TNF receptor-associated factor 6

Overview
NameTNF receptor-associated factor 6
Smed IDSMED30022138
Length (bp)1549
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor-associated factor 6 (SMED30022138) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor-associated factor 6 (SMED30022138) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor-associated factor 6 (SMED30022138) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor-associated factor 6 (SMED30022138) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022138

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30022138SMESG000015050.1 SmedASXL_010436SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30022138SMESG000015050.1 SmedASXL_010436SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
epidermisSMED30022138SMESG000065606.1 SMESG000065602.1 SMESG000065577.1 SMESG000017419.1 SMESG000016032.1 SMESG000015894.1 SMESG000000571.1 SMESG000000563.1 SMESG000000559.1 SMESG000000493.1 SMESG000000302.1 SMESG000000294.1 dd_Smed_v4_4144_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30022138SMESG000049688.1 SMESG000049676.1 SMESG000049663.1 SMESG000049621.1 SMESG000049614.1 SMESG000049603.1 SMESG000049567.1 SMESG000065606.1 SMESG000065602.1 SMESG000065577.1 SMESG000017419.1 SMESG000016032.1 SMESG000015894.1 SMESG000000571.1 SMESG000000563.1 SMESG000000559.1 SMESG000000493.1 SMESG000000302.1 SMESG000000294.1 dd_Smed_v6_4144_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30022138SMESG000049688.1 SMESG000049676.1 SMESG000049663.1 SMESG000049621.1 SMESG000049614.1 SMESG000049603.1 SMESG000049567.1 SMESG000065606.1 SMESG000065602.1 SMESG000065577.1 SMESG000017419.1 SMESG000016032.1 SMESG000015894.1 SMESG000000571.1 SMESG000000563.1 SMESG000000559.1 SMESG000000493.1 SMESG000000302.1 SMESG000000294.1 dd_Smed_v6_4144_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor-associated factor 6 vs. Ensembl Human
Match: TRAF6 (TNF receptor associated factor 6 [Source:HGNC Symbol;Acc:HGNC:12036])

HSP 1 Score: 69.707 bits (169), Expect = 4.760e-12
Identity = 42/153 (27.45%), Postives = 74/153 (48.37%), Query Frame = 1
Query: 1039 GIFKWKIKNFSQKIGER-------IYSKPFYSGRFGYKLCLGVTSELAKDYLVYQCNVFVNL--HLMRGEFDENLAWPFKNSVKIDVIDSENGFTYKTKTIKYSDCPDDDGWGKPTTERNIPINVIFVPF-------DSPAVKNNRLEIECRV 1449
            GI+ WKI NF   +  +       I+S  FY+G+ GYKLC+ +  +L       +C  +++L  H M+GE+D +L WPF+ ++++ ++D       +         P+   + +PT  RN P    +V F           +K++ L + C V
Sbjct:  351 GIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPT---AQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRN-PKGFGYVTFMHLEALRQRTFIKDDTLLVRCEV 499          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Human
Match: TRAF6 (TNF receptor associated factor 6 [Source:HGNC Symbol;Acc:HGNC:12036])

