Caveolin

Overview
NameCaveolin
Smed IDSMED30022151
Length (bp)707
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Caveolin (SMED30022151) t-SNE clustered cells

Violin plots show distribution of expression levels for Caveolin (SMED30022151) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Caveolin (SMED30022151) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Caveolin (SMED30022151) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022151

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30022151SMESG000074524.1 SmedASXL_068760SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30022151SMESG000074524.1 dd_Smed_v4_8555_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30022151SMESG000074524.1 dd_Smed_v4_8555_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30022151SMESG000074524.1 dd_Smed_v6_8555_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
neuronSMED30022151SMESG000074524.1 dd_Smed_v6_8555_0_1dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30022151SMESG000074524.1 OX_Smed_1.0.16662ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
neuronSMED30022151SMESG000074524.1 dd_Smed_v6_8555_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30022151SMESG000074524.1 KJ187183smed_ncbi_20200123PMID:25356635
Cowles et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30022151SMESG000074524.1 KJ187183smed_ncbi_20200123PMID:25356635
Cowles et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Caveolin vs. Ensembl Human
Match: CAV1 (caveolin 1 [Source:HGNC Symbol;Acc:HGNC:1527])

HSP 1 Score: 115.546 bits (288), Expect = 5.102e-32
Identity = 49/130 (37.69%), Postives = 74/130 (56.92%), Query Frame = 2
Query:  101 DNKMTEVDLENRDPQALNS-FLSAHFEQVLGEPEETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKV 487
            D    E+DL NRDP+ LN   +   FE V+ EPE THSFD +W+ ++  +   K   YR+ +A+ GI M L WG  FA ++  +IW   PC+K   + +QC+  +Y   +  +C PL E     FSN+++
Sbjct:   12 DAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRI 141          
BLAST of Caveolin vs. Ensembl Human
Match: CAV1 (caveolin 1 [Source:HGNC Symbol;Acc:HGNC:1527])

HSP 1 Score: 115.546 bits (288), Expect = 5.102e-32
Identity = 49/130 (37.69%), Postives = 74/130 (56.92%), Query Frame = 2
Query:  101 DNKMTEVDLENRDPQALNS-FLSAHFEQVLGEPEETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKV 487
            D    E+DL NRDP+ LN   +   FE V+ EPE THSFD +W+ ++  +   K   YR+ +A+ GI M L WG  FA ++  +IW   PC+K   + +QC+  +Y   +  +C PL E     FSN+++
Sbjct:   12 DAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRI 141          
BLAST of Caveolin vs. Ensembl Human
Match: CAV1 (caveolin 1 [Source:HGNC Symbol;Acc:HGNC:1527])

HSP 1 Score: 115.546 bits (288), Expect = 5.102e-32
Identity = 49/130 (37.69%), Postives = 74/130 (56.92%), Query Frame = 2
Query:  101 DNKMTEVDLENRDPQALNS-FLSAHFEQVLGEPEETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKV 487
            D    E+DL NRDP+ LN   +   FE V+ EPE THSFD +W+ ++  +   K   YR+ +A+ GI M L WG  FA ++  +IW   PC+K   + +QC+  +Y   +  +C PL E     FSN+++
Sbjct:   12 DAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRI 141          
BLAST of Caveolin vs. Ensembl Human
Match: CAV1 (caveolin 1 [Source:HGNC Symbol;Acc:HGNC:1527])

HSP 1 Score: 115.546 bits (288), Expect = 5.102e-32
Identity = 49/130 (37.69%), Postives = 74/130 (56.92%), Query Frame = 2
Query:  101 DNKMTEVDLENRDPQALNS-FLSAHFEQVLGEPEETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKV 487
            D    E+DL NRDP+ LN   +   FE V+ EPE THSFD +W+ ++  +   K   YR+ +A+ GI M L WG  FA ++  +IW   PC+K   + +QC+  +Y   +  +C PL E     FSN+++
Sbjct:   12 DAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRI 141          
BLAST of Caveolin vs. Ensembl Human
Match: CAV1 (caveolin 1 [Source:HGNC Symbol;Acc:HGNC:1527])

HSP 1 Score: 115.161 bits (287), Expect = 1.437e-31
Identity = 49/131 (37.40%), Postives = 74/131 (56.49%), Query Frame = 2
Query:  101 DNKMTEVDLENRDPQALNS-FLSAHFEQVLGEPEETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKVQ 490
            D    E+DL NRDP+ LN   +   FE V+ EPE THSFD +W+ ++  +   K   YR+ +A+ GI M L WG  FA ++  +IW   PC+K   + +QC+  +Y   +  +C PL E     FSN+++ 
Sbjct:   32 DAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRIN 162          
BLAST of Caveolin vs. Ensembl Celegans
Match: cav-2 (Caveolin-2 [Source:UniProtKB/Swiss-Prot;Acc:Q18879])

HSP 1 Score: 78.1814 bits (191), Expect = 5.874e-18
Identity = 40/137 (29.20%), Postives = 66/137 (48.18%), Query Frame = 2
Query:   83 NIEPEKDNKMTEVDLENRDPQALNSFLSAHFEQVLGEP-EETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKVQ 490
            NI P   +KM   ++++RDP+    +L+  F +V  EP E+ HS  CVW  ++K +   +   Y++ T I G+ +    G LFA  A  NIW F P L L  +    +  I+   +  +  P   +    FS  ++ 
Sbjct:    9 NIAPVLIHKM---NMDDRDPKDSAQYLNTSFFEVFNEPSEQYHSIACVWTLSFKIFEIVRIYSYKILTLIFGLIIAFLGGILFALFAFLNIWIFRPILILTRMAFAQIVLIWPMFLIYIVRPFFYSVGAIFSTARLH 142          
BLAST of Caveolin vs. Ensembl Celegans
Match: cav-1 (Caveolin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q94051])

HSP 1 Score: 78.9518 bits (193), Expect = 1.560e-17
Identity = 35/135 (25.93%), Postives = 68/135 (50.37%), Query Frame = 2
Query:   89 EPEKDNKMTEVDLENRDPQALNSFLSAHFEQVLGEPEETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKVQQ 493
            E +++N    VDL NRD  ++N+ +  +FE + GE +  HS+DCVWR  +  +   +   YR+  ++  +   + +   F  +A  N++   P  KL+++    L  ++   I  +  P+     L FSN  +++
Sbjct:   90 EQKEENIAIGVDLVNRDANSMNNHVQLNFEDIFGEADSQHSWDCVWRLNHTVFTAVRLFIYRL-VSLLALPFTIIFAIFFGLLASINVFIIVPLGKLLSIPGTLLAKLWNWLIHAIFDPIASAVGLIFSNFNIRK 223          
BLAST of Caveolin vs. Ensembl Celegans
Match: cav-2 (Caveolin-2 [Source:UniProtKB/Swiss-Prot;Acc:Q18879])

HSP 1 Score: 73.9442 bits (180), Expect = 1.841e-15
Identity = 40/137 (29.20%), Postives = 66/137 (48.18%), Query Frame = 2
Query:   83 NIEPEKDNKMTEVDLENRDPQALNSFLSAHFEQVLGEP-EETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKVQ 490
            NI P   +KM   ++++RDP+    +L+  F +V  EP E+ HS  CVW  ++K +   +   Y++ T I G+ +    G LFA  A  NIW F P L L  +    +  I+   +  +  P   +    FS  ++ 
Sbjct:  130 NIAPVLIHKM---NMDDRDPKDSAQYLNTSFFEVFNEPSEQYHSIACVWTLSFKIFEIVRIYSYKILTLIFGLIIAFLGGILFALFAFLNIWIFRPILILTRMAFAQIVLIWPMFLIYIVRPFFYSVGAIFSTARLH 263          
BLAST of Caveolin vs. Ensembl Celegans
Match: cav-2 (Caveolin-2 [Source:UniProtKB/Swiss-Prot;Acc:Q18879])

