998
            R  +AGG A  V +T   P+D +   M +  ++  ++G                   +G  +H+  E G+R  ++G  +++I   P +A+ +  Y      +      + +   L   V+  LAG++A  ++ P++ ++ R+ + K  ++   V     + + +    F KG    +   I Y+   +  YE +K + L++
Sbjct:   26 RQLVAGGGAGVVSRTCTAPLDRLKVIMQVKASRHNTIG------------------VVGGLAHMIREGGVRSLWRGNGVNVIKIAPETAIKFMAYEQIKKLIGMRQEQIGVQERL---VAGSLAGATAQTVIYPMEVVKTRLALGKTGQYSSMVDCARKIAKREGLRAFFKGYLPNVLGIIPYAGIDLATYETLKNWWLQK 205          
BLAST of slc25a-15 vs. Ensembl Yeast
Match: MRS4 (Iron transporter of the mitochondrial carrier family; mediates Fe2+ transport across the inner mitochondrial membrane; active under low-iron conditions; may transport other cations; protein abundance increases in response to DNA replication stress; MRS4 has a paralog, MRS3, that arose from the whole genome duplication [Source:SGD;Acc:S000001760])

HSP 1 Score: 70.4774 bits (171), Expect = 5.432e-14
Identity = 71/294 (24.15%), Postives = 122/294 (41.50%), Query Frame = 3
Query:  171 NTILYPISLIRTRLVMQHGNNLY-TGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMA---YVGTYETIRFKL---ADFDFNPHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVK-----NCKFLKTVSVLWREDR-------WFMFHKGLSARLTQSITYSFWIILFYEPIKYFCLK 995
            +++++PI  ++TR+     N    TGMI     I   EG   L+ G  V+S+ L +G A   Y GTYE  + +L    D   +   ++ ++G  A+     L+ P D V Q + +    DT++                  R   V   I    G   FY  Y  ++   IP +A  +  Y       +   S+      LI  +   ++G++ A +  P+DCI+  +QV+     + + +K  +   R  R       W  F +GL  R+  +I  +      YE  K+F +K
Sbjct:   38 HSLMFPIDALKTRVQAAGLNKAASTGMISQISKISTMEGSMALWKG--VQSVILGAGPAHAVYFGTYEFCKARLISPEDMQTHQPMKTALSGTIATIAADALMNPFDTVKQRLQL----DTNL------------------RVWNVTKQIYQNEGFAAFYYSYPTTLAMNIPFAAFNFMIYESASKFFNPQNSY----NPLIHCLCGGISGATCAALTTPLDCIKTVLQVRGSETVSIEIMKDANTFGRASRAILEVHGWKGFWRGLKPRIVANIPATAISWTAYECAKHFLMK 303          

HSP 2 Score: 47.7506 bits (112), Expect = 1.605e-6
Identity = 41/198 (20.71%), Postives = 80/198 (40.40%), Query Frame = 3
Query:  399 PHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIIN-NKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVK-NCKFLKTVSVLWREDRWFMFHKGLSARLTQSITYSFWIILFYEPIKYF 986
            P     +AG FA  +  +L+ P+D +   +     NK  S G +S I                  S I    G    +KG    ++   P  A+++G Y  +C     S   ++  + +   +S  +A  +A  +MNP D ++ R+Q+  N +       +++ + +  F+      L  +I ++ +  + YE    F
Sbjct:   22 PLHSQLLAGAFAGIMEHSLMFPIDALKTRVQAAGLNKAASTGMISQI------------------SKISTMEGSMALWKGVQSVILGAGPAHAVYFGTYE-FCKARLISPEDMQTHQPMKTALSGTIATIAADALMNPFDTVKQRLQLDTNLRVWNVTKQIYQNEGFAAFYYSYPTTLAMNIPFAAFNFMIYESASKF 200          
BLAST of slc25a-15 vs. Ensembl Yeast
Match: AGC1 (Mitochondrial amino acid transporter; acts both as a glutamate uniporter and as an aspartate-glutamate exchanger; involved in nitrogen metabolism and nitrogen compound biosynthesis; human homolog SLC25A13 complements yeast null mutant [Source:SGD;Acc:S000006225])

HSP 1 Score: 70.8626 bits (172), Expect = 1.449e-13
Identity = 72/298 (24.16%), Postives = 121/298 (40.60%), Query Frame = 3
Query:  174 TILYPISLIRTRLVMQHGNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTYETIRFKLADFDFNPHTR---------SFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIPRLLIQ----VVSAPLAGSSAALIMNPIDCIRMRIQVKNCK-------FLKTVSVLWREDRWFMFHKGLSARLTQSITYSFWIILFYEPIKYFCLKEDFK 1007
            T++YPI  I+TR+  Q     Y   I C   I+ +EG KGLY+G       L   +  V   + I+  + DF  N  T            I+G  A A       P+++V   + +   +   VG   +I+  N              + I  + G+RG Y G A  ++  +P SA+++  Y      L +     +  R  ++    + +  +AG  AA +  P D I+ R+Q+   K           +  + +E+ +  F KG  AR+ +S     + +  YE  K F    D K
Sbjct:  546 TVVYPIDFIKTRMQAQRSLAQYKNSIDCLLKIISREGIKGLYSG-------LGPQLIGVAPEKAIKLTVNDFMRNRLTDKNGKLSLFPEIISGASAGACQVIFTNPLEIVKIRLQV---QSDYVG--ENIQQANE-----------TATQIVKKLGLRGLYNGVAACLMRDVPFSAIYFPTYAHLKKDLFDFDPNDKTKRNRLKTWELLTAGAIAGMPAAFLTTPFDVIKTRLQIDPRKGETKYNGIFHAIRTILKEESFRSFFKGGGARVLRSSPQFGFTLAAYELFKGFIPSPDNK 820          
BLAST of slc25a-15 vs. Ensembl Yeast
Match: MRS3 (Iron transporter, mediates Fe2+ transport across inner mito membrane; mitochondrial carrier family member; active under low-iron conditions; may transport other cations; MRS3 has a paralog, MRS4, that arose from the whole genome duplication [Source:SGD;Acc:S000003669])