HSP 1 Score: 69.707 bits (169), Expect = 4.760e-12
Identity = 42/153 (27.45%), Postives = 74/153 (48.37%), Query Frame = 1
Query: 1039 GIFKWKIKNFSQKIGER-------IYSKPFYSGRFGYKLCLGVTSELAKDYLVYQCNVFVNL--HLMRGEFDENLAWPFKNSVKIDVIDSENGFTYKTKTIKYSDCPDDDGWGKPTTERNIPINVIFVPF-------DSPAVKNNRLEIECRV 1449
            GI+ WKI NF   +  +       I+S  FY+G+ GYKLC+ +  +L       +C  +++L  H M+GE+D +L WPF+ ++++ ++D       +         P+   + +PT  RN P    +V F           +K++ L + C V
Sbjct:  351 GIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPT---AQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRN-PKGFGYVTFMHLEALRQRTFIKDDTLLVRCEV 499          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 68.9366 bits (167), Expect = 8.125e-12
Identity = 39/119 (32.77%), Postives = 62/119 (52.10%), Query Frame = 1
Query: 1039 GIFKWKIKNFSQKIGERI-------YSKPFYSGRFGYKLCLGVTSELAKDYLVYQCNVFVNLHLMRGEFDENLAWPFKNSVKIDVIDSENGFTYKTKTIKYSDCPDDDGWGKPTTERNI 1374
            G+  WKI+++ ++  E +       YS+PFY+G FGYK+C  V   L  D +    ++ +   +MRGE+D  L WPFK  V + ++D  +   +     K    P+   + KPT E NI
Sbjct:  333 GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVY--LNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPD--PNSSSFKKPTGEMNI 447          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 68.9366 bits (167), Expect = 9.072e-12
Identity = 41/127 (32.28%), Postives = 65/127 (51.18%), Query Frame = 1
Query: 1039 GIFKWKIKNFSQKIGERI-------YSKPFYSGRFGYKLCLGVTSELAKDYLVYQCNVFVNLHLMRGEFDENLAWPFKNSVKIDVIDSENGFTYKTKTIKYSDCPDDDGWGKPTTERNIPINV-IFV 1395
            G+  WKI+++ ++  E +       YS+PFY+G FGYK+C  V   L  D +    ++ +   +MRGE+D  L WPFK  V + ++D  +   +     K    P+   + KPT E NI     +FV
Sbjct:  391 GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVY--LNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPD--PNSSSFKKPTGEMNIASGCPVFV 513          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 68.9366 bits (167), Expect = 9.072e-12
Identity = 41/127 (32.28%), Postives = 65/127 (51.18%), Query Frame = 1
Query: 1039 GIFKWKIKNFSQKIGERI-------YSKPFYSGRFGYKLCLGVTSELAKDYLVYQCNVFVNLHLMRGEFDENLAWPFKNSVKIDVIDSENGFTYKTKTIKYSDCPDDDGWGKPTTERNIPINV-IFV 1395
            G+  WKI+++ ++  E +       YS+PFY+G FGYK+C  V   L  D +    ++ +   +MRGE+D  L WPFK  V + ++D  +   +     K    P+   + KPT E NI     +FV
Sbjct:  391 GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVY--LNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPD--PNSSSFKKPTGEMNIASGCPVFV 513          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Celegans
Match: trf-1 (TNF Receptor Associated Factor (TRAF) homolog; TRF-1 [Source:UniProtKB/TrEMBL;Acc:G5EG80])

HSP 1 Score: 55.8398 bits (133), Expect = 3.845e-8
Identity = 33/88 (37.50%), Postives = 44/88 (50.00%), Query Frame = 1
Query: 1051 WKIKNFSQKIGER-------IYSKPFYSGRFGYKL----CL-GVTSELAKDYLVYQCNVFVNLHLMRGEFDENLAWPFKNSVKIDVID 1278
            WKI    Q+  E        I+S PF S RFGYK+    CL G  S   K   +Y       + L++GEFD  L WPF  ++KI ++D
Sbjct:  267 WKIDKLQQRTNEAKSGADTTIFSVPFMSHRFGYKMMACACLFGDGSSAGKSISLY-------VLLLKGEFDPTLEWPFHRAIKISLLD 347          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Celegans
Match: trf-2 (TNF Receptor Associated Factor (TRAF) homolog [Source:UniProtKB/TrEMBL;Acc:Q9N586])

HSP 1 Score: 51.6026 bits (122), Expect = 7.694e-7
Identity = 32/93 (34.41%), Postives = 52/93 (55.91%), Query Frame = 1
Query: 1057 IKNFSQKIGERIYSKPFYSGRFGYKLCLGVTSELAKDYLVYQCNVFVNLHLMRGEFDENLAWPFKNSVKIDVIDSENGFTYKTKTIKYSDCPD 1335
            +K    K    IYS+PFYS  +GYK+ + V +    D L ++    V + LM+GE+D+ L WPF+  V   ++ S++     TKTI  ++ P+
Sbjct:  172 VKATKNKSHRSIYSQPFYSHGYGYKM-MAVAAPYG-DGLAFREYFSVFVCLMKGEWDDILEWPFRCDVTFSIL-SDDKKELLTKTIYVNEMPE 261          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Zebrafish
Match: traf3 (TNF receptor-associated factor 3 [Source:ZFIN;Acc:ZDB-GENE-040801-257])