HSP 1 Score: 73.559 bits (179), Expect = 3.356e-15
Identity = 40/137 (29.20%), Postives = 66/137 (48.18%), Query Frame = 2
Query:   83 NIEPEKDNKMTEVDLENRDPQALNSFLSAHFEQVLGEP-EETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKVQ 490
            NI P   +KM   ++++RDP+    +L+  F +V  EP E+ HS  CVW  ++K +   +   Y++ T I G+ +    G LFA  A  NIW F P L L  +    +  I+   +  +  P   +    FS  ++ 
Sbjct:  168 NIAPVLIHKM---NMDDRDPKDSAQYLNTSFFEVFNEPSEQYHSIACVWTLSFKIFEIVRIYSYKILTLIFGLIIAFLGGILFALFAFLNIWIFRPILILTRMAFAQIVLIWPMFLIYIVRPFFYSVGAIFSTARLH 301          
BLAST of Caveolin vs. Ensembl Celegans
Match: cav-2 (Caveolin-2 [Source:UniProtKB/Swiss-Prot;Acc:Q18879])

HSP 1 Score: 72.4034 bits (176), Expect = 9.841e-15
Identity = 40/137 (29.20%), Postives = 66/137 (48.18%), Query Frame = 2
Query:   83 NIEPEKDNKMTEVDLENRDPQALNSFLSAHFEQVLGEP-EETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKVQ 490
            NI P   +KM   ++++RDP+    +L+  F +V  EP E+ HS  CVW  ++K +   +   Y++ T I G+ +    G LFA  A  NIW F P L L  +    +  I+   +  +  P   +    FS  ++ 
Sbjct:  200 NIAPVLIHKM---NMDDRDPKDSAQYLNTSFFEVFNEPSEQYHSIACVWTLSFKIFEIVRIYSYKILTLIFGLIIAFLGGILFALFAFLNIWIFRPILILTRMAFAQIVLIWPMFLIYIVRPFFYSVGAIFSTARLH 333          
BLAST of Caveolin vs. Ensembl Zebrafish
Match: cav3 (caveolin 3 [Source:ZFIN;Acc:ZDB-GENE-050522-426])

HSP 1 Score: 119.783 bits (299), Expect = 9.510e-34
Identity = 55/131 (41.98%), Postives = 77/131 (58.78%), Query Frame = 2
Query:   98 KDNKMTEVDLENRDPQALN-SFLSAHFEQVLGEPEETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKV 487
            +D+   E+DL NRDP+ +N   +   FE V+ EP+ THS D VW+ +Y  +   K  CYRV +A+ GI + L WG  FAC++ C+IW   PC+K   +  QCL  IY  CI   C PL E     FS+++V
Sbjct:   14 RDSHTKEIDLINRDPKQINEDVVKVDFEDVIAEPDGTHSMDGVWKASYTTFTVSKYWCYRVLSAVFGIPVALLWGFCFACISFCHIWAVMPCIKSYLIETQCLSRIYSLCIHTFCDPLFEALGKIFSSVRV 144          
BLAST of Caveolin vs. Ensembl Zebrafish
Match: cav1 (caveolin 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2415])

HSP 1 Score: 116.701 bits (291), Expect = 1.189e-32
Identity = 51/131 (38.93%), Postives = 75/131 (57.25%), Query Frame = 2
Query:   98 KDNKMTEVDLENRDPQALNS-FLSAHFEQVLGEPEETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKV 487
            +D    E+DL NRDP+ LN   +   FE V+ EP  T+SFD VW+ ++  +   K  CYR+ TA+ GI + L WG  FA ++  +IW   PC+K   + + C+  +Y  C+   C PL E    CFSN++V
Sbjct:   12 QDVHTKEIDLVNRDPKHLNDDVVKVDFEDVIAEPAGTYSFDGVWKASFTTFTVTKYWCYRLLTALVGIPLALVWGIFFAILSFIHIWAVVPCVKSYLIEIHCISRVYSICVHTFCDPLFEAMGKCFSNVRV 142          
BLAST of Caveolin vs. Ensembl Zebrafish
Match: cav1 (caveolin 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2415])

HSP 1 Score: 117.857 bits (294), Expect = 1.296e-32
Identity = 58/160 (36.25%), Postives = 88/160 (55.00%), Query Frame = 2
Query:   17 HSYAVRQSH*IVISNLKKLHIFNIEPE--KDNKMTEVDLENRDPQALNS-FLSAHFEQVLGEPEETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKV 487
            HS  +R+   I   N K++   +I  +  +D    E+DL NRDP+ LN   +   FE V+ EP  T+SFD VW+ ++  +   K  CYR+ TA+ GI + L WG  FA ++  +IW   PC+K   + + C+  +Y  C+   C PL E    CFSN++V
Sbjct:   16 HSPFIRKQGNIYKPNNKEMDNDSINEKTLQDVHTKEIDLVNRDPKHLNDDVVKVDFEDVIAEPAGTYSFDGVWKASFTTFTVTKYWCYRLLTALVGIPLALVWGIFFAILSFIHIWAVVPCVKSYLIEIHCISRVYSICVHTFCDPLFEAMGKCFSNVRV 175          
BLAST of Caveolin vs. Ensembl Zebrafish
Match: cav2 (caveolin 2 [Source:ZFIN;Acc:ZDB-GENE-040625-164])

HSP 1 Score: 85.1149 bits (209), Expect = 3.120e-20
Identity = 44/142 (30.99%), Postives = 71/142 (50.00%), Query Frame = 2
Query:   83 NIEP---EKDNKMTEVDLENRDPQALNSFLSAHFEQVLGEPEETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFS--NIKVQQ 493
            +IEP   +K N  +EV  ++RDP+ +N  L   FE ++ EP  THSFD VW  ++  +   K   YR+ T    I M    G +F  ++  +IW   P ++   + +  +  I+ + +D   GP   +   C S  NIK +Q
Sbjct:   22 SIEPILGKKPNVYSEV--QDRDPKDINKHLKVGFEDIIAEPNSTHSFDRVWIGSHAVFELVKYVFYRILTTFLAIPMAFIAGIVFGILSCIHIWVVMPVIQGCMMTLPSIHVIWTSLMDMFIGPFFFSIGRCLSSINIKTEQ 161          
BLAST of Caveolin vs. Ensembl Zebrafish
Match: zgc:172270 (zgc:172270 [Source:ZFIN;Acc:ZDB-GENE-080204-67])

HSP 1 Score: 80.1073 bits (196), Expect = 3.670e-18
Identity = 35/121 (28.93%), Postives = 65/121 (53.72%), Query Frame = 2
Query:  125 LENRDPQALNSFLSAHFEQVLGEPEETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKV 487
            +  RDP+ +N  L   FE V+ EP    S D VW  ++  +   +   YR+ TA+  + + L  G +FA ++  +IW FTPC++++ +    L+ ++ + +D +  P  ++ + C S I V
Sbjct:   56 INGRDPRQINECLKVSFEDVIAEPVSVRSGDRVWIWSHALFEVSRVWFYRIITAVLAVPVSLIAGIVFAVLSFIHIWFFTPCVQVVLINTGWLQTLWSSVLDIIILPFFQSVAKCCSGISV 176          
BLAST of Caveolin vs. Ensembl Xenopus
Match: usp14 (ubiquitin specific peptidase 14 [Source:Xenbase;Acc:XB-GENE-971842])