HSP 1 Score: 66.6254 bits (161), Expect = 8.895e-13
Identity = 68/293 (23.21%), Postives = 122/293 (41.64%), Query Frame = 3
Query:  171 NTILYPISLIRTRLVMQHGNNLYT-GMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMA---YVGTYETIRFKLADF-DFNPHT--RSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVKNCK------------FLKTVSVLWREDRWFMFHKGLSARLTQSITYSFWIILFYEPIKYFCL 992
            +++++PI  ++TR+   +  +L    M+     I   EG   L+ G  V+S+ L +G A   Y GTYE  +  L D  D   H   ++ I+G  A+     L+ P D + Q + +    +TS     + K                   I    G+  FY  Y  +++  IP +A  +  Y      L+ S  +      LI  +   ++GS+ A I  P+DCI+  +Q++  +            F K  S +++   W  F +G   R+  ++  +      YE  K+F +
Sbjct:   48 HSVMFPIDALKTRIQSANAKSLSAKNMLSQISHISTSEGTLALWKG--VQSVILGAGPAHAVYFGTYEFCKKNLIDSSDTQTHHPFKTAISGACATTASDALMNPFDTIKQRIQL----NTSASVWQTTK------------------QIYQSEGLAAFYYSYPTTLVMNIPFAAFNFVIYESSTKFLNPSNEY----NPLIHCLCGSISGSTCAAITTPLDCIKTVLQIRGSQTVSLEIMRKADTFSKAASAIYQVYGWKGFWRGWKPRIVANMPATAISWTAYECAKHFLM 312          

HSP 2 Score: 51.6026 bits (122), Expect = 8.913e-8
Identity = 45/189 (23.81%), Postives = 77/189 (40.74%), Query Frame = 3
Query:  366 IRFKLADFD----FNPHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVKNCKFLKTVSVLWREDRWFMFHKGLSA 920
            I   L D++      P     IAG FA  +  +++ P+D +   +   N K  S  ++             LS+     SHI    G    +KG    ++   P  A+++G Y  +C K     S  +        +S   A +++  +MNP D I+ RIQ      L T + +W+  +     +GL+A
Sbjct:   17 IPMDLPDYEALPTHAPLYHQLIAGAFAGIMEHSVMFPIDALKTRIQSANAKSLSAKNM-------------LSQI----SHISTSEGTLALWKGVQSVILGAGPAHAVYFGTYE-FCKKNLIDSSDTQTHHPFKTAISGACATTASDALMNPFDTIKQRIQ------LNTSASVWQTTKQIYQSEGLAA 181          
BLAST of slc25a-15 vs. Ensembl Yeast
Match: MME1 (Transporter of the mitochondrial inner membrane that exports magnesium; involved in mitochondrial Mg2+ homeostasis; has similarity to human mitochondrial ATP-Mg/Pi carriers [Source:SGD;Acc:S000004776])

HSP 1 Score: 63.5438 bits (153), Expect = 1.585e-11
Identity = 59/245 (24.08%), Postives = 101/245 (41.22%), Query Frame = 3
Query:  147 AGLGTFTVNTILYPISLIRTRLVMQHGNNLYTGMIHCARTILIKEG-WKGLYNGFFVKSIQLFSGMA-YVGTYE-TIRFKLADFDFNPHTRSFIAGGFASAVGQTLVVPVDVVSQHMMI---INNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLY------CDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVKN 845
             G+G    ++ ++ +  ++TR         Y  MI   RTI ++EG  +GLY G+    +  F   A + GTYE T R  + D+  N       AG     +   + VP +V+   + +    NN     G         S L+  +   I        E G R  + GY  ++   +P SAL + FY  +       ++       L IP    ++++   AG  A +I  P+D ++ R+Q + 
Sbjct:   60 GGIGGKIGDSAMHSLDTVKTRQQGAPNVKKYRNMISAYRTIWLEEGVRRGLYGGYMAAMLGSFPSAAIFFGTYEYTKRTMIEDWQINDTITHLSAGFLGDFISSFVYVPSEVLKTRLQLQGRFNNPFFQSG------YNYSNLRNAIKTVI-------KEEGFRSLFFGYKATLARDLPFSALQFAFYEKFRQLAFKIEQKDGRDGELSIPN---EILTGACAGGLAGIITTPMDVVKTRVQTQQ 288          
BLAST of slc25a-15 vs. Ensembl Yeast
Match: ODC2 (Mitochondrial inner membrane transporter; 2-oxodicarboxylate transporter, exports 2-oxoadipate and 2-oxoglutarate from the mitochondrial matrix to the cytosol for use in lysine and glutamate biosynthesis and in lysine catabolism; ODC2 has a paralog, ODC1, that arose from the whole genome duplication [Source:SGD;Acc:S000005748])

HSP 1 Score: 61.2326 bits (147), Expect = 6.335e-11
Identity = 61/278 (21.94%), Postives = 120/278 (43.17%), Query Frame = 3
Query:  174 TILYPISLIRTRLVMQ----------HGNNLYTGMIHCARTILIKEGWKGLYNG----FFVKSIQLFSGMAYVGTYETIRFKLADFDFNPHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIP--RLLIQVVSAPLAGSSAALIMNPIDCIRMRIQ--------VKNCKF-LKTVSVLWREDRWFMFHKGLSARLTQ 932
            T++YP+ +++TR  ++               Y G+I C + I+ KEG+  LY G      +++ +  +  A    Y+ I   L + +      S  AG  A      ++VP +++   M  +  K + +G +  +K T                 I++E GI G YKG   +M      +ALW G Y     ++ NS+   +    +    +++  + G+   ++  P D ++ RIQ        VK   + L ++ V++RE+ +   +KG   ++ +
Sbjct:   28 TVMYPLDVVKTRFQLEVTTPTAAAVGKQVERYNGVIDCLKKIVKKEGFSRLYRGISSPMLMEAPKRATKFACNDQYQKIFKNLFNTNETTQKISIAAGASAGMTEAAVIVPFELIKIRMQDV--KSSYLGPMDCLKKT-----------------IKNE-GIMGLYKGIESTMW----RNALWNGGYFGVIYQVRNSMPVAKTKGQKTRNDLIAGAIGGTVGTMLNTPFDVVKSRIQSVDAVSSAVKKYNWCLPSLLVIYREEGFRALYKGFVPKVCR 281          
BLAST of slc25a-15 vs. Ensembl Nematostella
Match: EDO42357 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1Q1])