HSP 1 Score: 82.8037 bits (203), Expect = 2.235e-16
Identity = 80/366 (21.86%), Postives = 161/366 (43.99%), Query Frame = 1
Query:  331 VNCPRQNCEFKDELQL-IENHMITCNKQPISCPFNSIGCGMNEVRNEEMKSHLNEDIYCHSKXXXXXXXXXXXXMESMKXXXXXXXXXXXXXXGNKLFNQQFYNINLQLTNQQEKILEMGRREKANTREIEDLKRENSQIKQQLDIIELKSTNQQQEMIKMEKE-NLIKQSKIFSE-----KTNIESYKEIGEAIPAKFQQQIGG----VKLEYHQWKHDETKENELSGVSSEIRXXXXXXXXXXXXGIFKWKIKNFSQKIGERI-------YSKPFYSGRFGYKLCLGVTSELAKDYLVYQCNVFVNLHLMRGEFDENLAWPFKNSVKIDVIDSENGFTYKTKTIKYSDCPDDDGWGKPTTERNI 1374
            V CP  +C F   L+  + +H   C K  ++C F   GC    + N+EM+ H +     H +            M +++               N     +  ++  +L  + + +  +  R     R+ E+++ +N Q++Q+L  +++  ++  ++++++E E   ++  +   E     + ++ES + +  ++ +       G      LE    +HD+        ++ E+    + LE+   +G   WKI+++ ++  E +       YS+PFY+G FGYK+C  V   L  D +    ++ +   +MRGE+D  L WPFK  V + ++D   G   K     +   P    + +PT E NI
Sbjct:  204 VACP-NHCSFSSILRSELSSHQHDCPKAQVTCSFIRYGCSYKGL-NQEMREHESSFASEHLR------------MMAVR---------------NTTLEAKVEDVKSELMERYKVLPSLSSRLAEVERQYEEMREKNRQLEQKLVSMQMLMSSHSEKLLEVEMELRELRPLRAMREEVETLRGSVESMRSMVSSLDSSCVNSASGSHTLASLEQQLTRHDDLMSVHDVRLA-EMDLKLQVLETASFNGTLIWKIRDYKRRKQEAVVSKTLSLYSQPFYTGYFGYKMCARVY--LNGDGMGKGTHLSLFFVVMRGEYDALLQWPFKQKVTLMLMD--QGPARKHLGDAFKPDPSSSSFRRPTGEMNI 535          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 80.1073 bits (196), Expect = 1.839e-15
Identity = 45/130 (34.62%), Postives = 74/130 (56.92%), Query Frame = 1
Query: 1039 GIFKWKIKNFS-----QKIGERI--YSKPFYSGRFGYKLCLGVTSELAKDYLVYQCNVFVNL--HLMRGEFDENLAWPFKNSVKIDVIDSENGFTYKTKTIKYSDCPDDDGWGKPTTERNIPINVIFVPF 1401
            GI+ W+++NFS     Q+ G+ I  +S PFY+GR GYKLCL +  +        +C+ F++L  H M+GEFD  L+WP + ++++ V+D   G  +  + ++    PD   + +PT  RN P    +V F
Sbjct:  375 GIYVWRVENFSHHLRNQEAGQPIVLHSPPFYTGRPGYKLCLRLHLQTPS---APRCSNFISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQVEG-QHHIEVMETK--PDLQAFQRPTVMRN-PKGFGYVTF 497          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 80.1073 bits (196), Expect = 1.839e-15
Identity = 45/130 (34.62%), Postives = 74/130 (56.92%), Query Frame = 1
Query: 1039 GIFKWKIKNFS-----QKIGERI--YSKPFYSGRFGYKLCLGVTSELAKDYLVYQCNVFVNL--HLMRGEFDENLAWPFKNSVKIDVIDSENGFTYKTKTIKYSDCPDDDGWGKPTTERNIPINVIFVPF 1401
            GI+ W+++NFS     Q+ G+ I  +S PFY+GR GYKLCL +  +        +C+ F++L  H M+GEFD  L+WP + ++++ V+D   G  +  + ++    PD   + +PT  RN P    +V F
Sbjct:  375 GIYVWRVENFSHHLRNQEAGQPIVLHSPPFYTGRPGYKLCLRLHLQTPS---APRCSNFISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQVEG-QHHIEVMETK--PDLQAFQRPTVMRN-PKGFGYVTF 497          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 80.1073 bits (196), Expect = 1.839e-15
Identity = 45/130 (34.62%), Postives = 74/130 (56.92%), Query Frame = 1
Query: 1039 GIFKWKIKNFS-----QKIGERI--YSKPFYSGRFGYKLCLGVTSELAKDYLVYQCNVFVNL--HLMRGEFDENLAWPFKNSVKIDVIDSENGFTYKTKTIKYSDCPDDDGWGKPTTERNIPINVIFVPF 1401
            GI+ W+++NFS     Q+ G+ I  +S PFY+GR GYKLCL +  +        +C+ F++L  H M+GEFD  L+WP + ++++ V+D   G  +  + ++    PD   + +PT  RN P    +V F
Sbjct:  375 GIYVWRVENFSHHLRNQEAGQPIVLHSPPFYTGRPGYKLCLRLHLQTPS---APRCSNFISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQVEG-QHHIEVMETK--PDLQAFQRPTVMRN-PKGFGYVTF 497          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Zebrafish
Match: traf5 (Tnf receptor-associated factor 5 [Source:ZFIN;Acc:ZDB-GENE-071120-3])