HSP 1 Score: 119.013 bits (297), Expect = 1.849e-33
Identity = 55/136 (40.44%), Postives = 81/136 (59.56%), Query Frame = 2
Query:   89 EPEK-DNKMTEVDLENRDPQALNSFLSAHFEQVLGEPEETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKVQQ 493
            EP+   ++   +D++NRDP  LN  +   FE   GEP+ +HS   VW  +YK +NG K+CCY V + +CG  +  CW   FACV  C+IW   PC++   + V C++  Y +C+ C+C P  E C+LC S I+VQ 
Sbjct:    3 EPKSIPSEPMPLDMDNRDPNNLNDHVRVLFEDAFGEPDGSHSIPGVWGMSYKTFNGVKNCCYIVLSVLCGCPLAFCWALQFACVQCCHIWMVGPCIRAWNMNVNCMKMFYSSCVHCLCDPCWEACALCLSIIRVQN 138          
BLAST of Caveolin vs. Ensembl Xenopus
Match: cav3.1 (caveolin 3, gene 1 [Source:NCBI gene;Acc:100125124])

HSP 1 Score: 116.316 bits (290), Expect = 3.146e-32
Identity = 53/131 (40.46%), Postives = 75/131 (57.25%), Query Frame = 2
Query:   98 KDNKMTEVDLENRDPQALN-SFLSAHFEQVLGEPEETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKV 487
            KD    E+DL +RDP+ +N S +   FE V+ EP+ THSFD VW+ +Y  +   K  CYR+ +A  GI + + WG +FA ++ C+IW   PC+K   +   CL  I+  C    C PL E     FS+IKV
Sbjct:   19 KDLLTKEIDLVDRDPKRINDSVIKVDFEDVIAEPQGTHSFDGVWKASYTTFTVTKFWCYRILSAAIGIPLSIVWGFIFALISFCHIWAVVPCIKSYQIETHCLGRIFSLCTHTFCDPLFEALGKIFSSIKV 149          
BLAST of Caveolin vs. Ensembl Xenopus
Match: tmod2 (tropomodulin 2 [Source:Xenbase;Acc:XB-GENE-944511])

HSP 1 Score: 115.546 bits (288), Expect = 6.875e-32
Identity = 58/145 (40.00%), Postives = 78/145 (53.79%), Query Frame = 2
Query:   74 HIFNIEPEKDNK------MTEVDLENRDPQALNS-FLSAHFEQVLGEPEETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKV 487
             I   EP K +K        E+DL  RDP+ +N   +   FE V+ EP+ THSFD VW+ +   +   K  CYRV +AI G+ + L WG LFAC++ C+IW   PC+K   + VQCL   Y  C+   C P+ E      S IKV
Sbjct:    3 QIQQPEPAKQDKSNTEALTKEIDLVQRDPKKINQEVVQVDFEDVIAEPDGTHSFDGVWKASSTTFTVTKYWCYRVFSAIFGLPLALLWGFLFACLSFCHIWAVVPCVKSYLMEVQCLGQFYALCVRTFCDPIFEAIGKVLSGIKV 147          
BLAST of Caveolin vs. Ensembl Xenopus
Match: cav1 (caveolin 1 [Source:NCBI gene;Acc:548467])

HSP 1 Score: 106.301 bits (264), Expect = 4.153e-28
Identity = 47/132 (35.61%), Postives = 70/132 (53.03%), Query Frame = 2
Query:   98 KDNKMTEVDLENRDPQALNS-FLSAHFEQVLGEPEETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKVQ 490
            +D    E+DL NRDP+ LN   +   FE V+ EP+ THSFD +W+ ++  +   K   YR+ T I GI + L WG  FA ++  +IW   P ++   + +QC+  +Y   I   C PL E      S IK+ 
Sbjct:   40 RDVHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPDGTHSFDGIWKASFTTFTVTKYWFYRLLTTIFGIPLALIWGIYFAILSFLHIWAVVPFMRSYLIEIQCISRVYSIGIHTFCDPLFEAMGKALSFIKIS 171          
BLAST of Caveolin vs. Ensembl Xenopus
Match: cav1 (caveolin 1 [Source:NCBI gene;Acc:548467])

HSP 1 Score: 106.301 bits (264), Expect = 4.466e-28
Identity = 47/132 (35.61%), Postives = 70/132 (53.03%), Query Frame = 2
Query:   98 KDNKMTEVDLENRDPQALNS-FLSAHFEQVLGEPEETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKVQ 490
            +D    E+DL NRDP+ LN   +   FE V+ EP+ THSFD +W+ ++  +   K   YR+ T I GI + L WG  FA ++  +IW   P ++   + +QC+  +Y   I   C PL E      S IK+ 
Sbjct:   44 RDVHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPDGTHSFDGIWKASFTTFTVTKYWFYRLLTTIFGIPLALIWGIYFAILSFLHIWAVVPFMRSYLIEIQCISRVYSIGIHTFCDPLFEAMGKALSFIKIS 175          
BLAST of Caveolin vs. Ensembl Mouse
Match: Cav3 (caveolin 3 [Source:MGI Symbol;Acc:MGI:107570])

HSP 1 Score: 115.546 bits (288), Expect = 3.842e-32
Identity = 54/131 (41.22%), Postives = 77/131 (58.78%), Query Frame = 2
Query:   98 KDNKMTEVDLENRDPQALNS-FLSAHFEQVLGEPEETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKV 487
            KD    E+DL NRDP+ +N   +   FE V+ EPE T+SFD VW+ ++  +   K  CYR+ + + G+ + L WG LFAC++ C+IW   PC+K   + +QC+ +IY  CI   C PL        SNIKV
Sbjct:   15 KDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPEGTYSFDGVWKVSFTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHIYSLCIRTFCNPLFAALGQVCSNIKV 145          
BLAST of Caveolin vs. Ensembl Mouse
Match: Cav1 (caveolin 1, caveolae protein [Source:MGI Symbol;Acc:MGI:102709])

HSP 1 Score: 115.546 bits (288), Expect = 4.437e-32
Identity = 50/131 (38.17%), Postives = 72/131 (54.96%), Query Frame = 2
Query:  101 DNKMTEVDLENRDPQALNS-FLSAHFEQVLGEPEETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKVQ 490
            D    E+DL NRDP+ LN   +   FE V+ EPE THSFD +W+ ++  +   K   YR+ + I GI M L WG  FA ++  +IW   PC+K   + +QC+  +Y   +   C PL E     FSNI++ 
Sbjct:   12 DAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRIS 142          
BLAST of Caveolin vs. Ensembl Mouse
Match: Cav1 (caveolin 1, caveolae protein [Source:MGI Symbol;Acc:MGI:102709])

HSP 1 Score: 115.546 bits (288), Expect = 4.437e-32
Identity = 50/131 (38.17%), Postives = 72/131 (54.96%), Query Frame = 2
Query:  101 DNKMTEVDLENRDPQALNS-FLSAHFEQVLGEPEETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKVQ 490
            D    E+DL NRDP+ LN   +   FE V+ EPE THSFD +W+ ++  +   K   YR+ + I GI M L WG  FA ++  +IW   PC+K   + +QC+  +Y   +   C PL E     FSNI++ 
Sbjct:   12 DAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRIS 142          
BLAST of Caveolin vs. Ensembl Mouse
Match: Cav1 (caveolin 1, caveolae protein [Source:MGI Symbol;Acc:MGI:102709])

