Kinase-like protein

Overview
NameKinase-like protein
Smed IDSMED30022145
Length (bp)918
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Kinase-like protein (SMED30022145) t-SNE clustered cells

Violin plots show distribution of expression levels for Kinase-like protein (SMED30022145) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Kinase-like protein (SMED30022145) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Kinase-like protein (SMED30022145) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Kinase-like protein vs. Ensembl Human
Match: AURKC (aurora kinase C [Source:HGNC Symbol;Acc:HGNC:11391])

HSP 1 Score: 218.009 bits (554), Expect = 3.912e-69
Identity = 108/278 (38.85%), Postives = 168/278 (60.43%), Query Frame = 2
Query:   35 QQMNKP----LNISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKSFSENTLQEC 856
            QQ + P    L +  F+IG  LG G+FG V++ + KE++F   LK++ KS I +  L  QL+REI+IQ +L HPNILRL N+FHD +R+Y++LE+A  G++  ++ K       R AT +++L D+++YCH K V+HRDIK  N+L+   G++K+ADFGWSVH  + R     G++ Y  PE++  +     + D+W IGV+ YE+L G  PF   +     +R ++ D R P ++   A  L+  +L   P +R+ L  IL H +V++ S   L  C
Sbjct:    9 QQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLARLKESHFIVALKVLFKSQIEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDARRVYLILEYAPRGELYKELQKSEKLDEQRTATIIEELADALTYCHDKKVIHRDIKPENLLLGFRGEVKIADFGWSVHTPSLRRKTMCGTLDYLPPEMIEGRT-YDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPLGARDLISRLLRYQPLERLPLAQILKHPWVQAHSRRVLPPC 285          
BLAST of Kinase-like protein vs. Ensembl Human
Match: AURKC (aurora kinase C [Source:HGNC Symbol;Acc:HGNC:11391])

HSP 1 Score: 218.394 bits (555), Expect = 4.439e-69
Identity = 108/278 (38.85%), Postives = 168/278 (60.43%), Query Frame = 2
Query:   35 QQMNKP----LNISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKSFSENTLQEC 856
            QQ + P    L +  F+IG  LG G+FG V++ + KE++F   LK++ KS I +  L  QL+REI+IQ +L HPNILRL N+FHD +R+Y++LE+A  G++  ++ K       R AT +++L D+++YCH K V+HRDIK  N+L+   G++K+ADFGWSVH  + R     G++ Y  PE++  +     + D+W IGV+ YE+L G  PF   +     +R ++ D R P ++   A  L+  +L   P +R+ L  IL H +V++ S   L  C
Sbjct:   28 QQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLARLKESHFIVALKVLFKSQIEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDARRVYLILEYAPRGELYKELQKSEKLDEQRTATIIEELADALTYCHDKKVIHRDIKPENLLLGFRGEVKIADFGWSVHTPSLRRKTMCGTLDYLPPEMIEGRT-YDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPLGARDLISRLLRYQPLERLPLAQILKHPWVQAHSRRVLPPC 304          
BLAST of Kinase-like protein vs. Ensembl Human
Match: AURKC (aurora kinase C [Source:HGNC Symbol;Acc:HGNC:11391])

HSP 1 Score: 218.394 bits (555), Expect = 5.379e-69
Identity = 108/278 (38.85%), Postives = 168/278 (60.43%), Query Frame = 2
Query:   35 QQMNKP----LNISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKSFSENTLQEC 856
            QQ + P    L +  F+IG  LG G+FG V++ + KE++F   LK++ KS I +  L  QL+REI+IQ +L HPNILRL N+FHD +R+Y++LE+A  G++  ++ K       R AT +++L D+++YCH K V+HRDIK  N+L+   G++K+ADFGWSVH  + R     G++ Y  PE++  +     + D+W IGV+ YE+L G  PF   +     +R ++ D R P ++   A  L+  +L   P +R+ L  IL H +V++ S   L  C
Sbjct:   25 QQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLARLKESHFIVALKVLFKSQIEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDARRVYLILEYAPRGELYKELQKSEKLDEQRTATIIEELADALTYCHDKKVIHRDIKPENLLLGFRGEVKIADFGWSVHTPSLRRKTMCGTLDYLPPEMIEGRT-YDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPLGARDLISRLLRYQPLERLPLAQILKHPWVQAHSRRVLPPC 301          
BLAST of Kinase-like protein vs. Ensembl Human
Match: AURKC (aurora kinase C [Source:HGNC Symbol;Acc:HGNC:11391])

HSP 1 Score: 216.853 bits (551), Expect = 8.151e-69
Identity = 105/268 (39.18%), Postives = 164/268 (61.19%), Query Frame = 2
Query:   53 LNISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKSFSENTLQEC 856
            L +  F+IG  LG G+FG V++ + KE++F   LK++ KS I +  L  QL+REI+IQ +L HPNILRL N+FHD +R+Y++LE+A  G++  ++ K       R AT +++L D+++YCH K V+HRDIK  N+L+   G++K+ADFGWSVH  + R     G++ Y  PE++  +     + D+W IGV+ YE+L G  PF   +     +R ++ D R P ++   A  L+  +L   P +R+ L  IL H +V++ S   L  C
Sbjct:    4 LTVDDFEIGRPLGKGKFGNVYLARLKESHFIVALKVLFKSQIEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDARRVYLILEYAPRGELYKELQKSEKLDEQRTATIIEELADALTYCHDKKVIHRDIKPENLLLGFRGEVKIADFGWSVHTPSLRRKTMCGTLDYLPPEMIEGRT-YDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPLGARDLISRLLRYQPLERLPLAQILKHPWVQAHSRRVLPPC 270          
BLAST of Kinase-like protein vs. Ensembl Human
Match: AURKC (aurora kinase C [Source:HGNC Symbol;Acc:HGNC:11391])

HSP 1 Score: 213.001 bits (541), Expect = 2.150e-67
Identity = 105/268 (39.18%), Postives = 163/268 (60.82%), Query Frame = 2
Query:   53 LNISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKSFSENTLQEC 856
            L +  F+IG  LG G+FG V++ + KE++F   LK++ KS I +  L  QL+REI+IQ +L HPNILRL N+FHD +R+Y++LE+A  G++  ++ K       R AT +++L D+++YCH K V+HRDIK  N+L+   G++K+ADFGWSVH    R     G++ Y  PE++  +     + D+W IGV+ YE+L G  PF   +     +R ++ D R P ++   A  L+  +L   P +R+ L  IL H +V++ S   L  C
Sbjct:    4 LTVDDFEIGRPLGKGKFGNVYLARLKESHFIVALKVLFKSQIEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDARRVYLILEYAPRGELYKELQKSEKLDEQRTATIIEELADALTYCHDKKVIHRDIKPENLLLGFRGEVKIADFGWSVHPLPERK-TMCGTLDYLPPEMIEGRT-YDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPLGARDLISRLLRYQPLERLPLAQILKHPWVQAHSRRVLPPC 269          
BLAST of Kinase-like protein vs. Ensembl Celegans
Match: air-2 (Aurora/IPL1-related protein kinase 2 [Source:UniProtKB/Swiss-Prot;Acc:O01427])

HSP 1 Score: 197.208 bits (500), Expect = 2.750e-61
Identity = 99/278 (35.61%), Postives = 159/278 (57.19%), Query Frame = 2
Query:   38 QMNKPLNISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKSFSENTLQECKASEI 871
            Q      I+ F+IG  LG G+FG V++ + K  +F   +K++ KS +    +  QL+REI+IQ +L HPNI++L  +F D K+IY++LE+A  G++   ++    +S   AA Y+ ++ D++SYCH K V+HRDIK  N+LI S G++K+ DFGWSVH  +++     G++ Y  PE+V          D+W+IGV+ YE L G  PF HE+            F  P ++   A  L+  +L V+P+ R TL  +  H +++   E  ++  K  +I
Sbjct:   20 QKGGKFTINDFEIGRPLGKGKFGSVYLARTKTGHFHVAIKVLFKSQLISGGVEHQLEREIEIQSHLNHPNIIKLYTYFWDAKKIYLVLEYAPGGEMYKQLTVSKRFSEPTAAKYMYEIADALSYCHRKNVIHRDIKPENLLIGSQGELKIGDFGWSVHAPSNKRQTMCGTMDYLPPEMV-NGADHSDAVDLWAIGVLCYEFLVGKPPFEHEDQSKTYAAIKAARFTYPDSVKKGARDLIGRLLVVDPKARCTLEQVKEHYWIQGMMEAKIRAEKQQKI 296          
BLAST of Kinase-like protein vs. Ensembl Celegans
Match: air-1 (Aurora/Ipl1 Related kinase; Aurora/Ipl1-related protein kinase 1 [Source:UniProtKB/TrEMBL;Acc:G5EDL3])

HSP 1 Score: 197.593 bits (501), Expect = 3.718e-61
Identity = 104/259 (40.15%), Postives = 162/259 (62.55%), Query Frame = 2
Query:   68 FDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDI-SKYGPYSNAR-AATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKSFSE 838
            FD+G  LG G+FG VFI +EK+T     LK++ K+ + +  +  QLKREI+IQ +L HPNIL L  +FHD KR++++L++A  G++ N + S+ G   N   A  +++QL +++ YCHSK V+HRDIK  N+L+ S   +KLADFGWSV  ++S+     G++ Y APE+V  + P  +  DIW+IG++L+EML G  PF ++    +  R  E    IP  ++  A  L+  I+   PQ+R+ L  I+ H ++K   +
Sbjct:   44 FDVGRPLGKGKFGNVFISREKKTKRIIALKVLFKTQLLQLGVSHQLKREIEIQYHLRHPNILTLYGYFHDDKRVFVILDYASRGELFNVLQSQPGHKVNEVIAGRFVRQLANALHYCHSKGVIHRDIKPENLLLDSKLNLKLADFGWSVVADHSKRHTLCGTMDYLAPEMVSNQ-PHDFNVDIWAIGILLFEMLVGYAPFANQTGDKLIARIKECKIYIPSVVTDGAASLINAIIKKEPQERLPLVDIMAHPWIKEMKQ 301          
BLAST of Kinase-like protein vs. Ensembl Celegans
Match: air-1 (Aurora/Ipl1 Related kinase; Aurora/Ipl1-related protein kinase 1 [Source:UniProtKB/TrEMBL;Acc:G5EDL3])

HSP 1 Score: 197.593 bits (501), Expect = 3.718e-61
Identity = 104/259 (40.15%), Postives = 162/259 (62.55%), Query Frame = 2
Query:   68 FDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDI-SKYGPYSNAR-AATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKSFSE 838
            FD+G  LG G+FG VFI +EK+T     LK++ K+ + +  +  QLKREI+IQ +L HPNIL L  +FHD KR++++L++A  G++ N + S+ G   N   A  +++QL +++ YCHSK V+HRDIK  N+L+ S   +KLADFGWSV  ++S+     G++ Y APE+V  + P  +  DIW+IG++L+EML G  PF ++    +  R  E    IP  ++  A  L+  I+   PQ+R+ L  I+ H ++K   +
Sbjct:   44 FDVGRPLGKGKFGNVFISREKKTKRIIALKVLFKTQLLQLGVSHQLKREIEIQYHLRHPNILTLYGYFHDDKRVFVILDYASRGELFNVLQSQPGHKVNEVIAGRFVRQLANALHYCHSKGVIHRDIKPENLLLDSKLNLKLADFGWSVVADHSKRHTLCGTMDYLAPEMVSNQ-PHDFNVDIWAIGILLFEMLVGYAPFANQTGDKLIARIKECKIYIPSVVTDGAASLINAIIKKEPQERLPLVDIMAHPWIKEMKQ 301          
BLAST of Kinase-like protein vs. Ensembl Celegans
Match: par-1 (Serine/threonine-protein kinase par-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9TW45])

HSP 1 Score: 167.933 bits (424), Expect = 1.946e-46
Identity = 88/261 (33.72%), Postives = 158/261 (60.54%), Query Frame = 2
Query:   44 NKPLNISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLN-YVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFV 823
            ++ +++  + +   +G G F KV + K   T  +  +K+I+K+ +N ++L ++L RE++I K L HPNI++L       + +Y++LE+A  G+V + +  +G      A    +Q+V +V Y HSK ++HRD+K+ N+L+  +  IK+ADFG+S   +    L+ + GS  Y APE+   K   G E D+WS+GV+LY +++G+LPF  +N   + +R + G +RIP  +S     LL+  L +NPQ+R +L++I+   ++
Sbjct:   76 DQDVHVGKYKLLKTIGKGNFAKVKLAKHVITGHEVAIKIIDKTALNPSSL-QKLFREVKIMKQLDHPNIVKLYQVMETEQTLYLVLEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYLHSKNIIHRDLKAENLLLDQDMNIKIADFGFSNTFSLGNKLDTFCGSPPYAAPELFSGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLVINPQRRSSLDNIMKDRWM 335          
BLAST of Kinase-like protein vs. Ensembl Celegans
Match: par-1 (Serine/threonine-protein kinase par-1 [Source:UniProtKB/Swiss-Prot;Acc:Q9TW45])