HSP 1 Score: 60.8474 bits (146), Expect = 6.693e-10
Identity = 37/138 (26.81%), Postives = 65/138 (47.10%), Query Frame = 1
Query: 1039 GIFKWKIKNFSQK--IGERIYSKPFYSGRFGYKLCLGVTSELAKDYLVYQCNVFVNLHLMRGEFDENLAWPFKNSVKIDVIDSENGFTYKTKTIKYSDCPD--DDGWGKPTTERNI---------------PINVIFV 1395
            G   WK++++  +   G  + S PFY+ R GYKL   V + L  D      ++ + + +MRG+FD  L WPF+ ++ + ++D      + + T      PD   D + +PT++ N+               P N +FV
Sbjct:  111 GKLIWKVRDYWHRKESGAALSSSPFYTSRSGYKL--SVRAYLGGDGSGRGSHMSLYITIMRGDFDSFLPWPFRQNITLTLLDQSGTRNHMSHTF----IPDVNSDSFHRPTSDANVATGFTRFISHCDLENPRNAVFV 242          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 80.8777 bits (198), Expect = 1.651e-15
Identity = 91/389 (23.39%), Postives = 175/389 (44.99%), Query Frame = 1
Query:  247 RYCQNR--MINYANDIAIDWPINIRISEIVVNCPRQNCEFKDELQL-IENHMITCNKQPISCPFNSIGCGMNEVRNEEMKSHLNEDIYCHSKXXXXXXXXXXXXMESMKXXXXXXXXXXXXXXGNKL--FNQQFYNINLQLTNQQEKILEMGRREKANTREIEDLKRENSQIKQQLDIIELKSTNQQQEMIKMEKENLIKQSKIFSEKTNIESYKEIGEAIPAKFQQQIGGVKLEYHQWKHDETKE-NELSGVSSEIRXXXXXXXXXXXXGIFKWKIKNFSQKIGERI-------YSKPFYSGRFGYKLCLGVTSELAKDYLVYQCNVFVNLHLMRGEFDENLAWPFKNSVKIDVIDSENGFTYKTKTIKYSDCPDDDGWGKPTTERNI 1374
            ++C+N+  ++       +D P       +V++CP   C  K  L+  +  H++ C   P +C F   GC      N+++K+H       H  L+ E  N L  ++ SM       +N+ +++  N++  F  +      QL N + +I+++ R  +    +++DL +E   ++Q  D  +   +N +        +N + Q ++ ++  N  S+       P   + QI          +HD+    +++     ++R       S    G+  WKI+++ ++  E +       YS+PFY+G FGYK+C  V   L  D +    ++ +   +MRGE+D  L WPFK  V + ++D   G + +     +   P+   + KPT E NI
Sbjct:  173 KFCRNQVPLVEMQKHEDVDCP------SVVISCPHM-CSVKSLLRSELNAHLLECVNAPSTCSFKRYGCTFKGT-NQQIKAHEASSAVQHVNLMKEWSNYLEAKV-SMLQNESSEKNKSIQILHNQMCSFEIEIERHKEQLRNNEARIIQLQRVIEGQADKLKDLDKEIRNLRQTGDEADGMKSNYES------LQNRLSQLEVMAK--NAASWN------PGVLETQIN---------RHDQMLSVHDIRLADMDLRFQVLETASYN--GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVY--LNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMD--QGPSRRHLGDAFKPDPNSSSFKKPTGEMNI 523          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Xenopus
Match: egf (epidermal growth factor [Source:Xenbase;Acc:XB-GENE-951823])

HSP 1 Score: 75.8702 bits (185), Expect = 6.496e-14
Identity = 45/154 (29.22%), Postives = 76/154 (49.35%), Query Frame = 1
Query: 1039 GIFKWKIKNFSQKIGER-------IYSKPFYSGRFGYKLCLGVTSELAKDYLVYQCNVFVNL--HLMRGEFDENLAWPFKNSVKIDVIDSENGFTYKTKTIKYSDCPDDDGWGKPTTERNIPINVIFVPF-------DSPAVKNNRLEIECRVV 1452
            GIF W+I NF+  +  +       I+S+ FY+G+ GYKLCL +  +L       +C  +++L  H M+GE+D  L WP + ++++ ++D   G   + +       P+   + +PT  RN P    +V F           VKN+ L + C V 
Sbjct:  387 GIFIWRINNFNSLLKNQEEERPVVIHSQGFYTGKPGYKLCLRLHLQLPS---AQRCANYISLFVHTMQGEYDSLLPWPLQGTIRLSILDQSEGVAMQDQEEVMDTKPELLAFQRPTVARN-PKGFGYVTFMHLQALKQRQYVKNDTLLVRCSVT 536          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 71.633 bits (174), Expect = 1.296e-12
Identity = 61/250 (24.40%), Postives = 115/250 (46.00%), Query Frame = 1
Query:  649 QLTNQQEKILEMGRREKANTREIEDLKRENSQIKQQLDIIELKSTNQQQEMIKMEKENLIKQSKIFSEKTNIESYKEIGEAIPAKFQQQIGGVKLEYHQWKHDETKE-NELSGVSSEIRXXXXXXXXXXXXGIFKWKIKNFSQKIGERI-------YSKPFYSGRFGYKLCLGVTSELAKDYLVYQCNVFVNLHLMRGEFDENLAWPFKNSVKIDVIDSENGFTYKTKTIKYSDCPDDDGWGKPTTERNI 1374
            QL N + +I+++ R  +    +++DL +E   ++Q  D  +   +N +        +N + Q ++ ++  N  S+       P   + QI          +HD+    +++     ++R       S    G+  WKI+++ ++  E +       YS+PFY+G FGYK+C  V   L  D +    ++ +   +MRGE+D  L WPFK  V + ++D   G + +     +   P+   + KPT E NI
Sbjct:  278 QLRNNEARIIQLQRVIEGQADKLKDLDKEIRNLRQTGDEADGMKSNYE------SLQNRLSQLEVMAK--NAASWN------PGVLETQIN---------RHDQMLSVHDIRLADMDLRFQVLETASYN--GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVY--LNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMD--QGPSRRHLGDAFKPDPNSSSFKKPTGEMNI 498          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Xenopus
Match: hspb6 (heat shock protein family B (small) member 6 [Source:Xenbase;Acc:XB-GENE-876273])