HSP 1 Score: 182.185 bits (461), Expect = 2.764e-54
Identity = 112/300 (37.33%), Postives = 157/300 (52.33%), Query Frame = 3
Query:  108 EMHMLKKYMFFPLAGLGTFTVNTILYPISLIRTRLVMQHGNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTYETIRFKLADFDFNPHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQV-KNCKFLKTVSVLWREDRWFMFHKGLSARLTQSITYSFWIILFYEPIKYFCLKEDF 1004
            +M   K Y F P   LG   +  +LYP +LI+ RL +Q    LY G +     ++  EG +GLY G+ V    LF+G  Y+ TYE +R K A +++    R F+AGG AS VGQT+ VPVD++SQ +MI    D  V      KL  + +         +     H++G  GFYKGY  S++T+ P+SA+WW  Y  Y   + N LS     RLL+   S  LAG +AA + NP+D IR R+QV      L T   L  E+      KGLSAR+      S  +++ YE IK   L+E+ 
Sbjct:   12 DMDKKKFYFFGPTLFLG---IRALLYPANLIKIRLQVQRKTTLYNGSLDAFTKVIRTEGVRGLYKGYLVSCAGLFAGQCYITTYELVRSKTAQYNYT--IRGFLAGGCASIVGQTITVPVDIISQKLMIQGQGDRKV------KLKGARI---------LIRETFHQHGPGGFYKGYFASLMTYAPSSAIWWASYGFYTGVIGN-LSADGTHRLLVLGSSGVLAGVTAATLTNPLDVIRTRLQVFGGTSMLVTFRSLLHEEGVAAVVKGLSARIISMAPSSLIMVVGYETIKKLSLREEL 290          
BLAST of slc25a-15 vs. Ensembl Nematostella
Match: EDO32924 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STR6])

HSP 1 Score: 147.902 bits (372), Expect = 2.072e-41
Identity = 97/305 (31.80%), Postives = 156/305 (51.15%), Query Frame = 3
Query:   90 ENFQVIEMHMLKKYMFFPLAGLGTFTVNTILYPISLIRTRLVMQHGNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTYETIRFKLADFDFNPHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIIN-NKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVKNCKFL-KTVSVLWREDRWFMFHKGLSARLTQSITYSFWIILFYEPIKYFCLKE 998
            E+ +VIE   L KY F+ L+      +   L+P  L++TRL +Q  +  Y G I   R I+  EG++GLY GF V  + L +G     +YE  R +L+ F      R FIAGG AS + Q+L  PV+V++Q +M+    K  + G    +                V  ++  E+GI GFY+G+ +S+I     S +WW  Y LY + +    +    P ++IQ +S  L+G +AA++ NP++ +R+R+QV+  K L +    L R +      KG+   +   +  S  +I+ YE +K   LKE
Sbjct:    3 EHVRVIEWSHLDKYKFYALSTAFYGGLGVALFPFDLVKTRLQVQKVDIRYNGTIDALRKIIRLEGFRGLYKGFAVSQLFLLTGNINSTSYEVTREQLSGFSV--AIRGFIAGGLASLIEQSLGNPVEVMAQRLMVEGTGKRRAKGVCRPVAFR-------------VVRNVYKEHGISGFYRGFLVSVINSSFWSGIWWASYGLYLE-MFGQYAPSGSPHVVIQGLSGALSGVTAAVLCNPLEIMRVRLQVEGGKSLTQAFKSLLRNEGALALTKGMLPSVISEVPTSMVMIIGYETLKKLSLKE 291          
BLAST of slc25a-15 vs. Ensembl Nematostella
Match: EDO29140 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4H4])

HSP 1 Score: 67.781 bits (164), Expect = 2.299e-12
Identity = 61/236 (25.85%), Postives = 103/236 (43.64%), Query Frame = 3
Query:  279 EGWKGLYNGFFVKSIQLFSGMAYVGTY--ETIRFKLADFDFNPHTR--SFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRH---EYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKL--------SNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVKNCK-------FLKTVSVLWREDRWFMFHKGLSA 920
            EG +GL++G     +++F   A V       I++   D D NPH     F++G  A  V      P+DVV   + +   +D S  S+S+              + G+ S +R    E GIRG YKG   S+++  P   +    Y++   KL        +NS +FL         V   +AG  A  +++P+D +R ++QV   +        L  + +LW++      + GL+A
Sbjct:  222 EGIRGLFSGNLTNCVRVFPTSAIVCLVYSRMIKYTPVDNDKNPHQPLWRFVSGATAGVVATASTHPLDVVRARLTV---QDMSTRSISN--------------YTGIVSALRRIHIEEGIRGLYKGLVPSLVSIAPFLGVQQSVYDIM--KLRALDSAFAANSGTFL---------VCGAIAGMIAQTVVHPLDVVRRQMQVDRGRSGSITQTSLSALKILWKQGGPRRIYAGLTA 429          

HSP 2 Score: 61.6178 bits (148), Expect = 1.972e-10
Identity = 47/173 (27.17%), Postives = 82/173 (47.40%), Query Frame = 3
Query:  183 YPISLIRTRLVMQHGNNL----YTGMIHCARTILIKEGWKGLYNGFF--VKSIQLFSGMAYVGTYETIRFKLADFDFNPHTRSF-IAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSV--GSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSA 674
            +P+ ++R RL +Q  +      YTG++   R I I+EG +GLY G    + SI  F G+     Y+ ++ +  D  F  ++ +F + G  A  + QT+V P+DVV + M +   +  S+   SLS++K+                  +  + G R  Y G   S +  +P +A
Sbjct:  286 HPLDVVRARLTVQDMSTRSISNYTGIVSALRRIHIEEGIRGLYKGLVPSLVSIAPFLGVQQ-SVYDIMKLRALDSAFAANSGTFLVCGAIAGMIAQTVVHPLDVVRRQMQVDRGRSGSITQTSLSALKI------------------LWKQGGPRRIYAGLTASYLKVMPAAA 439          
BLAST of slc25a-15 vs. Ensembl Nematostella
Match: EDO39381 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAE1])

HSP 1 Score: 67.3958 bits (163), Expect = 3.078e-12
Identity = 61/236 (25.85%), Postives = 103/236 (43.64%), Query Frame = 3
Query:  279 EGWKGLYNGFFVKSIQLFSGMAYVGTY--ETIRFKLADFDFNPHTR--SFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRH---EYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKL--------SNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVKNCK-------FLKTVSVLWREDRWFMFHKGLSA 920
            EG +GL++G     +++F   A V       I++   D D NPH     F++G  A  V      P+DVV   + +   +D S  S+S+              + G+ S +R    E GIRG YKG   S+++  P   +    Y++   KL        +NS +FL         V   +AG  A  +++P+D +R ++QV   +        L  + +LW++      + GL+A
Sbjct:  214 EGIRGLFSGNLTNCVRVFPTSAIVCLVYSRMIKYTPVDNDKNPHQPLWRFVSGATAGVVATASTHPLDVVRARLTV---QDMSTRSISN--------------YTGIVSALRRIHIEEGIRGLYKGLVPSLVSIAPFLGVQQSVYDIM--KLRALDSAFAANSGTFL---------VCGAIAGMIAQTVVHPLDVVRRQMQVDRGRSGSITQTSLSALKILWKQGGPRRIYAGLTA 421          