HSP 1 Score: 167.933 bits (424), Expect = 1.987e-46
Identity = 88/261 (33.72%), Postives = 158/261 (60.54%), Query Frame = 2
Query:   44 NKPLNISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLN-YVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFV 823
            ++ +++  + +   +G G F KV + K   T  +  +K+I+K+ +N ++L ++L RE++I K L HPNI++L       + +Y++LE+A  G+V + +  +G      A    +Q+V +V Y HSK ++HRD+K+ N+L+  +  IK+ADFG+S   +    L+ + GS  Y APE+   K   G E D+WS+GV+LY +++G+LPF  +N   + +R + G +RIP  +S     LL+  L +NPQ+R +L++I+   ++
Sbjct:   11 DQDVHVGKYKLLKTIGKGNFAKVKLAKHVITGHEVAIKIIDKTALNPSSL-QKLFREVKIMKQLDHPNIVKLYQVMETEQTLYLVLEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYLHSKNIIHRDLKAENLLLDQDMNIKIADFGFSNTFSLGNKLDTFCGSPPYAAPELFSGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLVINPQRRSSLDNIMKDRWM 270          
BLAST of Kinase-like protein vs. Ensembl Fly
Match: aurA (gene:FBgn0000147 transcript:FBtr0082483)

HSP 1 Score: 217.238 bits (552), Expect = 1.342e-67
Identity = 106/274 (38.69%), Postives = 174/274 (63.50%), Query Frame = 2
Query:   23 QFQHQQMNKPLNISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDI--SKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKSFSE 838
            + Q Q+  K   ++ FDIG +LG G+FG V++ +EKE+ F   LK++ K  I E+N+  Q++REI+IQ +L HP+ILRL  +FHD  RIY++LE+A  G + N +       +   ++ATY+Q L  ++ Y H + ++HRDIK  N+L+   G +K+ADFGWSVH+ NS  +   G++ Y  PE+V  K P     D+WS+GV+ +E+L G  PFY +N     K+ ++ D+++P +IS  A  L+  +L +NPQ R+ L+ ++ H ++ + ++
Sbjct:  139 ETQPQKPKKTWELNNFDIGRLLGRGKFGNVYLAREKESQFVVALKVLFKRQIGESNVEHQVRREIEIQSHLRHPHILRLYAYFHDDVRIYLILEYAPQGTLFNALQAQPMKRFDERQSATYIQALCSALLYLHERDIIHRDIKPENLLLGHKGVLKIADFGWSVHEPNSMRMTLCGTVDYLPPEMVQGK-PHTKNVDLWSLGVLCFELLVGHAPFYSKNYDETYKKILKVDYKLPEHISKAASHLISKLLVLNPQHRLPLDQVMVHPWILAHTQ 411          
BLAST of Kinase-like protein vs. Ensembl Fly
Match: aurB (gene:FBgn0024227 transcript:FBtr0080180)

HSP 1 Score: 174.866 bits (442), Expect = 3.297e-52
Identity = 93/284 (32.75%), Postives = 159/284 (55.99%), Query Frame = 2
Query:   17 VEQFQHQQMNKPLNISM--FDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGP---YSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKS-FSENTLQ 850
            ++   H    +P + S   F++G  LG G+FG+V++ +E+ +++   +K++ K ++ +  + RQ+ REI+IQ  L HP+ILRLL  FHD  RIY+ LE A  G++   + +  P   +   R+A Y  Q+ ++++YCH   V+HRD+K  NIL+ S   +KLADFGWS H  N++     G++ Y  PE+V          D W +G++ YE + G  PF   ++ +   +    +   P ++S     L+ G+L    + R+TL  ++ H +VK+  +E  LQ
Sbjct:   34 LKMMSHDAYGQPYDWSPRDFEMGAHLGRGKFGRVYLARERHSHYLVAMKVMFKEELRKGCVQRQVLREIEIQSRLKHPHILRLLTWFHDESRIYLALEIASEGELFKHL-RGAPNHRFDEPRSAKYTYQVANALNYCHLNNVIHRDLKPENILLTSTDDLKLADFGWSAHTPNNKRRTLCGTLDYLPPEMV-DGNSYDDSVDQWCLGILCYEFVVGCPPFESNSTESTYSKIRRMEISYPSHLSKGCKELIGGLLRKESKGRITLVDVMTHYWVKAGMAERELQ 315          
BLAST of Kinase-like protein vs. Ensembl Fly
Match: Sik2 (gene:FBgn0025625 transcript:FBtr0070340)

HSP 1 Score: 179.874 bits (455), Expect = 1.823e-50
Identity = 95/263 (36.12%), Postives = 155/263 (58.94%), Query Frame = 2
Query:   38 QMNKPLNISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVH-KNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFV 823
            ++ +P+ +  +DI   +G G F  V + + + T  +  +K+I+KS +++ NL +++ RE++I K L HP+I++L         IYI+ E+A  G++ + I+KYG  S + A     Q++ +V YCH K ++HRD+K+ N+L+  N  IK+ADFG+S H K       + GS  Y APEV   K   G E DIWS+GVVLY ++ G LPF      ++  R + G FRIP  +S +   L+R +L + P +R T++ I  H ++
Sbjct:  131 KLKEPMRVGFYDIERTIGKGNFAVVKLARHRITKNEVAIKIIDKSQLDQTNL-QKVYREVEIMKRLKHPHIIKLYQVMETKNMIYIVSEYASQGEIFDYIAKYGRMSESAARFKFWQIISAVEYCHKKGIVHRDLKAENLLLDLNMNIKIADFGFSNHFKPGELLATWCGSPPYAAPEVFEGKQYTGPEIDIWSLGVVLYVLVCGALPFDGSTLQSLRDRVLSGRFRIPFFMSSECEHLIRRMLVLEPTRRYTIDQIKRHRWM 392          
BLAST of Kinase-like protein vs. Ensembl Fly
Match: Sik3 (gene:FBgn0262103 transcript:FBtr0344259)

HSP 1 Score: 172.555 bits (436), Expect = 5.969e-48
Identity = 99/272 (36.40%), Postives = 152/272 (55.88%), Query Frame = 2
Query:   41 MNKPLNISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNL-NYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKSFSENTLQE 853
            ++K L +  +++   +G G F  V +     T  K  +K+I+K+ +NE  L +   REI I K+L HP+I RL         IY++ E+A NG++ + +   G      AA    QLV +V YCH + V+HRD+K+ N+L+  +  IKLADFG+S H      L  + GS  Y APEV       G ++DIWS+GVVLY ++ G LPF  +  L +  R V G FRIP  +S +   L+R +L V P +R T+  I+ H ++  + ++ +QE
Sbjct:   32 VDKLLRVGYYELEKTIGKGNFAVVKLATNIVTKTKVAIKIIDKTCLNEEYLNKTF-REIAILKSLRHPHITRLYEVMESQSMIYLVTEYAPNGEIFDHLVANGRMKEPEAARVFTQLVSAVHYCHRRGVVHRDLKAENVLLDKDMNIKLADFGFSNHYEEGATLKTWCGSPPYAAPEVFQGLEYDGPKSDIWSLGVVLYALVCGALPFDGKTILELKSRVVLGKFRIPFFMSQECEQLIRNMLVVEPDRRYTIKQIIKHRWLSEW-QSEMQE 301          
BLAST of Kinase-like protein vs. Ensembl Fly
Match: Sik3 (gene:FBgn0262103 transcript:FBtr0344258)

HSP 1 Score: 172.555 bits (436), Expect = 5.972e-48
Identity = 99/272 (36.40%), Postives = 152/272 (55.88%), Query Frame = 2
Query:   41 MNKPLNISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNL-NYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKSFSENTLQE 853
            ++K L +  +++   +G G F  V +     T  K  +K+I+K+ +NE  L +   REI I K+L HP+I RL         IY++ E+A NG++ + +   G      AA    QLV +V YCH + V+HRD+K+ N+L+  +  IKLADFG+S H      L  + GS  Y APEV       G ++DIWS+GVVLY ++ G LPF  +  L +  R V G FRIP  +S +   L+R +L V P +R T+  I+ H ++  + ++ +QE
Sbjct:   32 VDKLLRVGYYELEKTIGKGNFAVVKLATNIVTKTKVAIKIIDKTCLNEEYLNKTF-REIAILKSLRHPHITRLYEVMESQSMIYLVTEYAPNGEIFDHLVANGRMKEPEAARVFTQLVSAVHYCHRRGVVHRDLKAENVLLDKDMNIKLADFGFSNHYEEGATLKTWCGSPPYAAPEVFQGLEYDGPKSDIWSLGVVLYALVCGALPFDGKTILELKSRVVLGKFRIPFFMSQECEQLIRNMLVVEPDRRYTIKQIIKHRWLSEW-QSEMQE 301          
BLAST of Kinase-like protein vs. Ensembl Zebrafish
Match: aurkb (aurora kinase B [Source:NCBI gene;Acc:791894])

HSP 1 Score: 217.624 bits (553), Expect = 7.721e-69
Identity = 106/275 (38.55%), Postives = 168/275 (61.09%), Query Frame = 2
Query:   44 NKPLNISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKSFSENTLQECKASE 868
            +K L+I  FDIG  LG G+FG V++ +E++      LK++ KS + +  +  QL+REI+IQ +L HPNILR  N+FHD  R++++LE+A  G++  ++ +YG + + R ATY++++ D++ YCH K V+HRDIK  N+L+   G++K+ADFGWSVH  + R     G++ Y  PE++        + D+WSIGV+ YE L G  PF   +     KR  + D + P  +S  A  L+  +L  +P  R+ L S++ H +VK+ S   L    +SE
Sbjct:   45 SKVLSIDDFDIGRPLGKGKFGNVYLARERKLKVVIALKVLFKSQMVKEGVEHQLRREIEIQSHLRHPNILRFYNYFHDDTRVFLILEYAPRGEMYKELQRYGHFDDQRTATYMEEVSDALQYCHEKKVIHRDIKPENLLLGYRGELKIADFGWSVHAPSLRRRTMCGTLDYLPPEMI-EGHSHDEKVDLWSIGVLCYECLVGNPPFETASHAETYKRITKVDLQFPKLVSEGARDLISKLLRHSPSMRLPLRSVMEHPWVKANSRRVLPPVCSSE 318          
BLAST of Kinase-like protein vs. Ensembl Zebrafish
Match: aurka (aurora kinase A [Source:ZFIN;Acc:ZDB-GENE-040801-161])

HSP 1 Score: 217.624 bits (553), Expect = 1.023e-67
Identity = 99/252 (39.29%), Postives = 161/252 (63.89%), Query Frame = 2
Query:   68 FDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFV 823
            FDIG  LG G+FG V++ +E++T F   LK++ K  + +  +  QL+RE++IQ +L HPNILRL  +FHD  R+Y++LEFA  G++  ++ + G + + R+ATY+ +L D++ YCHSK V+HRDIK  N+L+ +NG++K+ADFGWSVH  +SR     G++ Y  PE++  K     + D+WS+GV+ YE L G  PF  ++     ++    +F  P ++S  +  L+  +L  NP  R+ +  ++ H +V
Sbjct:  138 FDIGRALGKGKFGSVYLAREQQTKFILALKVLFKKQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDAARVYLILEFAPKGELYGELQRCGTFDDQRSATYIMELADALRYCHSKAVIHRDIKPENLLLGANGELKIADFGWSVHTPSSRRSTLCGTLDYLPPEMIEGKT-HDEKVDLWSLGVLCYEFLVGRPPFETKSHEETYRKISRVEFTYPAHVSNGSRDLINRLLKHNPMHRLPIQGVMEHPWV 388          
BLAST of Kinase-like protein vs. Ensembl Zebrafish
Match: aurka (aurora kinase A [Source:ZFIN;Acc:ZDB-GENE-040801-161])

HSP 1 Score: 171.785 bits (434), Expect = 2.148e-51
Identity = 72/152 (47.37%), Postives = 111/152 (73.03%), Query Frame = 2
Query:   68 FDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNS 523
            FDIG  LG G+FG V++ +E++T F   LK++ K  + +  +  QL+RE++IQ +L HPNILRL  +FHD  R+Y++LEFA  G++  ++ + G + + R+ATY+ +L D++ YCHSK V+HRDIK  N+L+ +NG++K+ADFGWSVH  +S
Sbjct:  138 FDIGRALGKGKFGSVYLAREQQTKFILALKVLFKKQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDAARVYLILEFAPKGELYGELQRCGTFDDQRSATYIMELADALRYCHSKAVIHRDIKPENLLLGANGELKIADFGWSVHTPSS 289          
BLAST of Kinase-like protein vs. Ensembl Zebrafish
Match: mark3a (MAP/microtubule affinity-regulating kinase 3a [Source:ZFIN;Acc:ZDB-GENE-030131-6232])

HSP 1 Score: 169.088 bits (427), Expect = 3.366e-48
Identity = 91/257 (35.41%), Postives = 152/257 (59.14%), Query Frame = 2
Query:   86 LGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLN-YVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKS-FSENTLQ 850
            +G G F KV + +   T  +  +KMI+K+ +N  +L ++L RE+ I KNL HPNI++L       K +++++E+A  G+V + +  +G      A    +Q+V +V YCH K ++HRD+K+ N+L+  +  IK+ADFG+S        L+ + GS  Y APE+   K   G E D+WS+GV+LY +++G+LPF  +N   + +R + G +RIP  +S     LL+  L +NP +R TL  I+   ++ S F ++ L+
Sbjct:   63 IGKGNFAKVKLARHILTGSEVAIKMIDKTQLNPTSL-QKLSREVTIMKNLNHPNIVKLFEVIETEKTLFLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKRIVHRDLKAENLLLDGDMNIKIADFGFSNEFMVGSKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKRFLVLNPAKRGTLEQIMKERWINSGFEDDELK 318          
BLAST of Kinase-like protein vs. Ensembl Zebrafish
Match: MARK4 (si:dkey-31m14.7 [Source:ZFIN;Acc:ZDB-GENE-121214-92])