HSP 1 Score: 56.6102 bits (135), Expect = 4.809e-8
Identity = 30/90 (33.33%), Postives = 48/90 (53.33%), Query Frame = 1
Query: 1039 GIFKWKIKNFSQKIGERI-------YSKPFYSGRFGYKLCLGVTSELAKDYLVYQCNVFVNLHLMRGEFDENLAWPFKNSVKIDVIDSEN 1287
            G+F WKI + + K  + +       YS  FY+ ++GYK+CL +   L  D      +V +   +M+GE+D  L WPFK+ V   ++D  N
Sbjct:  230 GVFLWKISDLTNKSHDAVTGRAISLYSPAFYTAKYGYKVCLRI--YLNGDGAGKGTHVSLFFTVMKGEYDALLPWPFKHKVTFVLVDHNN 317          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Xenopus
Match: sytl2 (synaptotagmin like 2 [Source:Xenbase;Acc:XB-GENE-945155])

HSP 1 Score: 53.9138 bits (128), Expect = 4.800e-7
Identity = 36/120 (30.00%), Postives = 60/120 (50.00%), Query Frame = 1
Query: 1039 GIFKWKIKNFSQKIGE-------RIYSKPFYSGRFGYKLCLGVTSELAKDYLVYQCNVFVNLHLMRGEFDENLAWPFKNSVKIDVIDSENGFTYKTKTIKYSDCPDDD--GWGKPTTERN 1371
            G+  WKI ++S+K+ E         +S PFY+ ++GYKL   V++ L  +       + V + ++ GE+D  L WPF   V   ++D  +    K + I  +  PD +   + KPT  RN
Sbjct:  308 GVLIWKISDYSRKVQEAKVRGNFESFSPPFYTHKYGYKL--QVSAFLNGNGSGEGSYLSVYIRVLPGEYDNLLEWPFSYRVTFSLLDQSDPSLSKPQHITETFNPDPNWKNFQKPTGSRN 425          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Mouse
Match: Traf6 (TNF receptor-associated factor 6 [Source:MGI Symbol;Acc:MGI:108072])