HSP 2 Score: 61.2326 bits (147), Expect = 2.430e-10
Identity = 47/173 (27.17%), Postives = 82/173 (47.40%), Query Frame = 3
Query:  183 YPISLIRTRLVMQHGNNL----YTGMIHCARTILIKEGWKGLYNGFF--VKSIQLFSGMAYVGTYETIRFKLADFDFNPHTRSF-IAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSV--GSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSA 674
            +P+ ++R RL +Q  +      YTG++   R I I+EG +GLY G    + SI  F G+     Y+ ++ +  D  F  ++ +F + G  A  + QT+V P+DVV + M +   +  S+   SLS++K+                  +  + G R  Y G   S +  +P +A
Sbjct:  278 HPLDVVRARLTVQDMSTRSISNYTGIVSALRRIHIEEGIRGLYKGLVPSLVSIAPFLGVQQ-SVYDIMKLRALDSAFAANSGTFLVCGAIAGMIAQTVVHPLDVVRRQMQVDRGRSGSITQTSLSALKI------------------LWKQGGPRRIYAGLTASYLKVMPAAA 431          
BLAST of slc25a-15 vs. Ensembl Nematostella
Match: EDO31058 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZ11])

HSP 1 Score: 65.4698 bits (158), Expect = 5.638e-12
Identity = 56/200 (28.00%), Postives = 91/200 (45.50%), Query Frame = 3
Query:  153 LGTFTVNTILYPISLIRTRLVMQHGNNL-YTGMIHCARTILIKEGW-KGLYNGFFVKSIQLFSGMAYVGTY--ETIRF-----KLADFDFNPHT--------RSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGI-RGFYKGYAISMITFIPNSALWWGFYNL 698
            L   T     YP+ ++R+RL  Q   +  YT +    R I +KEG  K LY GF    + +   M  +G Y  ET++      ++A  + NP T          F+ GG A AV QT+  P+DVV + M +        G++      N+ + T +        ++  + GI RG Y+G +I+ +   P  A+ +G Y +
Sbjct:   99 LAGMTACACTYPLDMVRSRLAFQVAQDQGYTTITQTIRCISVKEGGPKALYKGFVPTLLTIVPAMG-IGFYMFETMKAYFLETRIAFTNTNPDTLCPELSIIGGFVCGGVAGAVSQTIAYPLDVVRRRMQL-------AGAVPDGHKYNTCINTLV--------NVYKDDGIRRGLYRGLSINYLRVCPQVAIMFGVYEV 282          
BLAST of slc25a-15 vs. Ensembl Medaka
Match: slc25a44a (solute carrier family 25 member 44 [Source:NCBI gene;Acc:101172653])

HSP 1 Score: 214.542 bits (545), Expect = 3.591e-66
Identity = 124/316 (39.24%), Postives = 176/316 (55.70%), Query Frame = 3
Query:   78 MDSAENFQVIEMHMLKKYMFFPLAGLGTFTVNTILYPISLIRTRLVMQHGNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTYETIRFKLADFDFNPHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIK------LTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVKN-CKFLKTVSVLWREDRWFMFHKGLSARLTQSITYSFWIILFYEPIKYFCLKEDF 1004
            M      Q+IE   L K  F+ L    TFT     YP SLIRTRL +Q G  +Y+G       IL  EG +GLY GF V S  L SG AYV TYE +R  ++ +  +   +S + GG AS V QT+ VP+DVVSQH+MI      SV  LS  K      L  S+ K    +   +   I    G++GFY+GY  S++T+IP+SALWW FY+ Y ++L+  L+    P LL+Q ++ P+AG++A  I NP+D IR R+QV+     ++T   L  E+   +  KGLSAR+  S+  S  +++ YE +K   L+ + 
Sbjct:    1 MQQKGPIQIIEWEDLDKRKFYSLGVFMTFTSRATAYPASLIRTRLQVQKGKAVYSGTFDAFLKILRAEGVRGLYRGFMVNSFTLLSGQAYVTTYELVRKFVSHYSPSNTVKSLVGGGAASLVAQTITVPIDVVSQHLMIQGCH--SVSQLSRFKVKPKRVLAASKSKRTFGQAWDLTVQIYAADGVKGFYRGYVASLLTYIPSSALWWPFYHFYAEQLTL-LAPSAWPHLLLQALAGPMAGATAYTITNPLDVIRARVQVEGRSSIIETFKQLLAEEGAGIVTKGLSARILSSLPTSVLLVVGYETLKKLSLRAEL 313          
BLAST of slc25a-15 vs. Ensembl Medaka
Match: slc25a44b (solute carrier family 25 member 44 [Source:NCBI gene;Acc:101164463])

HSP 1 Score: 206.068 bits (523), Expect = 5.034e-63
Identity = 117/314 (37.26%), Postives = 179/314 (57.01%), Query Frame = 3
Query:   78 MDSAENFQVIEMHMLKKYMFFPLAGLGTFTVNTILYPISLIRTRLVMQHGNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTYETIRFKLADFDFNPHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLT-NSELKTPLSRF---IGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVK-NCKFLKTVSVLWREDRWFMFHKGLSARLTQSITYSFWIILFYEPIKYFCLKEDF 1004
            M    N Q+IE   L K  F+      T T+   +YP +LIRTRL +Q G +LY+G       IL  EG +GLY GF V +  L SG AY+ TYE +R  ++ +  +   +S +AGG AS V Q++ VP+DVVSQ +M+          L+  +LT NSE   P   F     + + I    G+ GFY+GY  S++T+IPNSA+WW FY+ Y ++LS  L+  + P LL+Q ++ PLA ++A+ + NP+D +R R+QV+     ++T   L +E+  +   KGLSAR+  S   +  +++ YE +K   L+ + 
Sbjct:    1 MQQKRNIQIIEWEDLDKRKFYSFGLFMTMTIRATVYPATLIRTRLQVQRGKSLYSGTFDAFFKILRAEGVRGLYRGFMVNTFTLISGQAYITTYELVRKYVSQYSDDNTVKSLVAGGSASLVAQSITVPIDVVSQQLMMQ----GQGQHLTRFRLTSNSETGKPKKVFGQTRNIMAQIFATDGLPGFYRGYVASLLTYIPNSAVWWPFYHFYAEQLSK-LAPSDCPHLLLQAMAGPLAAATASTVTNPMDVVRARVQVEGRTSVVETFKQLIQEEGCWGLTKGLSARIISSTPTAIVMVVGYETLKKLSLRPEL 309          
BLAST of slc25a-15 vs. Ensembl Medaka
Match: slc25a44a (solute carrier family 25 member 44 [Source:NCBI gene;Acc:101172653])