HSP 1 Score: 165.236 bits (417), Expect = 6.972e-48
Identity = 89/253 (35.18%), Postives = 150/253 (59.29%), Query Frame = 2
Query:   86 LGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLN-YVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKSFSEN 841
            +G G F KV + +   T  +  +K+I+K+ +N  +L ++L RE++I K L HPNI++L       K +Y+++E+A  G+V + +  +G      A    +Q+V +V YCH K ++HRD+K+ N+L+ ++  IK+ADFG+S        L+ + GS  Y APE+   K   G E DIWS+GV+LY +++G+LPF  +N   + +R + G +R+P  +S     +LR  L +NP +R TL  I+  +++    EN
Sbjct:   64 IGKGNFAKVKLARHILTGREVAIKIIDKTQLNPTSL-QKLFREVRIMKGLNHPNIVQLFEVIETEKTLYLVMEYASGGEVFDYLVSHGRMKEKEARGKFRQIVSAVHYCHLKNIVHRDLKAENLLLDADSNIKIADFGFSNEFTLGSKLDTFCGSPPYAAPELFQGKKYDGPEVDIWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRVPFYMSTDCEGILRRFLVLNPTKRCTLEQIMKDKWMNVGYEN 315          
BLAST of Kinase-like protein vs. Ensembl Xenopus
Match: aurkb (aurora kinase B [Source:NCBI gene;Acc:549613])

HSP 1 Score: 219.935 bits (559), Expect = 5.306e-69
Identity = 103/265 (38.87%), Postives = 163/265 (61.51%), Query Frame = 2
Query:   53 LNISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKSFSENTL 847
              I  FDIG  LG G+FG V++ ++K+  F   LK++ KS + +  +  QL+REI+IQ +L HPNILR+ N+FHD KRIY++LEFA  G++  ++ K+G +   R+AT++++L D++ YCH + V+HRDIK  N+L+   G++K+ADFGWSVH  + R     G++ Y  PE++  K     + D+W  GV+ +E L G  PF   +     +R V  D + P  +S  +  L+  +L  +P QR+ L  ++ H +VK+ S   L
Sbjct:   88 FTIDDFDIGRPLGKGKFGNVYLARDKQNKFIMALKVLFKSQLEKEGVEHQLRREIEIQSHLRHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQKHGRFDEQRSATFMEELADALQYCHERKVIHRDIKPENLLMGYKGELKIADFGWSVHAPSLRRRTMCGTLDYLPPEMIEGKT-HDEKVDLWCAGVLCFEFLVGMPPFDSPSHTETHRRIVNVDLKFPPFLSDGSKDLISKLLRYHPPQRLPLKGVMEHPWVKANSRRVL 351          
BLAST of Kinase-like protein vs. Ensembl Xenopus
Match: aurkb (aurora kinase B [Source:NCBI gene;Acc:549613])

HSP 1 Score: 219.935 bits (559), Expect = 6.232e-69
Identity = 103/265 (38.87%), Postives = 163/265 (61.51%), Query Frame = 2
Query:   53 LNISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKSFSENTL 847
              I  FDIG  LG G+FG V++ ++K+  F   LK++ KS + +  +  QL+REI+IQ +L HPNILR+ N+FHD KRIY++LEFA  G++  ++ K+G +   R+AT++++L D++ YCH + V+HRDIK  N+L+   G++K+ADFGWSVH  + R     G++ Y  PE++  K     + D+W  GV+ +E L G  PF   +     +R V  D + P  +S  +  L+  +L  +P QR+ L  ++ H +VK+ S   L
Sbjct:   98 FTIDDFDIGRPLGKGKFGNVYLARDKQNKFIMALKVLFKSQLEKEGVEHQLRREIEIQSHLRHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQKHGRFDEQRSATFMEELADALQYCHERKVIHRDIKPENLLMGYKGELKIADFGWSVHAPSLRRRTMCGTLDYLPPEMIEGKT-HDEKVDLWCAGVLCFEFLVGMPPFDSPSHTETHRRIVNVDLKFPPFLSDGSKDLISKLLRYHPPQRLPLKGVMEHPWVKANSRRVL 361          
BLAST of Kinase-like protein vs. Ensembl Xenopus
Match: aurkb (aurora kinase B [Source:NCBI gene;Acc:549613])

HSP 1 Score: 219.935 bits (559), Expect = 8.057e-69
Identity = 103/265 (38.87%), Postives = 163/265 (61.51%), Query Frame = 2
Query:   53 LNISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKSFSENTL 847
              I  FDIG  LG G+FG V++ ++K+  F   LK++ KS + +  +  QL+REI+IQ +L HPNILR+ N+FHD KRIY++LEFA  G++  ++ K+G +   R+AT++++L D++ YCH + V+HRDIK  N+L+   G++K+ADFGWSVH  + R     G++ Y  PE++  K     + D+W  GV+ +E L G  PF   +     +R V  D + P  +S  +  L+  +L  +P QR+ L  ++ H +VK+ S   L
Sbjct:  103 FTIDDFDIGRPLGKGKFGNVYLARDKQNKFIMALKVLFKSQLEKEGVEHQLRREIEIQSHLRHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQKHGRFDEQRSATFMEELADALQYCHERKVIHRDIKPENLLMGYKGELKIADFGWSVHAPSLRRRTMCGTLDYLPPEMIEGKT-HDEKVDLWCAGVLCFEFLVGMPPFDSPSHTETHRRIVNVDLKFPPFLSDGSKDLISKLLRYHPPQRLPLKGVMEHPWVKANSRRVL 366          
BLAST of Kinase-like protein vs. Ensembl Xenopus
Match: zbtb39 (zinc finger and BTB domain containing 39 [Source:Xenbase;Acc:XB-GENE-957946])

HSP 1 Score: 212.616 bits (540), Expect = 1.521e-65
Identity = 100/267 (37.45%), Postives = 168/267 (62.92%), Query Frame = 2
Query:   68 FDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKSFSENTLQECKASE 868
            F+IG  LG G+FG V++ +E+E+ F   LK++ K+ + +  +  QL+RE++IQ +L HPNILRL  +FHD  R+Y++L++A  G++  ++ K   +   ++A Y++QL +++ YCHSK V+HRDIK  N+L+ +NG++K+ADFGWSVH  +SR     G++ Y  PE++  +     + D+WS+GV+ YE L G  PF  +      +R  + +F+ P  +S  A  L+  +L  NP  R++L  +L H ++    +N+ Q+ K  E
Sbjct:  146 FEIGRPLGKGKFGNVYLARERESKFILALKVLFKTQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDAARVYLILDYAPGGELFRELQKVTRFDEQKSALYIKQLAEALLYCHSKNVIHRDIKPENLLLGANGELKIADFGWSVHAPSSRRTTLCGTLDYLPPEMIEGRM-HDEKVDLWSLGVLCYEFLVGKPPFETDTHQETYRRISKVEFQYPSYVSEGARDLVSKLLKHNPNHRLSLKGVLEHPWI---IDNSAQKPKRKE 408          
BLAST of Kinase-like protein vs. Ensembl Xenopus
Match: ENSXETT00000045600.1 (MAP/microtubule affinity-regulating kinase 4 [Source:NCBI gene;Acc:100491038])

HSP 1 Score: 171.014 bits (432), Expect = 2.016e-48
Identity = 93/263 (35.36%), Postives = 156/263 (59.32%), Query Frame = 2
Query:   86 LGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLN-YVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVK-SFSENTLQECKASE 868
            +G G F KV + +   T  +  +K+I+K+ +N ++L ++L RE++I K L HPNI++L       K +Y+++E+A  G+V + +  +G      A    +Q+V +V YCH K ++HRD+K+ N+L+ S   IK+ADFG+S        L+ + GS  Y APE+   K   G E D+WS+GV+LY +++G+LPF  +N   + +R + G +RIP  +S     +LR  L +NP +R TL+ I+N +++   F  + L+  K  E
Sbjct:   57 IGKGNFAKVKLARHVLTGREVAIKIIDKTQLNPSSL-QKLFREVRIMKGLNHPNIVKLFEVIETEKTLYLIMEYASGGEVFDYLVSHGRMKEKEARAKFRQIVSAVHYCHQKNIVHRDLKAENLLLDSESNIKIADFGFSNEFTPGGKLDTFCGSPPYAAPELFQGKRYNGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCEGVLRRFLVLNPSKRCTLDQIMNDKWMNIGFDSDDLKPYKEPE 318          
BLAST of Kinase-like protein vs. Ensembl Mouse
Match: Aurkc (aurora kinase C [Source:MGI Symbol;Acc:MGI:1321119])

HSP 1 Score: 220.32 bits (560), Expect = 2.311e-70
Identity = 105/268 (39.18%), Postives = 167/268 (62.31%), Query Frame = 2
Query:   44 NKPLNISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKSFSENTL 847
             K   I+ F+IG  LG G+FG+V++ + KE +F   LK++ KS+I +  L  QL+RE++IQ +L H NILRL N+F+D  RIY++LE+A  G++  ++ ++      R AT +Q+L D+++YCH K V+HRDIK  N+L+  NG++K++DFGWSVH  + R     G++ Y  PE++ +K P     D+W IGV+ YE+L G  PF    S    +R  + DF+ P ++   A  L+  +L  +P +R++L  +L H +V+  S   L
Sbjct:    8 RKHFTINDFEIGRPLGRGKFGRVYLARLKENHFIVALKVLFKSEIEKEGLEHQLRREVEIQAHLQHRNILRLYNYFYDDTRIYLILEYAPGGELYKELQRHQKLDQQRTATIIQELSDALTYCHEKKVIHRDIKPENLLLGLNGEVKISDFGWSVHTPSLRRKTMCGTLDYLPPEMIAQK-PYNEMVDLWCIGVLCYELLVGKPPFESSTSSETYRRIRQVDFKFPSSVPAGAQDLISKLLRYHPSERLSLAQVLKHPWVREHSRRVL 274          
BLAST of Kinase-like protein vs. Ensembl Mouse
Match: Aurkc (aurora kinase C [Source:MGI Symbol;Acc:MGI:1321119])

HSP 1 Score: 220.32 bits (560), Expect = 2.311e-70
Identity = 105/268 (39.18%), Postives = 167/268 (62.31%), Query Frame = 2
Query:   44 NKPLNISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKSFSENTL 847
             K   I+ F+IG  LG G+FG+V++ + KE +F   LK++ KS+I +  L  QL+RE++IQ +L H NILRL N+F+D  RIY++LE+A  G++  ++ ++      R AT +Q+L D+++YCH K V+HRDIK  N+L+  NG++K++DFGWSVH  + R     G++ Y  PE++ +K P     D+W IGV+ YE+L G  PF    S    +R  + DF+ P ++   A  L+  +L  +P +R++L  +L H +V+  S   L
Sbjct:    8 RKHFTINDFEIGRPLGRGKFGRVYLARLKENHFIVALKVLFKSEIEKEGLEHQLRREVEIQAHLQHRNILRLYNYFYDDTRIYLILEYAPGGELYKELQRHQKLDQQRTATIIQELSDALTYCHEKKVIHRDIKPENLLLGLNGEVKISDFGWSVHTPSLRRKTMCGTLDYLPPEMIAQK-PYNEMVDLWCIGVLCYELLVGKPPFESSTSSETYRRIRQVDFKFPSSVPAGAQDLISKLLRYHPSERLSLAQVLKHPWVREHSRRVL 274          
BLAST of Kinase-like protein vs. Ensembl Mouse
Match: Aurkc (aurora kinase C [Source:MGI Symbol;Acc:MGI:1321119])

HSP 1 Score: 220.32 bits (560), Expect = 8.278e-70
Identity = 105/268 (39.18%), Postives = 167/268 (62.31%), Query Frame = 2
Query:   44 NKPLNISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKSFSENTL 847
             K   I+ F+IG  LG G+FG+V++ + KE +F   LK++ KS+I +  L  QL+RE++IQ +L H NILRL N+F+D  RIY++LE+A  G++  ++ ++      R AT +Q+L D+++YCH K V+HRDIK  N+L+  NG++K++DFGWSVH  + R     G++ Y  PE++ +K P     D+W IGV+ YE+L G  PF    S    +R  + DF+ P ++   A  L+  +L  +P +R++L  +L H +V+  S   L
Sbjct:   47 RKHFTINDFEIGRPLGRGKFGRVYLARLKENHFIVALKVLFKSEIEKEGLEHQLRREVEIQAHLQHRNILRLYNYFYDDTRIYLILEYAPGGELYKELQRHQKLDQQRTATIIQELSDALTYCHEKKVIHRDIKPENLLLGLNGEVKISDFGWSVHTPSLRRKTMCGTLDYLPPEMIAQK-PYNEMVDLWCIGVLCYELLVGKPPFESSTSSETYRRIRQVDFKFPSSVPAGAQDLISKLLRYHPSERLSLAQVLKHPWVREHSRRVL 313          
BLAST of Kinase-like protein vs. Ensembl Mouse
Match: Aurka (aurora kinase A [Source:MGI Symbol;Acc:MGI:894678])