HSP 1 Score: 74.7146 bits (182), Expect = 1.036e-13
Identity = 43/153 (28.10%), Postives = 74/153 (48.37%), Query Frame = 1
Query: 1039 GIFKWKIKNFSQKIGER-------IYSKPFYSGRFGYKLCLGVTSELAKDYLVYQCNVFVNL--HLMRGEFDENLAWPFKNSVKIDVIDSENGFTYKTKTIKYSDCPDDDGWGKPTTERNIPINVIFVPF-------DSPAVKNNRLEIECRV 1449
            GI+ WKI NF   +  +       I+S  FY+GR GYKLC+ +  +L       +C  +++L  H M+GE+D +L WPF+ ++++ ++D       +         P+   + +PT  RN P    +V F           +K++ L + C V
Sbjct:  359 GIYIWKIGNFGMHLKSQEEERPVVIHSPGFYTGRPGYKLCMRLHLQLPT---AQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEALIRQNHEEVMDAKPELLAFQRPTIPRN-PKGFGYVTFMHLEALRQGTFIKDDTLLVRCEV 507          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 69.3218 bits (168), Expect = 4.863e-12
Identity = 41/127 (32.28%), Postives = 65/127 (51.18%), Query Frame = 1
Query: 1039 GIFKWKIKNFSQKIGERI-------YSKPFYSGRFGYKLCLGVTSELAKDYLVYQCNVFVNLHLMRGEFDENLAWPFKNSVKIDVIDSENGFTYKTKTIKYSDCPDDDGWGKPTTERNIPINV-IFV 1395
            G+  WKI+++ ++  E +       YS+PFY+G FGYK+C  V   L  D +    ++ +   +MRGE+D  L WPFK  V + ++D  +   +     K    P+   + KPT E NI     +FV
Sbjct:  390 GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVY--LNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPD--PNSSSFKKPTGEMNIASGCPVFV 512          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 69.3218 bits (168), Expect = 4.863e-12
Identity = 41/127 (32.28%), Postives = 65/127 (51.18%), Query Frame = 1
Query: 1039 GIFKWKIKNFSQKIGERI-------YSKPFYSGRFGYKLCLGVTSELAKDYLVYQCNVFVNLHLMRGEFDENLAWPFKNSVKIDVIDSENGFTYKTKTIKYSDCPDDDGWGKPTTERNIPINV-IFV 1395
            G+  WKI+++ ++  E +       YS+PFY+G FGYK+C  V   L  D +    ++ +   +MRGE+D  L WPFK  V + ++D  +   +     K    P+   + KPT E NI     +FV
Sbjct:  390 GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVY--LNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPD--PNSSSFKKPTGEMNIASGCPVFV 512          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 69.3218 bits (168), Expect = 5.580e-12
Identity = 41/127 (32.28%), Postives = 65/127 (51.18%), Query Frame = 1
Query: 1039 GIFKWKIKNFSQKIGERI-------YSKPFYSGRFGYKLCLGVTSELAKDYLVYQCNVFVNLHLMRGEFDENLAWPFKNSVKIDVIDSENGFTYKTKTIKYSDCPDDDGWGKPTTERNIPINV-IFV 1395
            G+  WKI+++ ++  E +       YS+PFY+G FGYK+C  V   L  D +    ++ +   +MRGE+D  L WPFK  V + ++D  +   +     K    P+   + KPT E NI     +FV
Sbjct:  415 GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVY--LNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPD--PNSSSFKKPTGEMNIASGCPVFV 537          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Mouse
Match: Traf1 (TNF receptor-associated factor 1 [Source:MGI Symbol;Acc:MGI:101836])

HSP 1 Score: 62.003 bits (149), Expect = 7.889e-10
Identity = 44/153 (28.76%), Postives = 76/153 (49.67%), Query Frame = 1
Query: 1039 GIFKWKIKNFSQKIGERI-------YSKPFYSGRFGYKLCLGVTSELAKDYLVYQCNVFVNLHLMRGEFDENLAWPFKNSVKIDVIDSENGFTYKTKTIKYSDCPD--DDGWGKPTTERNIPINV-IFVPFD---SPA---VKNNRLEIECRV 1449
            G F WKI N +++  E +       +S  FY+ ++GYKLCL +   L  D    + ++ + + +MRGE+D  L WPF+N V   ++D +N   +     +    PD     + +P +E N+     +F P     SP    VK++ + ++C V
Sbjct:  260 GTFLWKITNVTKRCHESVCGRTVSLFSPAFYTAKYGYKLCLRLY--LNGDGSGKKTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLD-QNNREHAIDAFR----PDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLKCIV 405          
BLAST of TNF receptor-associated factor 6 vs. UniProt/SwissProt
Match: sp|Q6DJN2|TRF6B_XENLA (TNF receptor-associated factor 6-B OS=Xenopus laevis OX=8355 GN=traf6-b PE=2 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.288e-14
Identity = 51/153 (33.33%), Postives = 77/153 (50.33%), Query Frame = 1
Query: 1039 GIFKWKIKNFS--QKIGER-----IYSKPFYSGRFGYKLCLGVTSELAKDYLVYQCNVFVNL--HLMRGEFDENLAWPFKNSVKIDVIDSENGFTYKTKTIKYSDCPDDDGWGKPTTERNIPINVIFVPF-------DSPAVKNNRLEIECRV 1449
            G+F WKIK FS  QK  E      I+S  FY+G+ GYKLCL +  +L       +C  +++L  H M+GE+D  L WP   ++++ ++D   G   + +       PD   + +PTT+RN P    +V F           VKN+ L + C V
Sbjct:  385 GVFIWKIKGFSGLQKTQEEEKPVVIHSPGFYTGKPGYKLCLRLHLQLPS---AQRCANYISLFVHTMQGEYDSLLPWPLHGTIRLSILDQSEGAIIQDQEEVMDTKPDLLAFQRPTTQRN-PKGFGYVTFMHLNTLKQRQYVKNDTLFVRCAV 533          
BLAST of TNF receptor-associated factor 6 vs. UniProt/SwissProt
Match: sp|Q6IWL4|TRAF6_DANRE (TNF receptor-associated factor 6 OS=Danio rerio OX=7955 GN=traf6 PE=1 SV=2)