HSP 1 Score: 192.971 bits (489), Expect = 3.618e-58
Identity = 112/292 (38.36%), Postives = 155/292 (53.08%), Query Frame = 3
Query:   78 MDSAENFQVIEMHMLKKYMFFPLAGLGTFTVNTILYPISLIRTRLVMQHGNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTYETIRFKLADFDFNPHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIK------LTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVKNCKFLKTVS---------------VLWREDR 890
            M      Q+IE   L K  F+ L    TFT     YP SLIRTRL +Q G  +Y+G       IL  EG +GLY GF V S  L SG AYV TYE +R  ++ +  +   +S + GG AS V QT+ VP+DVVSQH+MI      SV  LS  K      L  S+ K    +   +   I    G++GFY+GY  S++T+IP+SALWW FY+ Y ++L+  L+    P LL+Q ++ P+AG++A  I NP+D IR R+Q    + +  +                  WR+DR
Sbjct:    1 MQQKGPIQIIEWEDLDKRKFYSLGVFMTFTSRATAYPASLIRTRLQVQKGKAVYSGTFDAFLKILRAEGVRGLYRGFMVNSFTLLSGQAYVTTYELVRKFVSHYSPSNTVKSLVGGGAASLVAQTITVPIDVVSQHLMIQGCH--SVSQLSRFKVKPKRVLAASKSKRTFGQAWDLTVQIYAADGVKGFYRGYVASLLTYIPSSALWWPFYHFYAEQLT-LLAPSAWPHLLLQALAGPMAGATAYTITNPLDVIRARVQAHAKQIMHHIRNSGRGPQTIRSELPWEQWRDDR 289          
BLAST of slc25a-15 vs. Ensembl Medaka
Match: slc25a22a (mitochondrial glutamate carrier 1 [Source:NCBI gene;Acc:101168864])

HSP 1 Score: 68.5514 bits (166), Expect = 2.016e-12
Identity = 65/265 (24.53%), Postives = 113/265 (42.64%), Query Frame = 3
Query:  174 TILYPISLIRTRLV-MQHGNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTYETIRFKLADFDFNPH---------TRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSL-SSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFY----NLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVKN-CKFLKTVSVLWREDRWFMFHKGLSA 920
            T ++PI L +TRL   Q+G+ LYT M  C    +  EG+ G+Y G  V        +  V   + I+    DF F  H          +  +AG  A      +  P++++   +            +  ++     E K+P +  + +   +  E GI G YKG   +++  +P S +++  +    N+    +     F       +  +S  LAGS+AA+ +NP+D I+ R+Q  N      T S +    R  M ++G SA
Sbjct:   24 TCVFPIDLAKTRLQNQQNGSRLYTSMSDCLIKTIRSEGYFGMYRGAAVN-------LTLVTPEKAIKLAANDF-FRQHLSKDGKLTLVKEMLAGCGAGTCQVIVTTPMEMLKIQLQDAGRIAAQRKLMPETVAAGTVETKSPTA--MQLTRQLLQEKGIAGLYKGLGATLLRDVPFSIIYFPLFANLNNIGKKDVDGPAPFY------VSFISGCLAGSTAAVAVNPVDVIKTRLQSLNRASTEDTYSGVTDCIRKIMRNEGPSA 272          
BLAST of slc25a-15 vs. Ensembl Medaka
Match: slc25a12 (calcium-binding mitochondrial carrier protein Aralar1 [Source:NCBI gene;Acc:101159534])

HSP 1 Score: 66.2402 bits (160), Expect = 2.973e-11
Identity = 74/299 (24.75%), Postives = 120/299 (40.13%), Query Frame = 3
Query:  129 YMFFPLAGLGTFTVNTILYPISLIRTRLVMQH------GNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMA---YVGTYETIRFKLADFDFNPHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTS--VGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVKNCKFLKTVS-------VLWREDRWFMFHKGLSARLTQSITYSFWIILFYE 971
            Y FF L  +   T  T +YPI L++TR+  Q       G  +Y     CA+ +L  EG+ G Y G   + I +    A    V  +   +F   D D  P     +AGG A A       P+++V   + +     T   V +LS ++                      + G  G YKG     +  IP SA+++  Y     +L++    L   +LL    +  +AG  AA ++ P D I+ R+QV       T +        + +E+ +    KG  AR+ +S       ++ YE
Sbjct:  329 YRFF-LGSIAGATGATAVYPIDLVKTRMQNQRSTGSFVGELMYKNSFDCAKKVLRYEGFFGFYRGLVPQLIGVAPEKAIKLTVNDFVRDKFTQKD-DTIPLFAEIMAGGCAGASQVIFTNPLEIVKIRLQVAGEITTGPRVSALSVVR----------------------DLGFFGLYKGAKACFLRDIPFSAIYFPMYAHTKTQLADENGRLGALQLL---TAGAIAGVPAASLVTPADVIKTRLQVAARAGQTTYTGVIDCFRKIMKEEGFRALWKGAGARMCRSSPQFGVTLVTYE 600          
BLAST of slc25a-15 vs. Planmine SMEST
Match: SMESG000010513.1 (SMESG000010513.1)

HSP 1 Score: 654.44 bits (1687), Expect = 0.000e+0
Identity = 315/315 (100.00%), Postives = 315/315 (100.00%), Query Frame = 3
Query:   78 MDSAENFQVIEMHMLKKYMFFPLAGLGTFTVNTILYPISLIRTRLVMQHGNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTYETIRFKLADFDFNPHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVKNCKFLKTVSVLWREDRWFMFHKGLSARLTQSITYSFWIILFYEPIKYFCLKEDFKKTIKI 1022
            MDSAENFQVIEMHMLKKYMFFPLAGLGTFTVNTILYPISLIRTRLVMQHGNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTYETIRFKLADFDFNPHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVKNCKFLKTVSVLWREDRWFMFHKGLSARLTQSITYSFWIILFYEPIKYFCLKEDFKKTIKI
Sbjct:    1 MDSAENFQVIEMHMLKKYMFFPLAGLGTFTVNTILYPISLIRTRLVMQHGNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTYETIRFKLADFDFNPHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVKNCKFLKTVSVLWREDRWFMFHKGLSARLTQSITYSFWIILFYEPIKYFCLKEDFKKTIKI 315          
BLAST of slc25a-15 vs. Planmine SMEST
Match: SMESG000069729.1 (SMESG000069729.1)