HSP 1 Score: 114.775 bits (286), Expect = 1.860e-31
Identity = 50/130 (38.46%), Postives = 72/130 (55.38%), Query Frame = 2
Query:  101 DNKMTEVDLENRDPQALNS-FLSAHFEQVLGEPEETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKV 487
            D    E+DL NRDP+ LN   +   FE V+ EPE THSFD +W+ ++  +   K   YR+ + I GI M L WG  FA ++  +IW   PC+K   + +QC+  +Y   +   C PL E     FSNI++
Sbjct:   43 DAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRI 172          
BLAST of Caveolin vs. Ensembl Mouse
Match: Cav1 (caveolin 1, caveolae protein [Source:MGI Symbol;Acc:MGI:102709])

HSP 1 Score: 114.775 bits (286), Expect = 1.860e-31
Identity = 50/130 (38.46%), Postives = 72/130 (55.38%), Query Frame = 2
Query:  101 DNKMTEVDLENRDPQALNS-FLSAHFEQVLGEPEETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKV 487
            D    E+DL NRDP+ LN   +   FE V+ EPE THSFD +W+ ++  +   K   YR+ + I GI M L WG  FA ++  +IW   PC+K   + +QC+  +Y   +   C PL E     FSNI++
Sbjct:   43 DAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRI 172          
BLAST of Caveolin vs. UniProt/SwissProt
Match: sp|P51638|CAV3_RAT (Caveolin-3 OS=Rattus norvegicus OX=10116 GN=Cav3 PE=1 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 2.441e-32
Identity = 56/131 (42.75%), Postives = 77/131 (58.78%), Query Frame = 2
Query:   98 KDNKMTEVDLENRDPQALNS-FLSAHFEQVLGEPEETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKV 487
            KD    E+DL NRDP+ +N   +   FE V+ EPE T+SFD VWR +Y  +   K  CYR+ + + G+ + L WG LFAC++ C+IW   PC+K   + +QC+ +IY  CI   C PL        SNIKV
Sbjct:   15 KDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPEGTYSFDGVWRVSYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHIYSLCIRTFCNPLFAALGQVCSNIKV 145          
BLAST of Caveolin vs. UniProt/SwissProt
Match: sp|Q2KI43|CAV3_BOVIN (Caveolin-3 OS=Bos taurus OX=9913 GN=CAV3 PE=2 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 1.043e-31
Identity = 54/132 (40.91%), Postives = 76/132 (57.58%), Query Frame = 2
Query:   98 KDNKMTEVDLENRDPQALNS-FLSAHFEQVLGEPEETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKVQ 490
            KD    E+DL NRDP+ +N   +   FE V+ EP  T+SFD VW+ +Y  +   K  CYR+ + + G+ + L WG LFAC++ C+IW   PC+K   + +QC+ +IY  CI   C PL        SNIKV 
Sbjct:   15 KDIHFKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKVSYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHIYSLCIRTFCNPLFAALGQVCSNIKVM 146          
BLAST of Caveolin vs. UniProt/SwissProt
Match: sp|Q2QL79|CAV1_DIDVI (Caveolin-1 OS=Didelphis virginiana OX=9267 GN=CAV1 PE=3 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 1.460e-31
Identity = 51/130 (39.23%), Postives = 74/130 (56.92%), Query Frame = 2
Query:  101 DNKMTEVDLENRDPQALNS-FLSAHFEQVLGEPEETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKV 487
            D    E+DL NRDP+ LN   +   FE V+ EPE THSFD +W+ ++  +   K   YR+ +A+ GI M L WG  FA ++  +IW   PC++   + +QC+  IY  CI   C PL E     FSN+++
Sbjct:   43 DAHTKEIDLVNRDPKHLNDDMVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIRSYLIEIQCISRIYSICIHTFCDPLFEAIGKIFSNVRI 172          
BLAST of Caveolin vs. UniProt/SwissProt
Match: sp|Q07E02|CAV1_ORNAN (Caveolin-1 OS=Ornithorhynchus anatinus OX=9258 GN=CAV1 PE=3 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 2.634e-31
Identity = 53/135 (39.26%), Postives = 76/135 (56.30%), Query Frame = 2
Query:   92 PEK---DNKMTEVDLENRDPQALNS-FLSAHFEQVLGEPEETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIK 484
            PEK   D    E+DL NRDP+ LN   +   FE V+ EPE THSFD +W+ ++  +   K   YR+ +A+ GI + L WG  FA ++  +IW   PC++   + +QC+  +Y  CI   C PL E     FSNI+
Sbjct:   37 PEKQLYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALLGIPLALLWGIYFAILSFLHIWAVVPCIRSYLIEIQCISRVYSICIHTFCDPLFEAIGKVFSNIR 171          
BLAST of Caveolin vs. UniProt/SwissProt
Match: sp|P51637|CAV3_MOUSE (Caveolin-3 OS=Mus musculus OX=10090 GN=Cav3 PE=1 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 2.687e-31
Identity = 54/131 (41.22%), Postives = 77/131 (58.78%), Query Frame = 2
Query:   98 KDNKMTEVDLENRDPQALNS-FLSAHFEQVLGEPEETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKV 487
            KD    E+DL NRDP+ +N   +   FE V+ EPE T+SFD VW+ ++  +   K  CYR+ + + G+ + L WG LFAC++ C+IW   PC+K   + +QC+ +IY  CI   C PL        SNIKV
Sbjct:   15 KDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPEGTYSFDGVWKVSFTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHIYSLCIRTFCNPLFAALGQVCSNIKV 145          
BLAST of Caveolin vs. TrEMBL
Match: A0A0A1CRK1 (Caveolin (Fragment) OS=Schmidtea mediterranea OX=79327 GN=cav-1 PE=2 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 3.917e-50
Identity = 83/83 (100.00%), Postives = 83/83 (100.00%), Query Frame = 2
Query:  248 NGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKVQQG 496
            NGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKVQQG
Sbjct:    1 NGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKVQQG 83          
BLAST of Caveolin vs. TrEMBL
Match: A0A1I8H544 (Caveolin OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 6.072e-45
Identity = 76/157 (48.41%), Postives = 104/157 (66.24%), Query Frame = 2
Query:   23 YAVRQSH*IVISNLKKLHIFNIEPEKDNKMTEVDLENRDPQALNSFLSAHFEQVLGEPEETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKVQQ 493
            +A++ SH   ++   K  +  I    ++ M EVDL NRDP ALN+ LS  FE VLGEP+  HS DCVWRN+Y C+N GK+C Y+V T +CGI + L WGC+FA VA+ +IWC TP  K+  + + C+R+  K+ +DC  GP CETC L  SN+K+ Q
Sbjct:    6 FALQVSHQEALARKLKESLSRIFSLCNSTMAEVDLTNRDPNALNNHLSTAFEDVLGEPDGIHSMDCVWRNSYSCFNCGKNCLYKVCTLLCGIFIALYWGCVFAAVAMQHIWCITPSFKVWEINMACMRHYSKSIVDCCLGPCCETCGLFLSNMKLTQ 162          
BLAST of Caveolin vs. TrEMBL
Match: A0A267EKQ3 (Caveolin (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig021804g1 PE=3 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 6.296e-45
Identity = 76/157 (48.41%), Postives = 104/157 (66.24%), Query Frame = 2
Query:   23 YAVRQSH*IVISNLKKLHIFNIEPEKDNKMTEVDLENRDPQALNSFLSAHFEQVLGEPEETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKVQQ 493
            +A++ SH   ++   K  +  I    ++ M EVDL NRDP ALN+ LS  FE VLGEP+  HS DCVWRN+Y C+N GK+C Y+V T +CGI + L WGC+FA VA+ +IWC TP  K+  + + C+R+  K+ +DC  GP CETC L  SN+K+ Q
Sbjct:    4 FALQVSHQEALARKLKESLSRIFSLCNSTMAEVDLTNRDPNALNNHLSTAFEDVLGEPDGIHSMDCVWRNSYSCFNCGKNCLYKVCTLLCGIFIALYWGCVFAAVAMQHIWCITPSFKVWEINMACMRHYSKSIVDCCLGPCCETCGLFLSNMKLTQ 160          
BLAST of Caveolin vs. TrEMBL
Match: A0A267DS21 (Caveolin OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013541g2 PE=3 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 3.808e-44
Identity = 68/137 (49.64%), Postives = 88/137 (64.23%), Query Frame = 2
Query:   86 IEPEKDNKMTEVDLENRDPQALNSFLSAHFEQVLGEPEETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKVQQG 496
            +  E +    EVDL NRDP  LN  L   FE VLGEPE  HS DC+WRN+Y C+ GGK+CCY+  + + G+C+ LCWGC FA VA  NIWC TPC K+  +++   R +++T  DC  G  C+    CFS IKV+QG
Sbjct:    1 MAKEGEEAKVEVDLVNRDPNQLNGHLKVAFEDVLGEPEHAHSIDCLWRNSYGCFTGGKNCCYKFVSVLSGLCIALCWGCTFAMVAFYNIWCITPCTKVFKIFISVFREMWETYWDCCVGAKCKALGYCFSRIKVEQG 137          
BLAST of Caveolin vs. TrEMBL
Match: A0A1I8GFP4 (Caveolin OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 5.219e-44
Identity = 71/131 (54.20%), Postives = 93/131 (70.99%), Query Frame = 2
Query:  101 DNKMTEVDLENRDPQALNSFLSAHFEQVLGEPEETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKVQQ 493
            ++ M EVDL NRDP ALN+ LS  FE VLGEP+  HS DCVWRN+Y C+N GK+C Y+V T +CGI + L WGC+FA VA+ +IWC TP  K+  + + C+R+  K+ +DC  GP CETC L  SN+K+ Q
Sbjct:   31 NSTMAEVDLTNRDPNALNNHLSTAFEDVLGEPDGIHSMDCVWRNSYSCFNCGKNCLYKVCTLLCGIFIALYWGCVFAAVAMQHIWCITPSFKVWEINMACMRHYSKSIVDCCLGPCCETCGLFLSNMKLTQ 161          
BLAST of Caveolin vs. Ensembl Cavefish
Match: cav3 (caveolin 3 [Source:NCBI gene;Acc:103034163])