HSP 1 Score: 80.1073 bits (196), Expect = 1.388e-14
Identity = 45/130 (34.62%), Postives = 74/130 (56.92%), Query Frame = 1
Query: 1039 GIFKWKIKNFS-----QKIGERI--YSKPFYSGRFGYKLCLGVTSELAKDYLVYQCNVFVNL--HLMRGEFDENLAWPFKNSVKIDVIDSENGFTYKTKTIKYSDCPDDDGWGKPTTERNIPINVIFVPF 1401
            GI+ W+++NFS     Q+ G+ I  +S PFY+GR GYKLCL +  +        +C+ F++L  H M+GEFD  L+WP + ++++ V+D   G  +  + ++    PD   + +PT  RN P    +V F
Sbjct:  375 GIYVWRVENFSHHLRNQEAGQPIVLHSPPFYTGRPGYKLCLRLHLQTPS---APRCSNFISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQVEG-QHHIEVMETK--PDLQAFQRPTVMRN-PKGFGYVTF 497          
BLAST of TNF receptor-associated factor 6 vs. UniProt/SwissProt
Match: sp|Q28DL4|TRAF6_XENTR (TNF receptor-associated factor 6 OS=Xenopus tropicalis OX=8364 GN=traf6 PE=2 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 3.565e-13
Identity = 45/154 (29.22%), Postives = 76/154 (49.35%), Query Frame = 1
Query: 1039 GIFKWKIKNFSQKIGER-------IYSKPFYSGRFGYKLCLGVTSELAKDYLVYQCNVFVNL--HLMRGEFDENLAWPFKNSVKIDVIDSENGFTYKTKTIKYSDCPDDDGWGKPTTERNIPINVIFVPF-------DSPAVKNNRLEIECRVV 1452
            GIF W+I NF+  +  +       I+S+ FY+G+ GYKLCL +  +L       +C  +++L  H M+GE+D  L WP + ++++ ++D   G   + +       P+   + +PT  RN P    +V F           VKN+ L + C V 
Sbjct:  387 GIFIWRINNFNSLLKNQEEERPVVIHSQGFYTGKPGYKLCLRLHLQLPS---AQRCANYISLFVHTMQGEYDSLLPWPLQGTIRLSILDQSEGVAMQDQEEVMDTKPELLAFQRPTVARN-PKGFGYVTFMHLQALKQRQYVKNDTLLVRCSVT 536          
BLAST of TNF receptor-associated factor 6 vs. UniProt/SwissProt
Match: sp|P70196|TRAF6_MOUSE (TNF receptor-associated factor 6 OS=Mus musculus OX=10090 GN=Traf6 PE=1 SV=2)