HSP 1 Score: 67.3958 bits (163), Expect = 3.069e-12
Identity = 74/271 (27.31%), Postives = 114/271 (42.07%), Query Frame = 3
Query:  174 TILYPISLIRTRLV-MQHGNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLF-----SGMAYVGT-YETIRFKLADFDFNPHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQ-------------VKNCKFLKTVSVLWREDRWFMFHKGLSARL 926
            T +YPI L++TRL   Q G  LY GM  CA+     EG+  +Y G    ++ LF       +  VG  +     K      NP  R  IAGG A A    +  P++++      I  +D      + IK      K   SR   +  ++  E GI G YKG   + +  +  SA+++  +  + +KL       +         S  LAG  A+L +NP D ++ R+Q             + +C F KT +     + W  F KG S R+
Sbjct:   27 TCVYPIDLVKTRLQNQQSGVKLYNGMFDCAKKTFKSEGFFKMYRG---SAVNLFLITPEKAIKLVGNDFFRYHLKPTGKPLNP-LREMIAGGGAGACQIIVTTPMELLK-----IQLQDE---GRTRIKGQTGATKASASR---IALNLLKEKGIFGLYKGMGATFLRDVTFSAIYFPLFANF-NKLGPQRENGKGTVFYWSFGSGCLAGCIASLSVNPFDVVKTRLQTLKKIEGEQEFTGIFDC-FKKTFTT----EGWKAFFKGASCRI 276          
BLAST of slc25a-15 vs. Planmine SMEST
Match: SMESG000002626.1 (SMESG000002626.1)

HSP 1 Score: 64.6994 bits (156), Expect = 4.981e-11
Identity = 83/319 (26.02%), Postives = 135/319 (42.32%), Query Frame = 3
Query:   81 DSAENFQVIEMHMLKKYMFFPLAGLGTFTVNTILYPISLIRTRLVMQH-----GNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTYETIRFKLADF--------DFN-PHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVKNCKFLKTVS-------VLWREDRWFMFHKGLSARLTQSITYSFWIILF-YE 971
            ++A   + + +  L++   F L G+      T +YPI L++TR+  Q      G  +Y     C + ++  EG+ GLY G    + QL      V   + I+  + DF        D N P     ++GG A         P+++V   + +        G ++S K             +    H+R E G  G YKG     +  IP SA+++  YN      ++    +  P  L+  V+A +AG+ AA +  P D I+ R+QV       T S        +WRE+    F KG  AR+ +S +  F + LF YE
Sbjct:   88 EAAGKGRTVFISALEQMYRFTLGGVAGALGATTVYPIDLVKTRMQNQRLGSIVGELMYKDSFDCFKKVVRFEGFLGLYRGL---APQLLG----VAPEKAIKLTMNDFMKDQLTPPDGNIPLWAECVSGGIAGGCQVIFTNPLEIVKIRLQV-------AGEIASAKR------------VAALHHVR-ELGFMGLYKGARACFLRDIPFSAIYFPAYNHLKMAFADE-DGINTPASLL--VAATIAGAPAAFLCTPADVIKTRLQVVARSGQTTYSGVFDATRKIWREEGGRAFWKGGPARVFRS-SPQFGVTLFAYE 375          
BLAST of slc25a-15 vs. Planmine SMEST
Match: SMESG000002626.1 (SMESG000002626.1)

HSP 1 Score: 64.3142 bits (155), Expect = 7.391e-11
Identity = 83/319 (26.02%), Postives = 135/319 (42.32%), Query Frame = 3
Query:   81 DSAENFQVIEMHMLKKYMFFPLAGLGTFTVNTILYPISLIRTRLVMQH-----GNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTYETIRFKLADF--------DFN-PHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVKNCKFLKTVS-------VLWREDRWFMFHKGLSARLTQSITYSFWIILF-YE 971
            ++A   + + +  L++   F L G+      T +YPI L++TR+  Q      G  +Y     C + ++  EG+ GLY G    + QL      V   + I+  + DF        D N P     ++GG A         P+++V   + +        G ++S K             +    H+R E G  G YKG     +  IP SA+++  YN      ++    +  P  L+  V+A +AG+ AA +  P D I+ R+QV       T S        +WRE+    F KG  AR+ +S +  F + LF YE
Sbjct:  132 EAAGKGRTVFISALEQMYRFTLGGVAGALGATTVYPIDLVKTRMQNQRLGSIVGELMYKDSFDCFKKVVRFEGFLGLYRGL---APQLLG----VAPEKAIKLTMNDFMKDQLTPPDGNIPLWAECVSGGIAGGCQVIFTNPLEIVKIRLQV-------AGEIASAKR------------VAALHHVR-ELGFMGLYKGARACFLRDIPFSAIYFPAYNHLKMAFADE-DGINTPASLL--VAATIAGAPAAFLCTPADVIKTRLQVVARSGQTTYSGVFDATRKIWREEGGRAFWKGGPARVFRS-SPQFGVTLFAYE 419          
BLAST of slc25a-15 vs. Planmine SMEST
Match: SMESG000002626.1 (SMESG000002626.1)