HSP 1 Score: 119.398 bits (298), Expect = 1.138e-33
Identity = 55/131 (41.98%), Postives = 75/131 (57.25%), Query Frame = 2
Query:   98 KDNKMTEVDLENRDPQALNS-FLSAHFEQVLGEPEETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKV 487
            KD    E+DL NRDP+ +N   +   FE V+ EP+ THS D VW+ +Y  +   K  CYRV +A+ GI + L WG  FAC++ C+IW   PC+K   +  QCL  IY  CI   C P  E     FS+++V
Sbjct:   14 KDRHAKEIDLINRDPKQINEDVVKVDFEDVIAEPDGTHSLDGVWKASYTTFTVSKYWCYRVLSAVFGIPVALLWGFCFACISFCHIWAVMPCIKSYLIETQCLSRIYSLCIHTFCDPFFEALGKVFSSVRV 144          
BLAST of Caveolin vs. Ensembl Cavefish
Match: cav1 (caveolin-1 [Source:NCBI gene;Acc:103028370])

HSP 1 Score: 114.39 bits (285), Expect = 1.870e-31
Identity = 57/160 (35.62%), Postives = 85/160 (53.12%), Query Frame = 2
Query:   17 HSYAVRQSH*IVISNLKKLH--IFNIEPEKDNKMTEVDLENRDPQALNS-FLSAHFEQVLGEPEETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKV 487
            HS  +R+   I   N K +     N +  +D    E+DL NRDP+ LN   +   FE V+ EP  T+SFD VW+ +Y  +   K   YR+ TA+ GI + L WG  FA ++  +IW   PCLK   + + C+  +Y  C+   C PL E    CFS++++
Sbjct:   15 HSPFIRKQGNIYKPNNKSMDNDSINEKTMQDVHTKEIDLVNRDPKHLNDHVVKVDFEDVIAEPAGTYSFDGVWKASYTTFTVTKYWFYRLLTALVGIPLALIWGIFFAILSFLHIWAVVPCLKSYLIEIHCVSQVYSICVHTFCDPLFEAVGKCFSSVRI 174          
BLAST of Caveolin vs. Ensembl Cavefish
Match: zgc:158296 (caveolin-2-like [Source:NCBI gene;Acc:103043623])

HSP 1 Score: 82.0333 bits (201), Expect = 4.329e-19
Identity = 42/144 (29.17%), Postives = 76/144 (52.78%), Query Frame = 2
Query:   62 LKKLHIFNIEPEKDNKMTEVDL--ENRDPQALNSFLSAHFEQVLGEPEETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKV 487
            ++K+      P + + +++     E+RDP  +N+ L   F  VL EP  T S+D VW  +   +   +   YR  TA+C + +    GCLFA +A  +IWC  PC+++    + C+R ++ + ++    PLCE+ + C S + +
Sbjct:   25 VQKIQPSLTPPPQFSSISQASFTNESRDPYGVNNHLKVDFSDVLAEPASTRSYDRVWVYSGIGFESARIWSYRCLTAVCAVPVSCLSGCLFALLACLHIWCVMPCVQVCHTCLPCVRSLWMSLVNIFLMPLCESAARCCSGVYI 168          
BLAST of Caveolin vs. Ensembl Cavefish
Match: cav2 (caveolin 2 [Source:NCBI gene;Acc:103028678])

HSP 1 Score: 81.2629 bits (199), Expect = 6.530e-19
Identity = 37/142 (26.06%), Postives = 68/142 (47.89%), Query Frame = 2
Query:   65 KKLHIFNIEPEKDNKMTEVDLENRDPQALNSFLSAHFEQVLGEPEETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKVQ 490
            KK  ++  EP++D          RDP+ +N+ L   FE ++ EP  THSFD VW  ++  +   K   YR+ T +  I M    G +F  ++  +IW   P +    + +  ++ ++ + +D   GP   +     S+I ++
Sbjct:   29 KKEKLYTPEPDRD----------RDPRDINAHLKVEFEDIIAEPSSTHSFDSVWIWSHAVFELLKYIFYRLLTTLLAIPMAFVAGIVFGLLSCVHIWVVMPLVHSCMMALPSVQVVWASLMDMFTGPFFHSFGKSLSSINIK 160          
BLAST of Caveolin vs. Ensembl Cavefish
Match: zgc:172270 (caveolin-2-like [Source:NCBI gene;Acc:103029205])