HSP 1 Score: 219.164 bits (557), Expect = 1.942e-68
Identity = 104/256 (40.62%), Postives = 161/256 (62.89%), Query Frame = 2
Query:   68 FDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKSFS 835
            FDIG  LG G+FG V++ +E+++ F   LK++ K+ + + N+  QL+RE++IQ +L HPNILRL  +FHD  R+Y++LE+A  G V  ++ K   +   R ATY+ +L +++SYCHSK V+HRDIK  N+L+ SNG++K+ADFGWSVH  +SR     G++ Y  PE++  +     + D+WS+GV+ YE L G  PF         +R    +F  P  ++  A  L+  +L  N  QR+TL  +L H ++K+ S
Sbjct:  124 FDIGRPLGKGKFGNVYLARERQSKFILALKVLFKTQLEKANVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSNGELKIADFGWSVHAPSSRRTTMCGTLDYLPPEMIEGRM-HDEKVDLWSLGVLCYEFLVGMPPFEAHTYQETYRRISRVEFTFPDFVTEGARDLISRLLKHNASQRLTLAEVLEHPWIKANS 378          
BLAST of Kinase-like protein vs. Ensembl Mouse
Match: Aurka (aurora kinase A [Source:MGI Symbol;Acc:MGI:894678])

HSP 1 Score: 219.164 bits (557), Expect = 1.942e-68
Identity = 104/256 (40.62%), Postives = 161/256 (62.89%), Query Frame = 2
Query:   68 FDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKSFS 835
            FDIG  LG G+FG V++ +E+++ F   LK++ K+ + + N+  QL+RE++IQ +L HPNILRL  +FHD  R+Y++LE+A  G V  ++ K   +   R ATY+ +L +++SYCHSK V+HRDIK  N+L+ SNG++K+ADFGWSVH  +SR     G++ Y  PE++  +     + D+WS+GV+ YE L G  PF         +R    +F  P  ++  A  L+  +L  N  QR+TL  +L H ++K+ S
Sbjct:  124 FDIGRPLGKGKFGNVYLARERQSKFILALKVLFKTQLEKANVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSNGELKIADFGWSVHAPSSRRTTMCGTLDYLPPEMIEGRM-HDEKVDLWSLGVLCYEFLVGMPPFEAHTYQETYRRISRVEFTFPDFVTEGARDLISRLLKHNASQRLTLAEVLEHPWIKANS 378          
BLAST of Kinase-like protein vs. UniProt/SwissProt
Match: sp|Q54WX4|AURK_DICDI (Aurora kinase OS=Dictyostelium discoideum OX=44689 GN=aurK PE=1 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 8.978e-74
Identity = 110/258 (42.64%), Postives = 170/258 (65.89%), Query Frame = 2
Query:   59 ISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYE--TDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVK 826
            I  FDIG +LG GRFG V++ +EK++ F   LK++ K+ +  +N+  QL+REI+IQ +L HPNILRL  +F+D KR+++++EFA  G+   ++ K G ++   AATY  Q+ D++ YCHSK V+HRDIK  N+LI   G+IK+ADFGWSVH  N++   + G++ Y  PEV+ +K   GY+   D+WS+G++++E L G  PF  +    +     E D   P +ISP+A  L+  +L  +P QR+TL  ++NH ++K
Sbjct:  107 IDDFDIGKLLGMGRFGHVYLAREKKSQFIVALKVLFKNQLQTHNIEHQLRREIEIQSHLRHPNILRLFGYFYDDKRVFLIIEFAKGGECFKELQKVGSFNEQTAATYTLQIADALRYCHSKHVIHRDIKPENLLIGVGGEIKIADFGWSVHAPNTKRSTFCGTLEYLPPEVIEKK---GYDQTADVWSLGILIFEFLVGRSPFTSDEEKNIFHNIQENDVYYPSSISPEAKDLISRLLVSDPHQRITLKDVINHPWIK 361          
BLAST of Kinase-like protein vs. UniProt/SwissProt
Match: sp|O59790|ARK1_SCHPO (Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ark1 PE=1 SV=2)

HSP 1 Score: 223.402 bits (568), Expect = 1.069e-69
Identity = 109/274 (39.78%), Postives = 174/274 (63.50%), Query Frame = 2
Query:   47 KPLNISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVD-KRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKSFSENTLQECKAS 865
            +  +I MF+IG  LG G+FG+V++ KEK+T F   LK ++KS++ ++ + +Q++REI+IQ NL H NILRL  HFHD KRIY++LEFA  G++   + +   +S   A+ Y+ Q+ +++SY H K V+HRDIK  NIL+  +G+IKL+DFGWSVH  ++R     G++ Y  PE+V  K     + D+WS+GV+ YE L G  PF   +  +   KR  + D +IP  + P A  L+  +L  NP++RM+L  ++ H ++  + ++  ++   S
Sbjct:   82 REFHIGMFEIGKPLGKGKFGRVYLAKEKKTGFIVALKTLHKSELVQSKIEKQVRREIEIQSNLRHKNILRLYGHFHDEKRIYLILEFAGRGELYQHLRRAKRFSEEVASKYIFQMANALSYLHKKHVIHRDIKPENILLGIDGEIKLSDFGWSVHAPSNRRTTLCGTLDYLPPEMVEGK-EHTEKVDLWSLGVLTYEFLVGAPPFEDMSGHSATYKRIAKVDLKIPSFVPPDARDLISRLLQHNPEKRMSLEQVMRHPWIVKYKDSWTRKSSES 354          
BLAST of Kinase-like protein vs. UniProt/SwissProt
Match: sp|O88445|AURKC_MOUSE (Aurora kinase C OS=Mus musculus OX=10090 GN=Aurkc PE=1 SV=2)

HSP 1 Score: 220.32 bits (560), Expect = 1.616e-69
Identity = 105/268 (39.18%), Postives = 167/268 (62.31%), Query Frame = 2
Query:   44 NKPLNISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKSFSENTL 847
             K   I+ F+IG  LG G+FG+V++ + KE +F   LK++ KS+I +  L  QL+RE++IQ +L H NILRL N+F+D  RIY++LE+A  G++  ++ ++      R AT +Q+L D+++YCH K V+HRDIK  N+L+  NG++K++DFGWSVH  + R     G++ Y  PE++ +K P     D+W IGV+ YE+L G  PF    S    +R  + DF+ P ++   A  L+  +L  +P +R++L  +L H +V+  S   L
Sbjct:    8 RKHFTINDFEIGRPLGRGKFGRVYLARLKENHFIVALKVLFKSEIEKEGLEHQLRREVEIQAHLQHRNILRLYNYFYDDTRIYLILEYAPGGELYKELQRHQKLDQQRTATIIQELSDALTYCHEKKVIHRDIKPENLLLGLNGEVKISDFGWSVHTPSLRRKTMCGTLDYLPPEMIAQK-PYNEMVDLWCIGVLCYELLVGKPPFESSTSSETYRRIRQVDFKFPSSVPAGAQDLISKLLRYHPSERLSLAQVLKHPWVREHSRRVL 274          
BLAST of Kinase-like protein vs. UniProt/SwissProt
Match: sp|Q6GPL3|AUKBB_XENLA (Aurora kinase B-B OS=Xenopus laevis OX=8355 GN=aurkb-b PE=2 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 2.591e-69
Identity = 105/265 (39.62%), Postives = 163/265 (61.51%), Query Frame = 2
Query:   53 LNISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKSFSENTL 847
              I  FDIG  LG G+FG V++ +EK+  F   LK++ KS + +  +  QL+REI+IQ +L HPNILR+ N+FHD KRIY++LEFA  G++  ++ K+G +   R+AT++++L D++ YCH + V+HRDIK  N+L+   G++K+ADFGWSVH  + R     G++ Y  PE++  K     + D+W  GV+ YE L G  PF   +     +R V  D + P  +S  +  L+  +L  +P QR+ L  ++ H +VK+ S   L
Sbjct:   95 FTIDDFDIGRPLGKGKFGNVYLAREKQNKFIMALKVLFKSQLEKEGVEHQLRREIEIQSHLRHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQKHGRFDEQRSATFMEELADALQYCHERKVIHRDIKPENLLMGYKGELKIADFGWSVHAPSLRRRTMCGTLDYLPPEMIEGKT-HDEKVDLWCAGVLCYEFLVGMPPFDSPSHSETHRRIVNVDLKFPPFLSEGSKDLISKLLRYHPAQRLPLKGVMEHPWVKANSRRVL 358          
BLAST of Kinase-like protein vs. UniProt/SwissProt
Match: sp|Q6DE08|AUKBA_XENLA (Aurora kinase B-A OS=Xenopus laevis OX=8355 GN=aurkb-a PE=1 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 2.940e-69
Identity = 105/265 (39.62%), Postives = 163/265 (61.51%), Query Frame = 2
Query:   53 LNISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKSFSENTL 847
              I  FDIG  LG G+FG V++ +EK+  F   LK++ KS + +  +  QL+REI+IQ +L HPNILR+ N+FHD KRIY++LEFA  G++  ++ K+G +   R+AT++++L D++ YCH + V+HRDIK  N+L+   G++K+ADFGWSVH  + R     G++ Y  PE++  K     + D+W  GV+ YE L G  PF   +     +R V  D + P  +S  +  L+  +L  +P QR+ L  ++ H +VK+ S   L
Sbjct:   88 FTIDDFDIGRPLGKGKFGNVYLAREKQNKFIMALKVLFKSQLEKEGVEHQLRREIEIQSHLRHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQKHGRFDEQRSATFMEELADALHYCHERKVIHRDIKPENLLMGYKGELKIADFGWSVHAPSLRRRTMCGTLDYLPPEMIEGKT-HDEKVDLWCAGVLCYEFLVGMPPFDSPSHTETHRRIVNVDLKFPPFLSDGSKDLISKLLRYHPPQRLPLKGVMEHPWVKANSRRVL 351          
BLAST of Kinase-like protein vs. TrEMBL
Match: I1ZIC8 (Aurora kinase-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 271.937 bits (694), Expect = 5.512e-87
Identity = 131/282 (46.45%), Postives = 183/282 (64.89%), Query Frame = 2
Query:   41 MNKPLN--ISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKSFSENTLQECKASEIMWS 880
            M +P N  I  F IG  +G G+FG V++VKEK  NF   +KMI K+ I EN+L  QLKREI+I  +L HPNILRL  +FHD +R+Y+++E A  G++  DI KYG Y N RAATY+ QL  ++ YCH + VMHRDIK  NILI S GQ KLADFGWSVH          G++ Y APE+V  +    +E DIW +GV+LYEMLT ++PF   +     +R    +F +P  ++P A  +++ IL +NP+ R++L+ I+ H ++  FSE    +C+AS +MW+
Sbjct:    1 MTEPQNWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMV-EQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEKVTDDCQASRLMWA 281          
BLAST of Kinase-like protein vs. TrEMBL
Match: A0A4S2MQY4 (Putative serine/threonine protein kinase OS=Ascodesmis nigricans OX=341454 GN=EX30DRAFT_374223 PE=3 SV=1)

HSP 1 Score: 243.047 bits (619), Expect = 2.808e-74
Identity = 111/276 (40.22%), Postives = 177/276 (64.13%), Query Frame = 2
Query:   38 QMNKPLNISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKSFSENTLQECKAS 865
            Q  +  ++ MF+IG  LG G+FG+V++ KE++T F   LK+++K+++ +N + +QL+REI+IQ NL HPNILRL  HFHD KR++++LEFA  G++   + K G +   +AA Y+ Q+  ++ Y H K V+HRDIK  NIL+  +G+IK++DFGWSVH  +SR     G++ Y  PE++      G E D+WS+GV+ YE L G+ PF  +  +   +R V+ D +IP  +SP+A  L+R +L + P+QR+ L  +  H +++      +Q    S
Sbjct:  122 QPAREFHLGMFEIGRPLGKGKFGRVYLAKERKTGFVCALKVLHKNELQKNKVEKQLRREIEIQSNLRHPNILRLYGHFHDSKRVFLILEFAGRGELYKILRKAGKFPEPQAAEYIAQMAAALQYLHKKHVIHRDIKPENILVGIHGEIKISDFGWSVHAPSSRRTTMCGTLDYLPPEMLNGTGRHGAEVDLWSLGVLTYEFLVGSAPF-EDTPVETQRRIVQCDLKIPSYVSPEAADLIRRLLVLRPEQRIPLEDVPFHPWIQKHCAKLVQPAGQS 396          
BLAST of Kinase-like protein vs. TrEMBL
Match: S8AAX8 (Protein kinase domain-containing protein OS=Dactylellina haptotyla (strain CBS 200.50) OX=1284197 GN=H072_7982 PE=3 SV=1)