HSP 1 Score: 63.5438 bits (153), Expect = 1.377e-10
Identity = 83/319 (26.02%), Postives = 135/319 (42.32%), Query Frame = 3
Query:   81 DSAENFQVIEMHMLKKYMFFPLAGLGTFTVNTILYPISLIRTRLVMQH-----GNNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTYETIRFKLADF--------DFN-PHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSLSSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSALWWGFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRMRIQVKNCKFLKTVS-------VLWREDRWFMFHKGLSARLTQSITYSFWIILF-YE 971
            ++A   + + +  L++   F L G+      T +YPI L++TR+  Q      G  +Y     C + ++  EG+ GLY G    + QL      V   + I+  + DF        D N P     ++GG A         P+++V   + +        G ++S K             +    H+R E G  G YKG     +  IP SA+++  YN      ++    +  P  L+  V+A +AG+ AA +  P D I+ R+QV       T S        +WRE+    F KG  AR+ +S +  F + LF YE
Sbjct:  317 EAAGKGRTVFISALEQMYRFTLGGVAGALGATTVYPIDLVKTRMQNQRLGSIVGELMYKDSFDCFKKVVRFEGFLGLYRGL---APQLLG----VAPEKAIKLTMNDFMKDQLTPPDGNIPLWAECVSGGIAGGCQVIFTNPLEIVKIRLQV-------AGEIASAKR------------VAALHHVR-ELGFMGLYKGARACFLRDIPFSAIYFPAYNHLKMAFADE-DGINTPASLL--VAATIAGAPAAFLCTPADVIKTRLQVVARSGQTTYSGVFDATRKIWREEGGRAFWKGGPARVFRS-SPQFGVTLFAYE 604          
The following BLAST results are available for this feature:
BLAST of slc25a-15 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC25A443.109e-6437.62solute carrier family 25 member 44 [Source:HGNC Sy... [more]
SLC25A443.272e-6236.79solute carrier family 25 member 44 [Source:HGNC Sy... [more]
SLC25A232.258e-1226.24solute carrier family 25 member 23 [Source:HGNC Sy... [more]
SLC25A231.788e-1127.04solute carrier family 25 member 23 [Source:HGNC Sy... [more]
SLC25A391.836e-1127.87solute carrier family 25 member 39 [Source:HGNC Sy... [more]
back to top
BLAST of slc25a-15 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F13G3.73.067e-4731.33pep chromosome:WBcel235:I:7304918:7307006:1 gene:W... [more]
F13G3.73.067e-4731.33pep chromosome:WBcel235:I:7305004:7307010:1 gene:W... [more]
F13G3.73.688e-4731.71pep chromosome:WBcel235:I:7305004:7307006:1 gene:W... [more]
Y43C5B.34.705e-3828.04pep chromosome:WBcel235:IV:10353167:10355120:1 gen... [more]
hpo-128.927e-1127.46pep chromosome:WBcel235:IV:12283174:12285065:1 gen... [more]
back to top
BLAST of slc25a-15 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG58051.166e-7438.87gene:FBgn0039223 transcript:FBtr0084743[more]
CG58051.166e-7438.87gene:FBgn0039223 transcript:FBtr0339255[more]
aralar15.051e-1224.68gene:FBgn0028646 transcript:FBtr0306586[more]
aralar15.373e-1224.68gene:FBgn0028646 transcript:FBtr0085692[more]
aralar16.130e-1224.68gene:FBgn0028646 transcript:FBtr0330290[more]
back to top
BLAST of slc25a-15 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a44b2.095e-6738.05solute carrier family 25 member 44b [Source:ZFIN;A... [more]
slc25a44a5.729e-6636.45solute carrier family 25 member 44a [Source:ZFIN;A... [more]
slc25a15a1.299e-1122.54solute carrier family 25 member 15a [Source:ZFIN;A... [more]
slc25a15a1.299e-1122.54solute carrier family 25 member 15a [Source:ZFIN;A... [more]
slc25a22a1.981e-1124.80solute carrier family 25 member 22a [Source:ZFIN;A... [more]
back to top
BLAST of slc25a-15 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a448.641e-6538.06solute carrier family 25 member 44 [Source:NCBI ge... [more]
slc25a453.300e-1124.19solute carrier family 25 member 45 [Source:NCBI ge... [more]
slc25a161.071e-1029.08solute carrier family 25 member 16 [Source:NCBI ge... [more]
slc25a22l1.730e-1025.61solute carrier family 25 (mitochondrial carrier: g... [more]
pdgfd3.698e-1024.82platelet derived growth factor D [Source:Xenbase;A... [more]
back to top
BLAST of slc25a-15 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc25a441.578e-6336.98solute carrier family 25, member 44 [Source:MGI Sy... [more]
Slc25a441.578e-6336.98solute carrier family 25, member 44 [Source:MGI Sy... [more]
Slc25a442.631e-6336.98solute carrier family 25, member 44 [Source:MGI Sy... [more]
Slc25a443.250e-4338.76solute carrier family 25, member 44 [Source:MGI Sy... [more]
Slc25a201.332e-1022.53solute carrier family 25 (mitochondrial carnitine/... [more]
back to top
BLAST of slc25a-15 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96H78|S2544_HUMAN1.493e-6337.62Solute carrier family 25 member 44 OS=Homo sapiens... [more]
sp|Q5RD67|S2544_PONAB1.889e-6337.62Solute carrier family 25 member 44 OS=Pongo abelii... [more]
sp|Q8BGF9|S2544_MOUSE1.104e-6236.98Solute carrier family 25 member 44 OS=Mus musculus... [more]
sp|Q54VX4|MCFJ_DICDI2.277e-2027.00Mitochondrial substrate carrier family protein J O... [more]
sp|Q55E45|MCFE_DICDI1.652e-1225.17Mitochondrial substrate carrier family protein E O... [more]
back to top
BLAST of slc25a-15 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YKB30.000e+0100.00Slc25a-15 OS=Schmidtea mediterranea OX=79327 GN=sl... [more]
A0A4S2L4713.697e-9943.45Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4Z2DF954.241e-9743.14Solute carrier family 25 member 44 isoform 2 OS=Sc... [more]
G4LUL13.686e-9444.02Mitochondrial carrier protein-related OS=Schistoso... [more]
A0A2C9JCK28.623e-8445.15Uncharacterized protein OS=Biomphalaria glabrata O... [more]
back to top
BLAST of slc25a-15 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a44a3.227e-6737.78solute carrier family 25 member 44 [Source:NCBI ge... [more]
slc25a44b1.200e-5937.65solute carrier family 25 member 44b [Source:ZFIN;A... [more]
slc25a44b4.391e-5837.65solute carrier family 25 member 44b [Source:ZFIN;A... [more]
slc25a44b1.720e-5737.65solute carrier family 25 member 44b [Source:ZFIN;A... [more]
SLC25A128.448e-1325.44solute carrier family 25 member 12 [Source:NCBI ge... [more]
back to top
BLAST of slc25a-15 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a44a7.756e-6736.71solute carrier family 25 member 44a [Source:ZFIN;A... [more]
slc25a23a3.293e-924.51solute carrier family 25 member 23a [Source:ZFIN;A... [more]
ENSPMAT00000008980.11.920e-823.78pep scaffold:Pmarinus_7.0:GL478832:29230:40541:-1 ... [more]
slc25a44.895e-828.48solute carrier family 25 member 4 [Source:ZFIN;Acc... [more]
ENSPMAT00000004577.17.475e-823.94pep scaffold:Pmarinus_7.0:GL479453:699:15637:1 gen... [more]
back to top
BLAST of slc25a-15 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
MRS45.432e-1424.15Iron transporter of the mitochondrial carrier fami... [more]
AGC11.449e-1324.16Mitochondrial amino acid transporter; acts both as... [more]
MRS38.895e-1323.21Iron transporter, mediates Fe2+ transport across i... [more]
MME11.585e-1124.08Transporter of the mitochondrial inner membrane th... [more]
ODC26.335e-1121.94Mitochondrial inner membrane transporter; 2-oxodic... [more]
back to top
BLAST of slc25a-15 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO423572.764e-5437.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329242.072e-4131.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO291402.299e-1225.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO393813.078e-1225.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO310585.638e-1228.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc25a-15 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc25a44a3.591e-6639.24solute carrier family 25 member 44 [Source:NCBI ge... [more]
slc25a44b5.034e-6337.26solute carrier family 25 member 44 [Source:NCBI ge... [more]
slc25a44a3.618e-5838.36solute carrier family 25 member 44 [Source:NCBI ge... [more]
slc25a22a2.016e-1224.53mitochondrial glutamate carrier 1 [Source:NCBI gen... [more]
slc25a122.973e-1124.75calcium-binding mitochondrial carrier protein Aral... [more]
back to top
BLAST of slc25a-15 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000010513.10.000e+0100.00SMESG000010513.1[more]
SMESG000069729.13.069e-1227.31SMESG000069729.1[more]
SMESG000002626.14.981e-1126.02SMESG000002626.1[more]
SMESG000002626.17.391e-1126.02SMESG000002626.1[more]
SMESG000002626.11.377e-1026.02SMESG000002626.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30022160
GenBankAKN21583.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022160 ID=SMED30022160|Name=slc25a-15|organism=Schmidtea mediterranea sexual|type=transcript|length=1255bp
TATAGATTAAGAATTATAATTTCAAATTTTGTTATATAAATTGCATAATG
ACATTTATATGTTAATGATTTATTTGAATGGATTCAGCCGAAAACTTCCA
AGTCATTGAAATGCATATGCTTAAAAAGTACATGTTTTTTCCTTTGGCTG
GATTAGGAACATTTACTGTAAATACAATTCTGTATCCGATATCGTTAATA
AGAACGAGATTAGTTATGCAACATGGTAATAATTTATACACAGGAATGAT
ACATTGTGCAAGAACTATATTAATCAAGGAAGGATGGAAGGGATTATATA
ATGGGTTTTTCGTAAAATCTATTCAGTTATTTTCAGGAATGGCATATGTT
GGAACTTATGAAACAATCAGATTTAAATTGGCAGATTTTGACTTTAATCC
ACACACACGTTCTTTCATAGCTGGAGGATTTGCATCGGCAGTCGGACAGA
CATTAGTAGTGCCAGTCGATGTCGTGTCGCAGCATATGATGATCATCAAC
AATAAGGACACAAGTGTTGGCAGTCTCAGTTCTATTAAACTAACAAATTC
CGAATTAAAGACACCATTATCAAGATTTATTGGAGTTTGTTCTCATATCA
GACATGAATACGGAATTCGCGGTTTCTATAAGGGTTACGCTATCTCGATG
ATAACATTCATTCCCAATAGTGCTCTCTGGTGGGGCTTCTACAATCTTTA
TTGTGATAAGCTCTCGAATTCGCTCAGTTTCTTGGAGATTCCCCGATTGC
TTATTCAAGTTGTCTCGGCACCTTTGGCCGGTTCCAGTGCTGCATTAATA
ATGAATCCGATTGATTGCATTAGAATGCGAATCCAGGTGAAGAATTGTAA
GTTTCTGAAGACAGTTAGTGTTTTGTGGCGTGAAGACCGTTGGTTCATGT
TTCACAAGGGGCTCTCAGCCAGGTTAACTCAGTCGATTACTTATTCGTTT
TGGATCATTTTATTTTATGAACCAATTAAATATTTCTGTTTAAAAGAGGA
TTTTAAGAAAACAATAAAAATATAGTCGCAATGCGTTCTCTTGGACGGCG
GAAGAGTGTAAATAATATAATAGCTAGACATGTTGGGATCAGAATCTTGT
ATATTTATTCTTGATTTAATATCACTTTTTATTGTGTTGGTATTTGACAT
AGGATTTCTTGGATTTTATTATAAATATATTATTAGAATTTGTTCAGTTT
AGATCATTTTCACGTTCTTTTTTTGTTACCGTGCTTTCATTTTATATTGT
AATTT
back to top