HSP 1 Score: 73.1738 bits (178), Expect = 1.050e-15
Identity = 33/122 (27.05%), Postives = 61/122 (50.00%), Query Frame = 2
Query:  125 LENRDPQALNSFLSAHFEQVLGEPEETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKVQ 490
            +  RDP+ +N  L   FE V+ EP    S D VW  +   +   +   YR+ T +  + + +  G LFA ++  +IW FTPC+K++ +    L  ++ + +D +  P  ++ + C     +Q
Sbjct:   56 INERDPRQINECLKVSFEDVIAEPMTVRSGDRVWIWSNALFEVSRVWFYRIITVLLAVPVSIIAGILFAILSCLHIWLFTPCVKMVLINTGWLETLWSSILDIIILPFYQSVAKCCGGFSIQ 177          
BLAST of Caveolin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007616.1 (pep scaffold:Pmarinus_7.0:GL484966:54:920:1 gene:ENSPMAG00000006881.1 transcript:ENSPMAT00000007616.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 96.2857 bits (238), Expect = 5.516e-26
Identity = 45/106 (42.45%), Postives = 68/106 (64.15%), Query Frame = 2
Query:  173 FEQVLGEPEETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKVQ 490
            FE V   PE +HS   VWR  ++ YNG K  CY + + +C + +  CWGC FAC    ++W  TPCL++  + + CL+  + T + C+C PLCETC+LCFS+I+++
Sbjct:    4 FEDVFAYPEGSHSIPGVWRCAFRTYNGTKWFCYLLLSVLCAVPLSCCWGCDFACAQFYHVW-VTPCLRMCRMNMLCLQMFWSTIVRCVCEPLCETCALCFSHIRIK 108          
BLAST of Caveolin vs. Ensembl Nematostella
Match: EDO41786 (Caveolin [Source:UniProtKB/TrEMBL;Acc:A7S3K1])

HSP 1 Score: 100.138 bits (248), Expect = 3.740e-27
Identity = 51/111 (45.95%), Postives = 64/111 (57.66%), Query Frame = 2
Query:  161 LSAHFEQVLGEPEETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKVQQ 493
            L   F+ V  EPE THS D VWR +YK +   K  CYR+ TAI GI   +  GC FAC++   IWC  PCL+   + +QCL  I+  CI   C PL E+ S  FS I+VQ 
Sbjct:    2 LQVFFQDVFAEPEGTHSIDGVWRTSYKTFVATKYWCYRIITAIFGIPTAILCGCYFACLSFDYIWCVMPCLRGYLIELQCLGKIWGLCIRTFCDPLFESFSKIFSGIRVQN 112          
BLAST of Caveolin vs. Ensembl Nematostella
Match: EDO33339 (Caveolin [Source:UniProtKB/TrEMBL;Acc:A7SSH5])

HSP 1 Score: 100.138 bits (248), Expect = 6.455e-27
Identity = 45/120 (37.50%), Postives = 65/120 (54.17%), Query Frame = 2
Query:  125 LENRDPQALNSFLSAHFEQVLGEPEETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIK 484
            +E+RDP  +N  +   ++ V  EPE  HS D VWR ++  +   K CCYR+ TAI G+   +  GC FAC++   IWC  PCL+   + +Q L  I+   I   C P  E+    FS I+
Sbjct:    1 MEDRDPSNINDHVKVFYQDVFAEPEGNHSIDGVWRASFSTFVNTKYCCYRLLTAIFGVPTAILCGCYFACLSFDYIWCIMPCLRAYVIQLQFLGKIFSLLIKTFCDPFFESFGRVFSGIR 120          
BLAST of Caveolin vs. Ensembl Medaka
Match: cav3 (caveolin 3 [Source:NCBI gene;Acc:101171655])

HSP 1 Score: 119.013 bits (297), Expect = 1.619e-33
Identity = 54/132 (40.91%), Postives = 77/132 (58.33%), Query Frame = 2
Query:   95 EKDNKMTEVDLENRDPQALNS-FLSAHFEQVLGEPEETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKV 487
            +KD+   E+DL NRDP+ +N   +   FE V+ EP+ THS D VW+ +Y  +   K  CYR+ +AI GI + L WG LFAC++ C+IW   PC+K   +  QC+  IY  CI     P  E     FS+++V
Sbjct:   15 QKDSHTKEIDLINRDPKQINEDVVKVEFEDVIAEPDGTHSLDGVWKLSYTTFTVSKYWCYRILSAIFGIPVALLWGFLFACISFCHIWAVVPCIKSCLIESQCISRIYTLCIQTFFDPFFEAVGKIFSSVRV 146          
BLAST of Caveolin vs. Ensembl Medaka
Match: cav1 (caveolin-1 [Source:NCBI gene;Acc:101162818])

HSP 1 Score: 114.005 bits (284), Expect = 2.661e-31
Identity = 49/131 (37.40%), Postives = 75/131 (57.25%), Query Frame = 2
Query:  101 DNKMTEVDLENRDPQALNS-FLSAHFEQVLGEPEETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKVQ 490
            D    E+DL NRDP+ +N   +   FE ++ EP  T+SFD VW+ ++  +   K  CYR+ TA+ GI + L WG  FA ++  +IW   PC+K   + + CL  +Y  C+   C PL E    CFS+I+++
Sbjct:   46 DVHTKEIDLVNRDPKQINDDVVKVDFEDIIAEPAGTYSFDGVWKASFTTFTVTKYWCYRLLTAVVGIPLALIWGIFFAILSFLHIWAVVPCVKSYLIEIHCLSRVYSICVHTFCDPLFEAMGRCFSSIRIR 176          
BLAST of Caveolin vs. Ensembl Medaka
Match: cav2 (caveolin-2 [Source:NCBI gene;Acc:110014685])

HSP 1 Score: 78.1814 bits (191), Expect = 2.535e-17
Identity = 36/140 (25.71%), Postives = 68/140 (48.57%), Query Frame = 2
Query:   83 NIEP---EKDNKMTEVDLENRDPQALNSFLSAHFEQVLGEPEETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKVQQ 493
            +IEP    K    +EV  ++RDP  +N+ +   FE V+ EP  THSFD VW  ++  +   K  CYR+ + +  + +    G +F  ++  +IW   P ++    ++     +++  +     PL  +     S+I+V+ 
Sbjct:   77 SIEPILLRKGKGFSEVP-DDRDPNDINAHVKVAFEDVIAEPVSTHSFDTVWVGSHAAFELVKFLCYRLLSTLLAVPVAFVLGLMFGVLSCLHIWLVGPVIRGFLTFLPPALTVWRKLMVLFVAPLSHSMGKSMSSIQVRS 215          
BLAST of Caveolin vs. Ensembl Medaka
Match: zgc:158296 (caveolin-2-like [Source:NCBI gene;Acc:101156574])

HSP 1 Score: 65.855 bits (159), Expect = 5.694e-13
Identity = 34/117 (29.06%), Postives = 55/117 (47.01%), Query Frame = 2
Query:  131 NRDPQALNSFLSAHFEQVLGEPEETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNI 481
            +RDP+ +N  L      VL EP   HS   VW  +   +   +   YR  T +  + M    G   A +A   +W   PC++L ++++ CLR +    +D +  P C + +LC S I
Sbjct:   57 SRDPKGINKHLKVEVSDVLSEPTAPHSTAAVWTVSVCGFERTRVWTYRCLTLLLAVPMAFVCGLSVAVLASLRVWFLVPCIQLSSLFIPCLRSLCLCAVDVVVSPFCVSLALCCSQI 173          
BLAST of Caveolin vs. Ensembl Medaka
Match: zgc:172270 (caveolin-2 [Source:NCBI gene;Acc:101164882])