HSP 1 Score: 243.047 bits (619), Expect = 3.321e-74
Identity = 113/271 (41.70%), Postives = 179/271 (66.05%), Query Frame = 2
Query:   44 NKPLNISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEF-VKSFSENTLQE 853
            +K L++ MF+IG  LG G+FG+V++ KE++T F   LK+++KS++ E  +  QL+RE++IQ NL HPNILR   HFHD KR+++++E+A  G++   + K G +S  RAA+Y+ Q+  ++SY H K V+HRDIK  NIL+ S+G+IKL+DFGWSVH   +R     G++ Y  PE +LR+ P G + D+WS+GV++YE L G  PF  +       R V   +++P  +SP+A  L+  +L ++P++R+ L+ +  H + VK     T +E
Sbjct:  127 SKALHLGMFEIGRPLGKGKFGRVYLAKERKTGFLCALKVLHKSELQEGRVEVQLRREVEIQSNLRHPNILRFFGHFHDSKRVFLIIEYAAQGELYKMLRKAGSFSEPRAASYIAQMASALSYLHKKHVIHRDIKPENILVGSHGEIKLSDFGWSVHAPTNRRTTLCGTLDYLPPE-MLREEPHGEKVDLWSLGVLMYEFLVGAAPF-EDAPRETQSRIVRLRYQVPDFVSPEAKDLITRLLRLDPEKRLPLDQVAEHPWIVKHCKSQTARE 395          
BLAST of Kinase-like protein vs. TrEMBL
Match: A0A5J4NGG3 (Aurora kinase A OS=Paragonimus westermani OX=34504 GN=DEA37_0005574 PE=3 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 5.751e-74
Identity = 111/270 (41.11%), Postives = 179/270 (66.30%), Query Frame = 2
Query:   68 FDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKSFSENTLQECKASEIMW 877
             DIG  LG+G FG V++ +EKE+ F   LKM+ K +IN     +Q++REI+IQ +L HPNI+RL ++F+D KRIY++LE+A  G++S +++++  ++N+RAATY+ QL ++++YCH   V+HRDIK  NIL+CS G++K+ADFG +VH+  SR     G++ Y APEV+  +    +  D WS+GV+ YEMLTG +PF  +++  V  R    +F +P ++S  A  L+  +L   P+ R+ L  + +H +++  +E +L  C A+   W
Sbjct:   48 IDIGKKLGEGCFGSVYLAREKESRFVIALKMLIKEEINTQERVQQIQREIEIQSHLKHPNIVRLYDYFYDKKRIYLMLEYAPKGELSKELTRFRQFNNSRAATYVYQLSNAIAYCHQNDVIHRDIKPENILLCSRGEVKIADFGSAVHRPASRRTAPFGTLVYLAPEVMDPESSYEHSVDTWSLGVLTYEMLTGCVPFTGDSNTEVAARIQSCEFLLPDSVSSDAGDLICSMLRKTPELRIPLADVPSHPWMRHHAEFSLVRCTAALRDW 317          
BLAST of Kinase-like protein vs. TrEMBL
Match: U4LAX1 (Similar to Serine/threonine-protein kinase ark1 acc. no. O59790 OS=Pyronema omphalodes (strain CBS 100304) OX=1076935 GN=PCON_01927 PE=3 SV=1)

HSP 1 Score: 243.432 bits (620), Expect = 1.014e-73
Identity = 113/262 (43.13%), Postives = 173/262 (66.03%), Query Frame = 2
Query:   38 QMNKPLNISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFV 823
            Q  +  ++ MF+IG  LG G+FG+V++ KE++  F   LK+++K+++ +N + +QL+REI+IQ NL HPNIL+L  HFHD KR++++LEFA  G++   + K G +S  RAA Y+ Q+  ++ Y H K V+HRDIK  NIL+  +G+IKL+DFGWSVH  NSR     G++ Y  PE++        + D+WS+GV+ YE L G  PF  +  +   KR V+GD +IP  ISP+A  L+R +L V P QR+ ++ I+ H ++
Sbjct:  170 QAPREFHLGMFEIGRPLGKGKFGRVYLAKERKNGFVCALKVLHKNELQKNKVEKQLRREIEIQSNLRHPNILQLYGHFHDSKRVFLILEFAGQGELYKMLQKAGRFSEPRAAEYIAQMAAALQYLHKKHVIHRDIKPENILVGIHGEIKLSDFGWSVHAPNSRRTTMCGTLDYLPPEMLNGSQYHSDKVDLWSLGVLTYEFLVGAAPF-EDTPIETQKRIVKGDMKIPDFISPEAADLIRKLLVVKPDQRIPISDIMKHPWI 430          
BLAST of Kinase-like protein vs. Ensembl Cavefish
Match: aurka (aurora kinase C-like [Source:NCBI gene;Acc:103034578])

HSP 1 Score: 223.016 bits (567), Expect = 3.392e-70
Identity = 103/262 (39.31%), Postives = 166/262 (63.36%), Query Frame = 2
Query:   50 PLNISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKSFS 835
            P ++  FDIG  LG G+FG V++ +E++T F   LK++ K  + +  +  QL+RE++IQ +L HPNILRL  +FHD  R+Y++LEFA  G++  ++ + G + + R+ATY+ +L D++ YCHSK V+HRDIK  N+L+ +NG++K+ADFGWSVH  +SR     G++ Y  PE++  K     + D+WS+GV+ YE L G  PF  ++     ++    +F  P ++S  +  L+ G+L  NP  R+ +  +L H +V   S
Sbjct:  102 PWSLENFDIGRALGKGKFGSVYLARERQTKFILALKVLFKKQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDSARVYLILEFAPKGELYGELQRCGMFDDQRSATYIMELADALHYCHSKKVIHRDIKPENLLLGANGELKIADFGWSVHTPSSRRSTLCGTLDYLPPEMIEGKT-HDEKVDLWSLGVLCYEFLVGRPPFETKSHEETYRKISRVEFTYPAHVSEGSRNLINGLLKHNPMHRLPIQGVLTHYWVVEHS 362          
BLAST of Kinase-like protein vs. Ensembl Cavefish
Match: aurka (aurora kinase C-like [Source:NCBI gene;Acc:103034578])

HSP 1 Score: 223.016 bits (567), Expect = 9.144e-70
Identity = 102/258 (39.53%), Postives = 165/258 (63.95%), Query Frame = 2
Query:   50 PLNISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFV 823
            P ++  FDIG  LG G+FG V++ +E++T F   LK++ K  + +  +  QL+RE++IQ +L HPNILRL  +FHD  R+Y++LEFA  G++  ++ + G + + R+ATY+ +L D++ YCHSK V+HRDIK  N+L+ +NG++K+ADFGWSVH  +SR     G++ Y  PE++  K     + D+WS+GV+ YE L G  PF  ++     ++    +F  P ++S  +  L+ G+L  NP  R+ +  +L H +V
Sbjct:  148 PWSLENFDIGRALGKGKFGSVYLARERQTKFILALKVLFKKQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDSARVYLILEFAPKGELYGELQRCGMFDDQRSATYIMELADALHYCHSKKVIHRDIKPENLLLGANGELKIADFGWSVHTPSSRRSTLCGTLDYLPPEMIEGKT-HDEKVDLWSLGVLCYEFLVGRPPFETKSHEETYRKISRVEFTYPAHVSEGSRNLINGLLKHNPMHRLPIQGVLTHYWV 404          
BLAST of Kinase-like protein vs. Ensembl Cavefish
Match: aurkb (aurora kinase B [Source:NCBI gene;Acc:103024192])

HSP 1 Score: 200.29 bits (508), Expect = 2.831e-62
Identity = 98/267 (36.70%), Postives = 157/267 (58.80%), Query Frame = 2
Query:   47 KPLNISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKSFSENTL 847
            K   I  F IG  LG G+FG V++ +EK+      LK++ KS + +  +  QL+REI+I   L HPNILR  N+F+D  R++++LE+A  G++  ++ + G +S+ R AT+++++ D++ YCH   V+HRDIK  N+L+   G++K+ADFGWSVH  + R     G++ Y  PE++        + D+W IGV+ YE L G  PF   +     KR  + D   P  +S  A  L+  +L  +P  R+ L S+++H +VK+ S   L
Sbjct:   28 KTFTIKDFHIGRPLGKGKFGNVYLAREKKLKVVVALKVLFKSQMEKEGVEHQLRREIEIHSRLRHPNILRFYNYFYDSSRVFLILEYAPRGEMYKELQRCGRFSDQRTATFMEEISDALQYCHENKVIHRDIKPENLLLGFRGELKIADFGWSVHAPSLRRRTMCGTLDYLPPEMI-EGHSHDEKVDLWCIGVLCYECLVGNPPFETASHSETYKRITKVDLHFPKVVSDGARDLISKLLRHSPTMRLPLKSVIDHPWVKTNSRRVL 293          
BLAST of Kinase-like protein vs. Ensembl Cavefish
Match: aurkb (aurora kinase B [Source:NCBI gene;Acc:103024192])

HSP 1 Score: 200.675 bits (509), Expect = 3.272e-62
Identity = 98/267 (36.70%), Postives = 157/267 (58.80%), Query Frame = 2
Query:   47 KPLNISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKSFSENTL 847
            K   I  F IG  LG G+FG V++ +EK+      LK++ KS + +  +  QL+REI+I   L HPNILR  N+F+D  R++++LE+A  G++  ++ + G +S+ R AT+++++ D++ YCH   V+HRDIK  N+L+   G++K+ADFGWSVH  + R     G++ Y  PE++        + D+W IGV+ YE L G  PF   +     KR  + D   P  +S  A  L+  +L  +P  R+ L S+++H +VK+ S   L
Sbjct:   41 KTFTIKDFHIGRPLGKGKFGNVYLAREKKLKVVVALKVLFKSQMEKEGVEHQLRREIEIHSRLRHPNILRFYNYFYDSSRVFLILEYAPRGEMYKELQRCGRFSDQRTATFMEEISDALQYCHENKVIHRDIKPENLLLGFRGELKIADFGWSVHAPSLRRRTMCGTLDYLPPEMI-EGHSHDEKVDLWCIGVLCYECLVGNPPFETASHSETYKRITKVDLHFPKVVSDGARDLISKLLRHSPTMRLPLKSVIDHPWVKTNSRRVL 306          
BLAST of Kinase-like protein vs. Ensembl Cavefish
Match: sik1 (serine/threonine-protein kinase SIK2-like [Source:NCBI gene;Acc:103047200])

HSP 1 Score: 174.866 bits (442), Expect = 6.061e-49
Identity = 96/260 (36.92%), Postives = 153/260 (58.85%), Query Frame = 2
Query:   47 KPLNISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWS-VHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFV 823
            +PL +  ++I   LG G F  V + + K T  +  +K+I+K+ +N +NL  ++ RE+QI K L HP+I++L         +YI+ E+A NG++ + ++  G  S A A     Q++ +V YCH   ++HRD+K+ N+L+ +N  IKLADFG+   +K       + GS  Y APEV   K   G + DIWS+GVVLY ++ G+LPF  E+   + +R  EG FRIP  +S     L+R +L V+P +R+T+  I  H ++
Sbjct:   19 RPLQVGFYEILRTLGKGNFAVVKLARHKVTKTQVAIKIIDKTRLNSSNL-EKIYREVQIMKLLNHPHIIKLYQVMETKDMLYIVTEYAKNGEMFDFLTSNGRMSEAEARKKFWQILTAVDYCHRHHIVHRDLKTENLLLDANMNIKLADFGFGNFYKTGEPLSTWCGSPPYAAPEVFEGKEYEGPQLDIWSLGVVLYVLVCGSLPFDGESLPALRQRVTEGRFRIPFFMSEDCENLIRKMLVVDPAKRITVAQIKQHRWM 277          
BLAST of Kinase-like protein vs. Ensembl Sea Lamprey
Match: aurka (aurora kinase A [Source:ZFIN;Acc:ZDB-GENE-040801-161])

HSP 1 Score: 210.305 bits (534), Expect = 6.248e-67
Identity = 107/261 (41.00%), Postives = 163/261 (62.45%), Query Frame = 2
Query:   47 KPLNISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKS 829
            K  ++  FDIG  LG G+FG V++ +EK T F   LK++ KS + ++ +  QL+REI+IQ +L HPNILRL  +FHD  R+Y++LE+A  G++   + K G +   R+A+Y+  + D++ YCHSK V+HRDIK  N+L+   G++K+ADFGWSVH  +SR     G++ Y  PE++  +     + D+WS+GV+ YE L G  PF  E      +R  + D R P ++S  A  L+  +L  NP  R+ L S+L H +VK+
Sbjct:    8 KQWSLDNFDIGRPLGKGKFGNVYLAREKSTKFILALKVLFKSQLEKSGVEHQLRREIEIQSHLRHPNILRLYGYFHDRTRVYLILEYAPRGELYKLLQKLGKFDEERSASYVADMADALIYCHSKKVIHRDIKPENLLLGLKGELKIADFGWSVHAPSSRRATLCGTLDYLPPEMIEGRT-HDEKVDLWSLGVLCYEFLVGRPPFESETHNETYRRISKVDLRFPSHLSDGAKDLIANLLKHNPHTRLQLASVLQHPWVKA 267          
BLAST of Kinase-like protein vs. Ensembl Sea Lamprey
Match: MARK3 (microtubule affinity regulating kinase 3 [Source:HGNC Symbol;Acc:HGNC:6897])

HSP 1 Score: 158.303 bits (399), Expect = 1.701e-45
Identity = 85/247 (34.41%), Postives = 148/247 (59.92%), Query Frame = 2
Query:   86 LGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLN-YVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFV 823
            +G G F KV + K   T  +  +K+I+K+ +N ++L ++L RE++I K L HPNI++L       K +Y+++E++  G+V + +  +G      A    +Q+V +V YCH K ++HRD+K+ N+L+ ++  IK+ADFG+S        L+ + GS  Y APE+   K   G E D+WS+GV+LY +++G+LPF  +N   + +R + G +RIP  +S     LL+  L ++P +R +L  I+   ++
Sbjct:   74 IGKGNFAKVKLAKHTLTGQEVAVKIIDKTQLNTSSL-QKLFREVRIMKVLNHPNIVKLFEVIEMEKTLYLVMEYSSGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKHIVHRDLKAENLLLDADMNIKIADFGFSNEFTLGSKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKRFLVLHPLKRGSLEQIMKDRWM 319          
BLAST of Kinase-like protein vs. Ensembl Sea Lamprey
Match: MARK3 (microtubule affinity regulating kinase 3 [Source:HGNC Symbol;Acc:HGNC:6897])