protein sequence of SMED30022160-orf-1

>SMED30022160-orf-1 ID=SMED30022160-orf-1|Name=SMED30022160-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=316bp
MDSAENFQVIEMHMLKKYMFFPLAGLGTFTVNTILYPISLIRTRLVMQHG
NNLYTGMIHCARTILIKEGWKGLYNGFFVKSIQLFSGMAYVGTYETIRFK
LADFDFNPHTRSFIAGGFASAVGQTLVVPVDVVSQHMMIINNKDTSVGSL
SSIKLTNSELKTPLSRFIGVCSHIRHEYGIRGFYKGYAISMITFIPNSAL
WWGFYNLYCDKLSNSLSFLEIPRLLIQVVSAPLAGSSAALIMNPIDCIRM
RIQVKNCKFLKTVSVLWREDRWFMFHKGLSARLTQSITYSFWIILFYEPI
KYFCLKEDFKKTIKI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005347ATP transmembrane transporter activity
Vocabulary: biological process
TermDefinition
GO:0015867ATP transport
GO:0055085transmembrane transport
GO:0006810transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR002067Mit_carrier
IPR018108Mitochondrial_sb/sol_carrier
IPR023395Mt_carrier_dom_sf
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002067Mitochondrial carrier proteinPRINTSPR00926MITOCARRIERcoord: 237..255
score: 22.26
coord: 112..125
score: 44.26
coord: 125..139
score: 24.15
coord: 186..206
score: 26.54
IPR018108Mitochondrial substrate/solute carrierPFAMPF00153Mito_carrcoord: 226..306
e-value: 5.1E-8
score: 32.7
coord: 24..99
e-value: 4.5E-12
score: 45.7
coord: 110..212
e-value: 1.8E-14
score: 53.4
IPR018108Mitochondrial substrate/solute carrierPROSITEPS50920SOLCARcoord: 107..211
score: 12.087
IPR018108Mitochondrial substrate/solute carrierPROSITEPS50920SOLCARcoord: 222..303
score: 13.782
IPR018108Mitochondrial substrate/solute carrierPROSITEPS50920SOLCARcoord: 16..100
score: 15.09
IPR023395Mitochondrial carrier domain superfamilyGENE3DG3DSA:1.50.40.10coord: 8..153
e-value: 7.1E-25
score: 89.3
IPR023395Mitochondrial carrier domain superfamilyGENE3DG3DSA:1.50.40.10coord: 154..310
e-value: 2.1E-21
score: 77.8
IPR023395Mitochondrial carrier domain superfamilySUPERFAMILYSSF103506Mitochondrial carriercoord: 15..298
NoneNo IPR availablePANTHERPTHR46314FAMILY NOT NAMEDcoord: 2..314
NoneNo IPR availablePANTHERPTHR46314:SF2SOLUTE CARRIER FAMILY 25 MEMBER 44coord: 2..314
NoneNo IPR availableTMHMMTMhelixcoord: 283..305
NoneNo IPR availableTMHMMTMhelixcoord: 72..94
NoneNo IPR availableTMHMMTMhelixcoord: 20..42
NoneNo IPR availableTMHMMTMhelixcoord: 183..205
NoneNo IPR availableTMHMMTMhelixcoord: 114..133