HSP 1 Score: 63.929 bits (154), Expect = 5.684e-12
Identity = 30/115 (26.09%), Postives = 53/115 (46.09%), Query Frame = 2
Query:  125 LENRDPQALNSFLSAHFEQVLGEPEETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLC 469
            ++ RDP+ +N  L   FE V+ EP    S D VW  +   +   +   YR+ T +  I M +  G LFA  +  ++W   PC++ + +  + L+ ++   +     P   T   C
Sbjct:  112 IKTRDPRGINDCLKVTFEDVIAEPVSVRSGDRVWIWSNALFEVSRVWLYRILTVVLAIPMSVLSGVLFAIFSCFHVWMVGPCVEYVLIGTRWLQSLWNVVLGVFVLPFSRTAKRC 226          
BLAST of Caveolin vs. Planmine SMEST
Match: SMESG000074524.1 (SMESG000074524.1)

HSP 1 Score: 263.848 bits (673), Expect = 7.262e-91
Identity = 127/129 (98.45%), Postives = 128/129 (99.22%), Query Frame = 2
Query:  110 MTEVDLENRDPQALNSFLSAHFEQVLGEPEETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKVQQG 496
            MTEVDLENRDP ALNSFLSAHFEQVLGEPEETH+FDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKVQQG
Sbjct:    1 MTEVDLENRDPHALNSFLSAHFEQVLGEPEETHAFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKVQQG 129          
BLAST of Caveolin vs. Planmine SMEST
Match: SMESG000063381.1 (SMESG000063381.1)

HSP 1 Score: 129.413 bits (324), Expect = 4.976e-38
Identity = 60/128 (46.88%), Postives = 79/128 (61.72%), Query Frame = 2
Query:  110 MTEVDLENRDPQALNSFLSAHFEQVLGEPEETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKVQQ 493
            M ++DLENRDP+ +N+ L   FE +L EPE  HS DCVWR +Y CY  G  CCY+  T +CG+C+ LCWGC+FACVA   IW  TP  K+  ++    + +  +     C P C  C  CFSNI+V Q
Sbjct:    1 MADLDLENRDPRNINNHLKVTFEDILAEPEGAHSIDCVWRTSYCCYKFGIGCCYKFLTTLCGLCLALCWGCVFACVAFEYIWFLTPICKVYGLHCAIFKSLMDSITGICCEPCCRACGACFSNIQVTQ 128          
BLAST of Caveolin vs. Planmine SMEST
Match: SMESG000063380.1 (SMESG000063380.1)

HSP 1 Score: 121.709 bits (304), Expect = 4.830e-35
Identity = 62/132 (46.97%), Postives = 82/132 (62.12%), Query Frame = 2
Query:  110 MTEVDLENRDPQALNSFLSAHFEQVLGEPEETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETC----SLCFSNIKVQQ 493
            MTE D++NRD   +NS L   FE VL EPE  HS DC+W+N+YKC+     CCY+  T +CG+C+ LCWGC+FACVA  +IWC +P  K+  ++    R +    ID +CG  CE C      C SNI+V Q
Sbjct:    1 MTEFDMDNRDVNNINSHLKVTFENVLAEPEGAHSIDCIWKNSYKCFQFSLGCCYKFYTVLCGLCIALCWGCVFACVAFEHIWCCSPVCKVYNLHCSSCRAL----IDSICGVCCEPCYRAMGACCSNIQVTQ 128          
BLAST of Caveolin vs. Planmine SMEST
Match: SMESG000052389.1 (SMESG000052389.1)

HSP 1 Score: 116.701 bits (291), Expect = 4.710e-33
Identity = 51/126 (40.48%), Postives = 83/126 (65.87%), Query Frame = 2
Query:  110 MTEVDLENRDPQALNSFLSAHFEQVLGEPEETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETCSLCFSNIKV 487
            M ++DLENRDP+ +N+ + A +E  + EP+   S DC+W+ ++KC+  G +CCY+  + + G+C+ L WGC + C A C+IWC TPC+K+  ++    + I K  +DC+ GP+CE C LC  + +V
Sbjct:    1 MKDLDLENRDPRNINAHIQAEWEDNIAEPDGVKSCDCLWKCSFKCFQCGLNCCYQFLSGLLGLCIALYWGCCYGCTAFCHIWCCTPCVKMYILHCAFCKKINKAYMDCIYGPICEICGLCGGHFRV 126          
BLAST of Caveolin vs. Planmine SMEST
Match: SMESG000063380.1 (SMESG000063380.1)