HSP 1 Score: 160.999 bits (406), Expect = 1.004e-44
Identity = 87/256 (33.98%), Postives = 151/256 (58.98%), Query Frame = 2
Query:   59 ISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLN-YVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFV 823
            I  + +   +G G F KV + +   T  +  +K+I+K+ +N ++L ++L RE++I K L HPNI++L       K +Y+++E+A  G+V + +  +G      A    +Q+V +V YCH K ++HRD+K+ N+L+ ++  IK+ADFG+S        L+ + GS  Y APE+   K   G E D+WS+GV+LY +++G+LPF  +N   + +R + G +RIP  +S     LL+  L +NP +R +L  I+   ++
Sbjct:   51 IGTYRLLKTIGKGNFAKVKLARHTLTGREVAVKIIDKTQLNPSSL-QKLFREVRIMKILNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKHIVHRDLKAENLLLDADMNIKIADFGFSNEFTLGSKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKRFLVLNPAKRGSLEQIMKDRWM 305          
BLAST of Kinase-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006410.1 (pep scaffold:Pmarinus_7.0:GL476370:17405:31068:-1 gene:ENSPMAG00000005688.1 transcript:ENSPMAT00000006410.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 154.066 bits (388), Expect = 1.388e-42
Identity = 85/247 (34.41%), Postives = 146/247 (59.11%), Query Frame = 2
Query:   86 LGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLN-YVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFV 823
            +G G F KV + +   T  +  +K+I+K+ +N  +L ++L RE++I K L HPNI++L       K +Y+++E+A  G+V + +  +G      A    +Q+V +V YCH K ++HRD+K+ N+L+  +  IK+ADFG+S        L+ + GS  Y APE+   K   G E D+WS+GV+LY +++G+LPF  +N   + ++ + G +RIP  +S     LL+  L +NP +R +L  I+   ++
Sbjct:   45 IGKGNFAKVKLARHILTGREVAIKIIDKTQLNPTSL-QKLFREVRIMKCLNHPNIVKLYEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKNIVHRDLKAENLLLDVDMHIKIADFGFSNEFTLVNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELREKVLRGKYRIPFYMSTDCENLLKRFLVLNPIKRGSLEQIMRDRWM 290          
BLAST of Kinase-like protein vs. Ensembl Sea Lamprey
Match: STK36 (serine/threonine kinase 36 [Source:HGNC Symbol;Acc:HGNC:17209])

HSP 1 Score: 146.747 bits (369), Expect = 1.249e-39
Identity = 86/264 (32.58%), Postives = 145/264 (54.92%), Query Frame = 2
Query:   83 MLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKN-NSRNLNYV-GSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKSFSENTLQECKASE 868
            M+G+G FGKV+  +++ T     LK I K   ++  L R L+REI I + L HPNI+++L+ F   K + ++ ++A  G++   +   G     +      QLV ++ Y HS  ++HRD+K  NIL+   G +KL DFG++   + N+  L  + G+  Y +PE+V  K P  +  D+WS+G +LYE+  GT PFY  +   +    ++   + P N+S +    L+G+L   P+ R++  ++L+H FV   S   L +  A E
Sbjct:    9 MIGEGSFGKVYKGRKRYTGQVVALKFIPKVGRSDKEL-RNLRREIDIMRGLQHPNIVQMLDSFETDKEVVVVTDYAE-GELFQILEDDGNLPEEQVREIACQLVSALYYLHSHRILHRDMKPQNILLGKGGVVKLCDFGFARAMSINTLVLTSIKGTPLYMSPELVEEK-PYDHTADLWSMGCILYELFVGTPPFYTNSIFQLVSLIIKDPVKWPKNMSSEFRNFLQGLLTKEPKLRLSWPALLHHPFVAGKSSIVLDDISAEE 269          
BLAST of Kinase-like protein vs. Ensembl Yeast
Match: IPL1 (Aurora kinase of chromosomal passenger complex; mediates release of mono-oriented kinetochores from microtubules in meiosis I, and kinetochore release from SPB clusters at meiotic exit; helps maintain condensed chromosomes during anaphase; required for SPB cohesion and prevention of multipolar spindle formation; promotes telomerase release at G2/M; Iocalizes to nuclear foci that diffuse upon DNA replication stress; required for inhibition of karyopherin Pse1p upon SAC arrest [Source:SGD;Acc:S000006130])

HSP 1 Score: 176.407 bits (446), Expect = 3.742e-53
Identity = 102/269 (37.92%), Postives = 164/269 (60.97%), Query Frame = 2
Query:   47 KPLNISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWS-VHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFV---KSFSEN 841
            K L++  F++G  LG G+FGKV+ V+ + T +   LK++ K +I + NL +Q +RE++IQ +L HPN+ +   +FHD KR+Y+L+E+  NG++   +  +GP+++  A+ Y+ Q+ +++ Y H K ++HRDIK  NILI  N  IKL DFGWS ++   +R     G+I Y +PE+V  +    +  D W++GV+ +E+LTG  PF  E   T  KR    D ++P NIS  A  L+  +L  +P+ RM L  +  H ++   K F EN
Sbjct:   97 KSLSLDDFELGKKLGKGKFGKVYCVRHRSTGYICALKVMEKEEIIKYNLQKQFRREVEIQTSLNHPNLTKSYGYFHDEKRVYLLMEYLVNGEMYKLLRLHGPFNDILASDYIYQIANALDYMHKKNIIHRDIKPENILIGFNNVIKLTDFGWSIINPPENRRKTVCGTIDYLSPEMVESR-EYDHTIDAWALGVLAFELLTGAPPFEEEMKDTTYKRIAALDIKMPSNISQDAQDLILKLLKYDPKDRMRLGDVKMHPWILRNKPFWEN 364          
BLAST of Kinase-like protein vs. Ensembl Yeast
Match: KCC4 (Protein kinase of the bud neck involved in the septin checkpoint; associates with septin proteins, negatively regulates Swe1p by phosphorylation, shows structural homology to bud neck kinases Gin4p and Hsl1p; KCC4 has a paralog, GIN4, that arose from the whole genome duplication [Source:SGD;Acc:S000000529])

HSP 1 Score: 160.614 bits (405), Expect = 1.073e-44
Identity = 98/290 (33.79%), Postives = 159/290 (54.83%), Query Frame = 2
Query:   32 HQQMNKPLNISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENN--------LFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNL-NYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVD--KRTVEGDFRIPGN--ISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKSFSENTLQECKA 862
            H        I  + +G  LG G  GKV + + + T  +  +K+I+KS  N N         L   ++REI I K L HPN+L L + +  +  +Y++LE+A  G++ N +  +GP     A    +Q++  +SYCH+  ++HRD+K  N+L+ S   IK+ADFG +  + ++  L    GS  Y APE+V      G+ +D+WS GV+L+ +LTG LPF  EN    D   +  +G F +P +  IS  A  L+  IL V+P+QR+ +  IL+H  +K +   T+++ K+
Sbjct:    9 HSAAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKY--QTIKDSKS 296          
BLAST of Kinase-like protein vs. Ensembl Yeast
Match: GIN4 (Protein kinase involved in bud growth and assembly of the septin ring; proposed to have kinase-dependent and kinase-independent activities; undergoes autophosphorylation; similar to Hsl1p; GIN4 has a paralog, KCC4, that arose from the whole genome duplication [Source:SGD;Acc:S000002915])

HSP 1 Score: 154.066 bits (388), Expect = 2.060e-42
Identity = 94/277 (33.94%), Postives = 153/277 (55.23%), Query Frame = 2
Query:   59 ISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENN--------------LFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNY-VGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHE--NSLTVDKRTVEGDFRIPGN--ISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKSF 832
            I  + +G  LG G  GKV + +   T  +  +K+I+K+  N  N              L   ++REI I K L HPN+LRL + +  +  +Y++LE+A  G++ N + + GP     A  + +Q++  VSYCH+  ++HRD+K  N+L+     IK+ADFG +  +   + L    GS  Y APE+V      G+ +D+WS GV+L+ +LTG LPF  E  N  T+  +  +G+F +P +  IS +A  L+R IL V+P++R+    IL H  ++ +
Sbjct:   16 IGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKY 292          
BLAST of Kinase-like protein vs. Ensembl Yeast
Match: CDC5 (Polo-like kinase; controls targeting and activation of Rho1p at cell division site via Rho1p guanine nucleotide exchange factors; regulates Spc72p; also functions in adaptation to DNA damage during meiosis; regulates the shape of the nucleus and expansion of the nuclear envelope during mitosis; similar to Xenopus Plx1 and S. pombe Plo1p; human homologs PLK1, PLK3 can each complement yeast cdc5 thermosensitive mutants [Source:SGD;Acc:S000004603])

HSP 1 Score: 147.132 bits (370), Expect = 3.394e-40
Identity = 84/251 (33.47%), Postives = 135/251 (53.78%), Query Frame = 2
Query:   77 GTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYV--GSIFYRAPEVVLRKFP-LGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGN--ISPKAIVLLRGILAVNPQQRMTLNSILNH 814
            G  LG+G F + F +K+      F  K + K+ I      ++L  EIQI K++ HPNI++ ++ F D   +YILLE   NG +   + +    +      +  Q+  ++ Y HS+ V+HRD+K  NI   SN  +K+ DFG +    N     Y   G+  Y APEV++ K     +E DIWS+GV+LY +L G  PF   +  T+ +R    DF  P +  IS +  +L+R IL+++P +R +L  I+++
Sbjct:   85 GHFLGEGGFARCFQIKDDSGEI-FAAKTVAKASIKSEKTRKKLLSEIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPEVRFFTTQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNYIAPEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSFPRDKPISDEGKILIRDILSLDPIERPSLTEIMDY 334          
BLAST of Kinase-like protein vs. Ensembl Yeast
Match: SNF1 (AMP-activated S/T protein kinase; forms a complex with Snf4p and members of the Sip1p/Sip2p/Gal83p family; required for transcription of glucose-repressed genes, thermotolerance, sporulation, and peroxisome biogenesis; regulates nucleocytoplasmic shuttling of Hxk2p; regulates filamentous growth and acts as a non-canonical GEF, activating Arf3p during invasive growth; SUMOylation by Mms21p inhibits its function and targets Snf1p for destruction via the Slx5-Slx8 Ub ligase [Source:SGD;Acc:S000002885])

HSP 1 Score: 145.591 bits (366), Expect = 8.013e-40
Identity = 87/257 (33.85%), Postives = 143/257 (55.64%), Query Frame = 2
Query:   59 ISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNL-NYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVK 826
            I  + I   LG+G FGKV +     T  K  LK+INK  + ++++  +++REI   + L HP+I++L +       I +++E+A N ++ + I +    S   A  + QQ++ +V YCH   ++HRD+K  N+L+  +  +K+ADFG S    +   L    GS  Y APEV+  K   G E D+WS GV+LY ML   LPF  E+   + K    G + +P  +SP A  L++ +L VNP  R++++ I+  ++ K
Sbjct:   52 IGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYAGN-ELFDYIVQRDKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDESIPVLFKNISNGVYTLPKFLSPGAAGLIKRMLIVNPLNRISIHEIMQDDWFK 307          
BLAST of Kinase-like protein vs. Ensembl Nematostella
Match: EDO35437 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLH0])

HSP 1 Score: 229.18 bits (583), Expect = 6.596e-74
Identity = 111/271 (40.96%), Postives = 172/271 (63.47%), Query Frame = 2
Query:   56 NISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKSFSENTLQECKASE 868
            N+S FDIG  LG G+FG V++ +EK++ +   LK++ KS + ++N+  QL+REI+IQ +L H NILRL  +F+D  R+Y++LE+A  G++  +++    +   RAA Y++QL D+++YCHSK V+HRDIK  N+L+   G IK+ADFGWSVH  +SR     G++ Y  PE++  K     + D+WSIGV+ YE L G  PF  E      +R    D R P ++SP A  L+  +L  NP  R+ L ++LNH +++  +   L++  AS+
Sbjct:   44 NLSDFDIGKPLGKGKFGNVYLAREKKSKYIVALKVLFKSQLQKSNVEHQLRREIEIQSHLRHNNILRLFGYFYDDTRVYLILEYAPRGELYKELTACEKFDEKRAAKYIRQLADALAYCHSKKVIHRDIKPENLLLNYKGDIKIADFGWSVHAPSSRRTTLCGTLDYLPPEMIEGK-EHDEKVDLWSIGVLCYEFLVGKPPFEAEGHNETYRRISRVDLRFPSHVSPGARDLISKLLQHNPNNRLPLKAVLNHPWIRMHATPVLEQKPASQ 313          
BLAST of Kinase-like protein vs. Ensembl Nematostella
Match: EDO46035 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR22])

HSP 1 Score: 164.081 bits (414), Expect = 2.175e-48
Identity = 86/269 (31.97%), Postives = 153/269 (56.88%), Query Frame = 2
Query:   32 HQQMNKPLNISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWS-VHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKSFS 835
            H +    + I  ++I   +G G F  V +     T  K  +K+I+KS ++++NL + +KRE+++ K L HP+I++L       + +Y++ E+A  G++ + +  +G      A     Q+V ++ YCH   ++HRD+K+ N+L+  +  IK+ADFG+S + + + +   + GS  Y APE+   K  LG E DIWS+GVVLY ++ G LPF      ++  R ++G FRIP  +S +   L+R +L  +P +R T+  I  H+++   +
Sbjct:    8 HSRHGSVVRIGFYNIEKTIGKGNFAVVKLATHCITKSKVAVKIIDKSQLDDDNLTK-VKREVKVMKKLAHPHIIKLHEVMETERMLYLVTEYASKGEIFDYLVAHGRMQEKEAKNTFNQIVSAIEYCHKMNIVHRDLKAENLLLDEDMNIKIADFGFSNIFQADKKLKTWCGSPPYAAPELFEGKEYLGPEVDIWSLGVVLYVLVCGALPFDGSTLQSLRSRVLDGRFRIPFFMSTECEHLIRHMLVRDPVKRFTIPQIRQHKWMAEVT 275          
BLAST of Kinase-like protein vs. Ensembl Nematostella
Match: EDO30768 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZV3])

HSP 1 Score: 165.622 bits (418), Expect = 1.254e-46
Identity = 89/258 (34.50%), Postives = 153/258 (59.30%), Query Frame = 2
Query:   53 LNISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLN-YVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFV 823
            ++I  + +   +G G F KV + K   T  +  +K+I+K+ +N ++L ++L RE++I K L HPNI++L       K +Y+++E+A  G+V + +  +G      A    +Q+V +V YCH K V+HRD+K+ N+L+ ++  IK+ADFG+S        L+ + GS  Y APE+   K   G E D+WS+GV+LY +++G+LPF  +N   + +R + G +RIP  +S     LL+  L +NPQ+R  L   +  +++
Sbjct:   33 VHIGRYRLIKTIGKGNFAKVKLAKHVPTGKEVAIKIIDKTQLNPSSL-QKLFREVRIMKFLDHPNIVKLYEVIETDKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKHVIHRDLKAENLLLDADMNIKIADFGFSNEFTPGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLVLNPQKRARLEQTMTDKWM 289          
BLAST of Kinase-like protein vs. Ensembl Nematostella
Match: EDO36169 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJE6])

HSP 1 Score: 160.999 bits (406), Expect = 1.651e-45
Identity = 92/260 (35.38%), Postives = 144/260 (55.38%), Query Frame = 2
Query:   53 LNISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNY-VGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKS 829
            L I  +++G  LG G FGKV +   + T  K  +K++N++ I   ++  +++REIQ  K   HP+I++L         I++++E+   G++   I K+G      A  + QQ++  V YCH   V+HRD+K  N+L+ S   IK+ADFG S    +   L    GS  Y APEV+  K   G E DIWS GV+LY +L GTLPF  E+  T+ ++   G F +P ++S     LL  +L V+P +R T+  I   ++ K+
Sbjct:   15 LAIGNYNLGETLGVGTFGKVKLAVHQLTGHKVAIKILNRNKIKSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPTDIFMVMEYVSGGELFEYILKHGKLEEKDARRFFQQIISGVDYCHRHMVVHRDLKPENLLLDSQLNIKIADFGLSNIMTDGEFLQTSCGSPNYAAPEVISGKLYAGPEVDIWSAGVILYALLCGTLPFDDEHIPTLFRKIKGGVFHVPPHLSSGPASLLNAMLNVDPIKRATVQFIKEDDWFKT 274          
BLAST of Kinase-like protein vs. Ensembl Nematostella
Match: EDO47961 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKT6])

HSP 1 Score: 150.984 bits (380), Expect = 3.196e-44
Identity = 80/260 (30.77%), Postives = 143/260 (55.00%), Query Frame = 2
Query:   53 LNISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNL-NYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKS 829
            L +  + +   LG+G F KV + K K+ N    +K+I+K    ++ +++ L REI++   L HPN+++L        ++Y++LE A  GD+   I+K       RA     Q V +++YCH + V+HRD+K  N+L+ +NG++K+ DFG++ + + +  L  + GS  Y +PE++      G  +DIWS+GVVLY ++   LPF  ++   +  R      R     S +   L+R +LA++ ++R T   +L+  + K 
Sbjct:    3 LELHGYTVMRNLGEGAFAKVKLAKSKKHNCHVAIKIIDKRKAPKDYIYKFLPREIRVMHKLNHPNVIQLYEAIETETKVYLILELAEGGDLLEYINKNALLPEERARVIFCQFVATMAYCHKERVVHRDLKCENLLLDANGRLKITDFGFACNTHKTNILQTFCGSYAYCSPEILRGDLYDGQASDIWSMGVVLYALVCARLPFGDDDLRAIMNREPR-KLRFSKKTSKECRELIRKMLALDEKKRPTAEELLHEPWCKE 261          
BLAST of Kinase-like protein vs. Ensembl Medaka
Match: aurka (aurora kinase A [Source:NCBI gene;Acc:101165631])

HSP 1 Score: 212.231 bits (539), Expect = 7.190e-66
Identity = 100/258 (38.76%), Postives = 161/258 (62.40%), Query Frame = 2
Query:   56 NISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGN--ISPKAIVLLRGILAVNPQQRMTLNSILNHEFV 823
            ++  FDIG  LG G+FG V++ +E++T F   LK++ K  +    +  QL+RE++IQ +L HPNILRL  +FHD  R+Y++LEFA  G++  ++ + G +   R+ATY+ +L D++ YCH+K V+HRDIK  N+L+ +NG++K+ADFGWSVH  +SR     G++ Y  PE++  K     + D+WS+GV+ YE L G  PF  + +    +R    ++  P +  IS  A  L+  +L  NP  R+ +  +L H ++
Sbjct:  118 SLEDFDIGRPLGKGKFGNVYLARERQTKFILALKVLFKKQLERAGVEHQLRREVEIQSHLRHPNILRLYGYFHDASRVYLILEFAPKGELYGELQRCGSFPEDRSATYIMELADALHYCHTKKVIHRDIKPENLLLGANGELKIADFGWSVHTPSSRRSTLCGTLDYLPPEMIEGKT-HDEKVDLWSLGVLCYEFLVGKPPFEAKTNDETYRRISRVEYTYPAHAAISDGAKDLVAKLLKHNPMHRLPIQGVLCHPWL 374          
BLAST of Kinase-like protein vs. Ensembl Medaka
Match: aurka (aurora kinase A [Source:NCBI gene;Acc:101165631])

HSP 1 Score: 212.231 bits (539), Expect = 1.940e-65
Identity = 100/254 (39.37%), Postives = 159/254 (62.60%), Query Frame = 2
Query:   68 FDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGN--ISPKAIVLLRGILAVNPQQRMTLNSILNHEFV 823
            FDIG  LG G+FG V++ +E++T F   LK++ K  +    +  QL+RE++IQ +L HPNILRL  +FHD  R+Y++LEFA  G++  ++ + G +   R+ATY+ +L D++ YCH+K V+HRDIK  N+L+ +NG++K+ADFGWSVH  +SR     G++ Y  PE++  K     + D+WS+GV+ YE L G  PF  + +    +R    ++  P +  IS  A  L+  +L  NP  R+ +  +L H ++
Sbjct:  158 FDIGRPLGKGKFGNVYLARERQTKFILALKVLFKKQLERAGVEHQLRREVEIQSHLRHPNILRLYGYFHDASRVYLILEFAPKGELYGELQRCGSFPEDRSATYIMELADALHYCHTKKVIHRDIKPENLLLGANGELKIADFGWSVHTPSSRRSTLCGTLDYLPPEMIEGKT-HDEKVDLWSLGVLCYEFLVGKPPFEAKTNDETYRRISRVEYTYPAHAAISDGAKDLVAKLLKHNPMHRLPIQGVLCHPWL 410          
BLAST of Kinase-like protein vs. Ensembl Medaka
Match: aurkb (aurora kinase B [Source:NCBI gene;Acc:100301584])

HSP 1 Score: 207.994 bits (528), Expect = 3.070e-65
Identity = 101/267 (37.83%), Postives = 162/267 (60.67%), Query Frame = 2
Query:   47 KPLNISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKSFSENTL 847
            K ++I  FDIG  LG G+FG V++ + K+      LK++ KS + +  +  QL+REI+IQ +L HPNILR  N+FHD KR++++LE+A  G++  ++ KY  + + R ATY++++ D++ YCH K V+HRDIK  N+L+   G++K+ADFGWSVH  + R     G++ Y  PE++        + D+W IGV+ +E L G  PF   +     KR ++ D   P  +S  A  L+  +L  NP  R+ L  +++H +V++ S   L
Sbjct:   38 KKISIDDFDIGRPLGKGKFGNVYLARVKKLQAIVALKVLFKSQMEKEGVEHQLRREIEIQAHLKHPNILRFYNYFHDRKRVFLVLEYAPRGEMYKELQKYQRFDDQRTATYMEEISDALLYCHEKKVIHRDIKPENLLLGYRGELKIADFGWSVHAPSLRRRTMCGTLDYLPPEMI-EGHTHSEKVDLWCIGVLCFECLVGNPPFETASHTDTYKRIMKVDLNFPKVVSDGARDLISKLLRHNPNDRLPLQKVMDHPWVRTNSHRLL 303          
BLAST of Kinase-like protein vs. Ensembl Medaka
Match: aurka (aurora kinase A [Source:NCBI gene;Acc:101165631])

HSP 1 Score: 211.075 bits (536), Expect = 6.465e-65
Identity = 100/254 (39.37%), Postives = 159/254 (62.60%), Query Frame = 2
Query:   68 FDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGN--ISPKAIVLLRGILAVNPQQRMTLNSILNHEFV 823
            FDIG  LG G+FG V++ +E++T F   LK++ K  +    +  QL+RE++IQ +L HPNILRL  +FHD  R+Y++LEFA  G++  ++ + G +   R+ATY+ +L D++ YCH+K V+HRDIK  N+L+ +NG++K+ADFGWSVH  +SR     G++ Y  PE++  K     + D+WS+GV+ YE L G  PF  + +    +R    ++  P +  IS  A  L+  +L  NP  R+ +  +L H ++
Sbjct:  169 FDIGRPLGKGKFGNVYLARERQTKFILALKVLFKKQLERAGVEHQLRREVEIQSHLRHPNILRLYGYFHDASRVYLILEFAPKGELYGELQRCGSFPEDRSATYIMELADALHYCHTKKVIHRDIKPENLLLGANGELKIADFGWSVHTPSSRRSTLCGTLDYLPPEMIEGKT-HDEKVDLWSLGVLCYEFLVGKPPFEAKTNDETYRRISRVEYTYPAHAAISDGAKDLVAKLLKHNPMHRLPIQGVLCHPWL 421          
BLAST of Kinase-like protein vs. Ensembl Medaka
Match: aurkb (aurora kinase B [Source:NCBI gene;Acc:100301584])

HSP 1 Score: 207.608 bits (527), Expect = 7.774e-65
Identity = 101/267 (37.83%), Postives = 162/267 (60.67%), Query Frame = 2
Query:   47 KPLNISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKSFSENTL 847
            K ++I  FDIG  LG G+FG V++ + K+      LK++ KS + +  +  QL+REI+IQ +L HPNILR  N+FHD KR++++LE+A  G++  ++ KY  + + R ATY++++ D++ YCH K V+HRDIK  N+L+   G++K+ADFGWSVH  + R     G++ Y  PE++        + D+W IGV+ +E L G  PF   +     KR ++ D   P  +S  A  L+  +L  NP  R+ L  +++H +V++ S   L
Sbjct:   58 KKISIDDFDIGRPLGKGKFGNVYLARVKKLQAIVALKVLFKSQMEKEGVEHQLRREIEIQAHLKHPNILRFYNYFHDRKRVFLVLEYAPRGEMYKELQKYQRFDDQRTATYMEEISDALLYCHEKKVIHRDIKPENLLLGYRGELKIADFGWSVHAPSLRRRTMCGTLDYLPPEMI-EGHTHSEKVDLWCIGVLCFECLVGNPPFETASHTDTYKRIMKVDLNFPKVVSDGARDLISKLLRHNPNDRLPLQKVMDHPWVRTNSHRLL 323          
BLAST of Kinase-like protein vs. Planmine SMEST
Match: SMESG000036830.1 (SMESG000036830.1)

HSP 1 Score: 583.563 bits (1503), Expect = 0.000e+0
Identity = 280/281 (99.64%), Postives = 281/281 (100.00%), Query Frame = 2
Query:   41 MNKPLNISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKSFSENTLQECKASEIMWSR 883
            MNKPLNISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKSFSENTLQECKASEIMW+R
Sbjct:    1 MNKPLNISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKSFSENTLQECKASEIMWTR 281          
BLAST of Kinase-like protein vs. Planmine SMEST
Match: SMESG000006604.1 (SMESG000006604.1)

HSP 1 Score: 271.937 bits (694), Expect = 1.533e-90
Identity = 131/282 (46.45%), Postives = 183/282 (64.89%), Query Frame = 2
Query:   41 MNKPLN--ISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKSFSENTLQECKASEIMWS 880
            M +P N  I  F IG  +G G+FG V++VKEK  NF   +KMI K+ I EN+L  QLKREI+I  +L HPNILRL  +FHD +R+Y+++E A  G++  DI KYG Y N RAATY+ QL  ++ YCH + VMHRDIK  NILI S GQ KLADFGWSVH          G++ Y APE+V  +    +E DIW +GV+LYEMLT ++PF   +     +R    +F +P  ++P A  +++ IL +NP+ R++L+ I+ H ++  FSE    +C+AS +MW+
Sbjct:    1 MTEPQNWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMV-EQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEKVTDDCQASRLMWA 281          
BLAST of Kinase-like protein vs. Planmine SMEST
Match: SMESG000016505.1 (SMESG000016505.1)