HSP 1 Score: 113.62 bits (283), Expect = 6.166e-32
Identity = 58/127 (45.67%), Postives = 78/127 (61.42%), Query Frame = 2
Query:  125 LENRDPQALNSFLSAHFEQVLGEPEETHSFDCVWRNTYKCYNGGKDCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRYIYKTCIDCMCGPLCETC----SLCFSNIKVQQ 493
            ++NRD   +NS L   FE VL EPE  HS DC+W+N+YKC+     CCY+  T +CG+C+ LCWGC+FACVA  +IWC +P  K+  ++    R +    ID +CG  CE C      C SNI+V Q
Sbjct:    1 MDNRDVNNINSHLKVTFENVLAEPEGAHSIDCIWKNSYKCFQFSLGCCYKFYTVLCGLCIALCWGCVFACVAFEHIWCCSPVCKVYNLHCSSCRAL----IDSICGVCCEPCYRAMGACCSNIQVTQ 123          
The following BLAST results are available for this feature:
BLAST of Caveolin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CAV15.102e-3237.69caveolin 1 [Source:HGNC Symbol;Acc:HGNC:1527][more]
CAV15.102e-3237.69caveolin 1 [Source:HGNC Symbol;Acc:HGNC:1527][more]
CAV15.102e-3237.69caveolin 1 [Source:HGNC Symbol;Acc:HGNC:1527][more]
CAV15.102e-3237.69caveolin 1 [Source:HGNC Symbol;Acc:HGNC:1527][more]
CAV11.437e-3137.40caveolin 1 [Source:HGNC Symbol;Acc:HGNC:1527][more]
back to top
BLAST of Caveolin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cav-25.874e-1829.20Caveolin-2 [Source:UniProtKB/Swiss-Prot;Acc:Q1887... [more]
cav-11.560e-1725.93Caveolin-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9405... [more]
cav-21.841e-1529.20Caveolin-2 [Source:UniProtKB/Swiss-Prot;Acc:Q1887... [more]
cav-23.356e-1529.20Caveolin-2 [Source:UniProtKB/Swiss-Prot;Acc:Q1887... [more]
cav-29.841e-1529.20Caveolin-2 [Source:UniProtKB/Swiss-Prot;Acc:Q1887... [more]
back to top
BLAST of Caveolin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Caveolin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cav39.510e-3441.98caveolin 3 [Source:ZFIN;Acc:ZDB-GENE-050522-426][more]
cav11.189e-3238.93caveolin 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2415][more]
cav11.296e-3236.25caveolin 1 [Source:ZFIN;Acc:ZDB-GENE-030131-2415][more]
cav23.120e-2030.99caveolin 2 [Source:ZFIN;Acc:ZDB-GENE-040625-164][more]
zgc:1722703.670e-1828.93zgc:172270 [Source:ZFIN;Acc:ZDB-GENE-080204-67][more]
back to top
BLAST of Caveolin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
usp141.849e-3340.44ubiquitin specific peptidase 14 [Source:Xenbase;Ac... [more]
cav3.13.146e-3240.46caveolin 3, gene 1 [Source:NCBI gene;Acc:100125124... [more]
tmod26.875e-3240.00tropomodulin 2 [Source:Xenbase;Acc:XB-GENE-944511][more]
cav14.153e-2835.61caveolin 1 [Source:NCBI gene;Acc:548467][more]
cav14.466e-2835.61caveolin 1 [Source:NCBI gene;Acc:548467][more]
back to top
BLAST of Caveolin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cav33.842e-3241.22caveolin 3 [Source:MGI Symbol;Acc:MGI:107570][more]
Cav14.437e-3238.17caveolin 1, caveolae protein [Source:MGI Symbol;Ac... [more]
Cav14.437e-3238.17caveolin 1, caveolae protein [Source:MGI Symbol;Ac... [more]
Cav11.860e-3138.46caveolin 1, caveolae protein [Source:MGI Symbol;Ac... [more]
Cav11.860e-3138.46caveolin 1, caveolae protein [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Caveolin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P51638|CAV3_RAT2.441e-3242.75Caveolin-3 OS=Rattus norvegicus OX=10116 GN=Cav3 P... [more]
sp|Q2KI43|CAV3_BOVIN1.043e-3140.91Caveolin-3 OS=Bos taurus OX=9913 GN=CAV3 PE=2 SV=1[more]
sp|Q2QL79|CAV1_DIDVI1.460e-3139.23Caveolin-1 OS=Didelphis virginiana OX=9267 GN=CAV1... [more]
sp|Q07E02|CAV1_ORNAN2.634e-3139.26Caveolin-1 OS=Ornithorhynchus anatinus OX=9258 GN=... [more]
sp|P51637|CAV3_MOUSE2.687e-3141.22Caveolin-3 OS=Mus musculus OX=10090 GN=Cav3 PE=1 S... [more]
back to top
BLAST of Caveolin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0A1CRK13.917e-50100.00Caveolin (Fragment) OS=Schmidtea mediterranea OX=7... [more]
A0A1I8H5446.072e-4548.41Caveolin OS=Macrostomum lignano OX=282301 PE=3 SV=... [more]
A0A267EKQ36.296e-4548.41Caveolin (Fragment) OS=Macrostomum lignano OX=2823... [more]
A0A267DS213.808e-4449.64Caveolin OS=Macrostomum lignano OX=282301 GN=BOX15... [more]
A0A1I8GFP45.219e-4454.20Caveolin OS=Macrostomum lignano OX=282301 PE=3 SV=... [more]
back to top
BLAST of Caveolin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cav31.138e-3341.98caveolin 3 [Source:NCBI gene;Acc:103034163][more]
cav11.870e-3135.63caveolin-1 [Source:NCBI gene;Acc:103028370][more]
zgc:1582964.329e-1929.17caveolin-2-like [Source:NCBI gene;Acc:103043623][more]
cav26.530e-1926.06caveolin 2 [Source:NCBI gene;Acc:103028678][more]
zgc:1722701.050e-1527.05caveolin-2-like [Source:NCBI gene;Acc:103029205][more]
back to top
BLAST of Caveolin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000007616.15.516e-2642.45pep scaffold:Pmarinus_7.0:GL484966:54:920:1 gene:E... [more]
back to top
BLAST of Caveolin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Caveolin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO417863.740e-2745.95Caveolin [Source:UniProtKB/TrEMBL;Acc:A7S3K1][more]
EDO333396.455e-2737.50Caveolin [Source:UniProtKB/TrEMBL;Acc:A7SSH5][more]
back to top
BLAST of Caveolin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cav31.619e-3340.91caveolin 3 [Source:NCBI gene;Acc:101171655][more]
cav12.661e-3137.40caveolin-1 [Source:NCBI gene;Acc:101162818][more]
cav22.535e-1725.71caveolin-2 [Source:NCBI gene;Acc:110014685][more]
zgc:1582965.694e-1329.06caveolin-2-like [Source:NCBI gene;Acc:101156574][more]
zgc:1722705.684e-1226.09caveolin-2 [Source:NCBI gene;Acc:101164882][more]
back to top
BLAST of Caveolin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074524.17.262e-9198.45SMESG000074524.1[more]
SMESG000063381.14.976e-3846.88SMESG000063381.1[more]
SMESG000063380.14.830e-3546.97SMESG000063380.1[more]
SMESG000052389.14.710e-3340.48SMESG000052389.1[more]
SMESG000063380.16.166e-3245.67SMESG000063380.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022151 ID=SMED30022151|Name=Caveolin|organism=Schmidtea mediterranea sexual|type=transcript|length=707bp
TCCGAGTATAGTAACGCATAGCTATGCGGTTAGGCAGTCACATTAAATAG
TCATTTCAAATTTAAAAAAGCTTCATATTTTCAATATTGAGCCAGAAAAA
GATAACAAAATGACTGAAGTGGATTTAGAAAATCGAGATCCTCAAGCTCT
CAACTCCTTTCTATCGGCACATTTTGAACAAGTTCTAGGAGAGCCTGAAG
AAACTCACTCATTTGATTGCGTATGGAGGAACACTTACAAATGCTACAAT
GGCGGGAAAGATTGCTGCTATAGGGTTTCGACAGCGATTTGTGGGATCTG
CATGGGACTTTGTTGGGGTTGTTTATTTGCTTGCGTTGCTCTTTGCAATA
TCTGGTGTTTTACGCCATGCTTGAAGCTAATAGCGGTCTACGTACAGTGC
CTACGCTACATTTATAAGACATGCATAGACTGTATGTGCGGACCGCTCTG
TGAAACGTGCAGCCTCTGTTTCAGCAATATTAAAGTACAACAAGGATAAT
GTTTTAAGAATCAAACAGACATTTATTTAGAGTAGTTTATTAGAAGATTT
TATGATATTTTATTAATTAAATTCTTAATAAAACTGTGACAGTGGGTATA
TTGCAATTAACCTTTTTTCAAATGAGACTTTTACTTTGTTATTTTTATTT
CCGAATTAATTATAAATAATTTGAAGAGTCAATTTTATATTATTATAAGT
GTTTATT
back to top

protein sequence of SMED30022151-orf-1

>SMED30022151-orf-1 ID=SMED30022151-orf-1|Name=SMED30022151-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=130bp
MTEVDLENRDPQALNSFLSAHFEQVLGEPEETHSFDCVWRNTYKCYNGGK
DCCYRVSTAICGICMGLCWGCLFACVALCNIWCFTPCLKLIAVYVQCLRY
IYKTCIDCMCGPLCETCSLCFSNIKVQQG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000025nervous system
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001612Caveolin
Vocabulary: biological process
TermDefinition
GO:0070836caveola assembly
Vocabulary: cellular component
TermDefinition
GO:0000139Golgi membrane
GO:0005794Golgi apparatus
GO:0005886plasma membrane
GO:0005901caveola
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001612CaveolinPFAMPF01146Caveolincoord: 3..127
e-value: 1.0E-38
score: 132.3
IPR001612CaveolinPANTHERPTHR10844CAVEOLINcoord: 3..127
NoneNo IPR availableTMHMMTMhelixcoord: 60..82