HSP 1 Score: 182.956 bits (463), Expect = 1.023e-55
Identity = 104/256 (40.62%), Postives = 150/256 (58.59%), Query Frame = 2
Query:   68 FDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFY----HENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFV 823
            FDIG  LG G+FG V++VK  +  F   LK++ KS +  +NL  Q  REI I  +L HPNIL+L   FHD K +Y++LE+A  G +   + K   +++  AATYL QL D++SYCH K V+HRDIK  N+LI  + ++KLADFGWS+H N  +     G++ Y  PE+V  K     + D W  G++LYEML G  PF      E    +   ++E  FR   +I  +A  L+  IL +   +R+T  +I NH ++
Sbjct:   36 FDIGMPLGTGKFGHVYLVKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHTNLMKRKTLCGTLDYLPPEMVNSK-EYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIE--FR--SDIVLEARDLITRILKLKSVERLTFVAIQNHPWM 286          
BLAST of Kinase-like protein vs. Planmine SMEST
Match: SMESG000004605.1 (SMESG000004605.1)

HSP 1 Score: 183.341 bits (464), Expect = 1.205e-55
Identity = 98/252 (38.89%), Postives = 143/252 (56.75%), Query Frame = 2
Query:   68 FDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFV 823
            FD+G  LG G+FG V++ K  +  F   LK++ KS +  +NL  Q  REI I  +L HPNIL+L   FHD K +Y++LE+A  G +   + K   +++  AATYL QL D++SYCH K V+HRDIK  N+LI  + ++KLADFGWS+H N  +     G++ Y  PE+V  K     + D W  G++LYEML G  PF   N             +   +I  +A  L+  IL +   +R++   I NH ++
Sbjct:   51 FDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHTNLMKRKTMCGTLDYLPPEIVNYK-EYDEKIDHWMTGILLYEMLHGCPPFERANKQETYAAIRGNTIKFRSDIVLEARDLITRILKLRATERLSFPEIQNHPWM 301          
BLAST of Kinase-like protein vs. Planmine SMEST
Match: SMESG000060356.1 (SMESG000060356.1)

HSP 1 Score: 175.637 bits (444), Expect = 1.618e-52
Identity = 101/273 (37.00%), Postives = 151/273 (55.31%), Query Frame = 2
Query:   68 FDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTV--DKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKSFSENTLQECKASEIMWS 880
            F I   +GDG+F KV+   EK       LK I+KS   +      ++ E++I  +L HPN+L+L   F D    Y++LEF   G++  DI K   Y N RAATY+ Q+  ++ YCH+  ++HRDIKS NIL+ S G +K+ADFG S          + G++ + APE +L         DIWS+GV+ YEML    PF+ EN   +  + R V  +F    +IS +    L  +L  +  +R+T + +L   F+  +SENTL+ECKA+   W+
Sbjct:   10 FSILEKVGDGQFAKVYKAIEKNIKRVVALKKISKSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPE-ILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVE--YFLNSLLRKDTYERLTASQVLAFPFILKYSENTLKECKAAIDQWA 279          
The following BLAST results are available for this feature:
BLAST of Kinase-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AURKC3.912e-6938.85aurora kinase C [Source:HGNC Symbol;Acc:HGNC:11391... [more]
AURKC4.439e-6938.85aurora kinase C [Source:HGNC Symbol;Acc:HGNC:11391... [more]
AURKC5.379e-6938.85aurora kinase C [Source:HGNC Symbol;Acc:HGNC:11391... [more]
AURKC8.151e-6939.18aurora kinase C [Source:HGNC Symbol;Acc:HGNC:11391... [more]
AURKC2.150e-6739.18aurora kinase C [Source:HGNC Symbol;Acc:HGNC:11391... [more]
back to top
BLAST of Kinase-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
air-22.750e-6135.61Aurora/IPL1-related protein kinase 2 [Source:UniP... [more]
air-13.718e-6140.15Aurora/Ipl1 Related kinase; Aurora/Ipl1-related pr... [more]
air-13.718e-6140.15Aurora/Ipl1 Related kinase; Aurora/Ipl1-related pr... [more]
par-11.946e-4633.72Serine/threonine-protein kinase par-1 [Source:Uni... [more]
par-11.987e-4633.72Serine/threonine-protein kinase par-1 [Source:Uni... [more]
back to top
BLAST of Kinase-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aurA1.342e-6738.69gene:FBgn0000147 transcript:FBtr0082483[more]
aurB3.297e-5232.75gene:FBgn0024227 transcript:FBtr0080180[more]
Sik21.823e-5036.12gene:FBgn0025625 transcript:FBtr0070340[more]
Sik35.969e-4836.40gene:FBgn0262103 transcript:FBtr0344259[more]
Sik35.972e-4836.40gene:FBgn0262103 transcript:FBtr0344258[more]
back to top
BLAST of Kinase-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aurkb7.721e-6938.55aurora kinase B [Source:NCBI gene;Acc:791894][more]
aurka1.023e-6739.29aurora kinase A [Source:ZFIN;Acc:ZDB-GENE-040801-1... [more]
aurka2.148e-5147.37aurora kinase A [Source:ZFIN;Acc:ZDB-GENE-040801-1... [more]
mark3a3.366e-4835.41MAP/microtubule affinity-regulating kinase 3a [Sou... [more]
MARK46.972e-4835.18si:dkey-31m14.7 [Source:ZFIN;Acc:ZDB-GENE-121214-9... [more]
back to top
BLAST of Kinase-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aurkb5.306e-6938.87aurora kinase B [Source:NCBI gene;Acc:549613][more]
aurkb6.232e-6938.87aurora kinase B [Source:NCBI gene;Acc:549613][more]
aurkb8.057e-6938.87aurora kinase B [Source:NCBI gene;Acc:549613][more]
zbtb391.521e-6537.45zinc finger and BTB domain containing 39 [Source:X... [more]
ENSXETT00000045600.12.016e-4835.36MAP/microtubule affinity-regulating kinase 4 [Sour... [more]
back to top
BLAST of Kinase-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Aurkc2.311e-7039.18aurora kinase C [Source:MGI Symbol;Acc:MGI:1321119... [more]
Aurkc2.311e-7039.18aurora kinase C [Source:MGI Symbol;Acc:MGI:1321119... [more]
Aurkc8.278e-7039.18aurora kinase C [Source:MGI Symbol;Acc:MGI:1321119... [more]
Aurka1.942e-6840.63aurora kinase A [Source:MGI Symbol;Acc:MGI:894678][more]
Aurka1.942e-6840.63aurora kinase A [Source:MGI Symbol;Acc:MGI:894678][more]
back to top
BLAST of Kinase-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q54WX4|AURK_DICDI8.978e-7442.64Aurora kinase OS=Dictyostelium discoideum OX=44689... [more]
sp|O59790|ARK1_SCHPO1.069e-6939.78Serine/threonine-protein kinase ark1 OS=Schizosacc... [more]
sp|O88445|AURKC_MOUSE1.616e-6939.18Aurora kinase C OS=Mus musculus OX=10090 GN=Aurkc ... [more]
sp|Q6GPL3|AUKBB_XENLA2.591e-6939.62Aurora kinase B-B OS=Xenopus laevis OX=8355 GN=aur... [more]
sp|Q6DE08|AUKBA_XENLA2.940e-6939.62Aurora kinase B-A OS=Xenopus laevis OX=8355 GN=aur... [more]
back to top
BLAST of Kinase-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZIC85.512e-8746.45Aurora kinase-1 OS=Schmidtea mediterranea OX=79327... [more]
A0A4S2MQY42.808e-7440.22Putative serine/threonine protein kinase OS=Ascode... [more]
S8AAX83.321e-7441.70Protein kinase domain-containing protein OS=Dactyl... [more]
A0A5J4NGG35.751e-7441.11Aurora kinase A OS=Paragonimus westermani OX=34504... [more]
U4LAX11.014e-7343.13Similar to Serine/threonine-protein kinase ark1 ac... [more]
back to top
BLAST of Kinase-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aurka3.392e-7039.31aurora kinase C-like [Source:NCBI gene;Acc:1030345... [more]
aurka9.144e-7039.53aurora kinase C-like [Source:NCBI gene;Acc:1030345... [more]
aurkb2.831e-6236.70aurora kinase B [Source:NCBI gene;Acc:103024192][more]
aurkb3.272e-6236.70aurora kinase B [Source:NCBI gene;Acc:103024192][more]
sik16.061e-4936.92serine/threonine-protein kinase SIK2-like [Source:... [more]
back to top
BLAST of Kinase-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aurka6.248e-6741.00aurora kinase A [Source:ZFIN;Acc:ZDB-GENE-040801-1... [more]
MARK31.701e-4534.41microtubule affinity regulating kinase 3 [Source:H... [more]
MARK31.004e-4433.98microtubule affinity regulating kinase 3 [Source:H... [more]
ENSPMAT00000006410.11.388e-4234.41pep scaffold:Pmarinus_7.0:GL476370:17405:31068:-1 ... [more]
STK361.249e-3932.58serine/threonine kinase 36 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Kinase-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
IPL13.742e-5337.92Aurora kinase of chromosomal passenger complex; me... [more]
KCC41.073e-4433.79Protein kinase of the bud neck involved in the sep... [more]
GIN42.060e-4233.94Protein kinase involved in bud growth and assembly... [more]
CDC53.394e-4033.47Polo-like kinase; controls targeting and activatio... [more]
SNF18.013e-4033.85AMP-activated S/T protein kinase; forms a complex ... [more]
back to top
BLAST of Kinase-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO354376.596e-7440.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460352.175e-4831.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO307681.254e-4634.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361691.651e-4535.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479613.196e-4430.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Kinase-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aurka7.190e-6638.76aurora kinase A [Source:NCBI gene;Acc:101165631][more]
aurka1.940e-6539.37aurora kinase A [Source:NCBI gene;Acc:101165631][more]
aurkb3.070e-6537.83aurora kinase B [Source:NCBI gene;Acc:100301584][more]
aurka6.465e-6539.37aurora kinase A [Source:NCBI gene;Acc:101165631][more]
aurkb7.774e-6537.83aurora kinase B [Source:NCBI gene;Acc:100301584][more]
back to top
BLAST of Kinase-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000036830.10.000e+099.64SMESG000036830.1[more]
SMESG000006604.11.533e-9046.45SMESG000006604.1[more]
SMESG000016505.11.023e-5540.63SMESG000016505.1[more]
SMESG000004605.11.205e-5538.89SMESG000004605.1[more]
SMESG000060356.11.618e-5237.00SMESG000060356.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022145 ID=SMED30022145|Name=Kinase-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=918bp
ATTAATAAATTGATAAGTTGAACAATTTCAACATCAGCAAATGAATAAGC
CATTAAATATTAGTATGTTTGATATTGGAACAATGCTGGGTGATGGAAGG
TTTGGCAAGGTATTTATTGTTAAAGAAAAAGAAACTAACTTCAAATTTGG
CTTGAAGATGATCAACAAATCTGATATCAATGAAAATAATTTGTTTAGGC
AGTTAAAACGCGAAATACAAATTCAAAAGAACTTGTGCCATCCAAACATT
TTGCGTCTTTTGAATCATTTTCATGATCATAAACGAATATATATTCTTTT
GGAATTCGCTCATAATGGCGATGTTTCGAATGATATATCCAAATATGGGC
CGTATTCTAATGCCAGAGCAGCTACATATTTACAGCAGTTGGTTGACAGT
GTAAGCTATTGTCATTCCAAGTTTGTCATGCACCGAGATATAAAGTCAGC
GAACATTTTAATTTGTTCCAATGGCCAAATAAAGCTGGCTGATTTTGGAT
GGTCGGTTCACAAAAATAATAGCAGGAACCTTAATTATGTCGGTTCAATA
TTCTATCGAGCTCCAGAAGTAGTTTTAAGAAAATTCCCACTTGGTTACGA
AACCGATATTTGGTCAATTGGGGTAGTTTTATATGAAATGTTAACGGGAA
CCCTTCCTTTCTACCATGAAAATTCATTAACTGTCGATAAAAGAACTGTA
GAAGGTGATTTTCGGATTCCTGGAAATATTAGCCCCAAAGCTATTGTTCT
TCTCAGAGGAATTCTTGCAGTAAACCCACAACAAAGAATGACTTTGAATT
CCATATTGAATCATGAATTTGTTAAAAGCTTTTCTGAAAATACTTTACAA
GAATGCAAGGCATCAGAAATCATGTGGAGCAGGTGAAATGTGAACGAATG
AGTGCTGTTTAGATAGAG
back to top

protein sequence of SMED30022145-orf-1

>SMED30022145-orf-1 ID=SMED30022145-orf-1|Name=SMED30022145-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=282bp
MNKPLNISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENN
LFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDIS
KYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLA
DFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEM
LTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRM
TLNSILNHEFVKSFSENTLQECKASEIMWSR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000017photoreceptor neuron
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR030616Aur
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0007049cell cycle
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 10..261
e-value: 2.4E-82
score: 289.5
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 13..261
e-value: 1.1E-66
score: 225.0
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 10..261
score: 45.7
NoneNo IPR availablePIRSFPIRSF000654ILKcoord: 2..259
e-value: 1.5E-29
score: 100.6
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 5..280
e-value: 5.1E-82
score: 277.7
NoneNo IPR availablePANTHERPTHR24350:SF0AURORA Acoord: 5..269
NoneNo IPR availableCDDcd14007STKc_Auroracoord: 10..262
e-value: 4.03377E-111
score: 319.42
IPR030616Aurora kinasePANTHERPTHR24350SERINE/THREONINE-PROTEIN KINASE IAL-RELATEDcoord: 5..269
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 129..141
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 6..269