HSP 1 Score: 74.7146 bits (182), Expect = 7.246e-13
Identity = 43/153 (28.10%), Postives = 74/153 (48.37%), Query Frame = 1
Query: 1039 GIFKWKIKNFSQKIGER-------IYSKPFYSGRFGYKLCLGVTSELAKDYLVYQCNVFVNL--HLMRGEFDENLAWPFKNSVKIDVIDSENGFTYKTKTIKYSDCPDDDGWGKPTTERNIPINVIFVPF-------DSPAVKNNRLEIECRV 1449
            GI+ WKI NF   +  +       I+S  FY+GR GYKLC+ +  +L       +C  +++L  H M+GE+D +L WPF+ ++++ ++D       +         P+   + +PT  RN P    +V F           +K++ L + C V
Sbjct:  359 GIYIWKIGNFGMHLKSQEEERPVVIHSPGFYTGRPGYKLCMRLHLQLPT---AQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEALIRQNHEEVMDAKPELLAFQRPTIPRN-PKGFGYVTFMHLEALRQGTFIKDDTLLVRCEV 507          
BLAST of TNF receptor-associated factor 6 vs. UniProt/SwissProt
Match: sp|B5DF45|TRAF6_RAT (TNF receptor-associated factor 6 OS=Rattus norvegicus OX=10116 GN=Traf6 PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.096e-12
Identity = 43/153 (28.10%), Postives = 74/153 (48.37%), Query Frame = 1
Query: 1039 GIFKWKIKNFSQKIGER-------IYSKPFYSGRFGYKLCLGVTSELAKDYLVYQCNVFVNL--HLMRGEFDENLAWPFKNSVKIDVIDSENGFTYKTKTIKYSDCPDDDGWGKPTTERNIPINVIFVPF-------DSPAVKNNRLEIECRV 1449
            GI+ WKI NF   +  +       I+S  FY+GR GYKLC+ +  +L       +C  +++L  H M+GE+D +L WPF+ ++++ ++D       +         P+   + +PT  RN P    +V F           +K++ L + C V
Sbjct:  359 GIYIWKIGNFGMHLKSQEEERPVVIHSPGFYTGRPGYKLCMRLHLQLPT---AQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAVIRQNHEEVMDAKPELLAFQRPTIPRN-PKGFGYVTFMHLEALRQGTFIKDDTLLVRCEV 507          
BLAST of TNF receptor-associated factor 6 vs. TrEMBL
Match: T1E101 (TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 5.293e-21
Identity = 48/135 (35.56%), Postives = 74/135 (54.81%), Query Frame = 1
Query:  109 VSKELQCKICNKLMIKACHAPCGCRFCSDCIQHYLDGNDKFCPGTSRYCQNRMINYANDIAIDWPINIRISEIVVNCPRQNCEFKDELQLIENHMITCNKQPISCPFNSIGCGMNEVRNEEMKSHLNEDIYCHSK 513
            V+ +L C +CNKLM  AC + CGC +C  CI+ YL  N  +CPG    C+   +N   D+  +  ++ RIS IVV CP   C +  EL  ++ H+  C  + + CP  +IGC    +  +EM  HL + +  H++
Sbjct:   25 VNNDLLCILCNKLMRDACESACGCHYCYTCIRIYLSQNHNYCPGDKTECKEDYLNLEGDVFRNIRLSTRISRIVVKCPNIRCNYTSELLRLKEHLDKCTPESVECPCVTIGCEEEPLLKDEMAKHLTDQVLRHTQ 159          
BLAST of TNF receptor-associated factor 6 vs. TrEMBL
Match: I1ZID8 (TNF receptor associated factor-2 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 1.312e-20
Identity = 46/153 (30.07%), Postives = 84/153 (54.90%), Query Frame = 1
Query:   55 SESVWKFMRENEIKISCEVSKELQCKICNKLMIKACHAPCGCRFCSDCIQHYLDGNDKFCPGTSRYCQNRMINYANDIAIDWPINIRISEIVVNCPRQNCEFKDELQLIENHMITCNKQPISCPFNSIGCGMNEVRNEEMKSHLNEDIYCHSK 513
            +E + + +     ++   V   L+C +C  L++ AC + CGCRFCS CI  Y+   + +CPG +  C+   +   ++I  D+ +N +I+++ V CP + C+   EL  IE H+  C  +  +CPF  +GC   ++  +++ +HL    + HSK
Sbjct:    3 AEKINRLLITYNFEVEGGVPDNLKCDLCKNLLVNACQSRCGCRFCSKCIMEYVSRGNLYCPGGTSECKEENLTICSNIHTDYRVNRKIAKMRVKCPEETCKVYCELVDIEEHLRLCTMKSQNCPFFVLGCNQPKMVIQDLTNHLQNGTFQHSK 155          
BLAST of TNF receptor-associated factor 6 vs. TrEMBL
Match: A0A151MBD1 (TNF receptor-associated factor OS=Alligator mississippiensis OX=8496 GN=TRAF6 PE=3 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 3.618e-18
Identity = 107/484 (22.11%), Postives = 194/484 (40.08%), Query Frame = 1
Query:   88 EIKISCEVSKELQCKICNKLMIKACHAPCGCRFCSDCIQHYLDGNDKFCPGTSRYCQNRMINYANDIAIDWPINIRISEIVVNCPRQNCEFKDELQLIENHMITCNKQPISCPFNSIGCGMNEVRNEEMKSHLNEDIYCHSKXXXXXXXXXXXXMESMKXXXXXXXXXXX--XXXGNKLFNQQF---YNINLQLTNQQEKILEMGRREKANTREIEDLKRENSQIKQQLDIIELKSTNQQQEMIKMEKENLIKQSKIFSEKTN--------IESYKEIGEAIPAKFQQQIGGVKLEYHQWKHDETKENELSGVSSEIRXXXXXXXXXXXXGIFKWKIKNFSQKIGERIYSKP-------FYSGRFGYKLCLGVTSELAKDYLVYQCNVFVNL--HLMRGEFDENLAWPFKNSVKIDVIDSENGFTYKTKTIKYSDCPDDDGWGKPTTERNIPINVIFVPF-------DSPAVKNNRLEIECRVV 1452
            +++    +  + +C IC   + +A   PCG RFC  CI   +      CP  +       I   N +  D      I  + V CP + C  K EL+ IE H + CN   + CP     C +   +  +MK H+ ++  C  + +           E  ++         +  E     L  QQ    Y+ +             G  EK    E+    +E +Q+  ++    L+S +    +          +  +FS  ++        +E++KE  + +  +  +Q   ++    + +       EL      +      +E+++ +GI+ WKI+NFS  +  +   +P       FY+G+ GYKLCL +  +L       +C  F++L  H M+GE+D  L WPF+ ++++ ++D   G             P+   + +PT  RN P    +V F           VK++ L + C VV
Sbjct:   88 DVEFDPPLESKYECPICLMALREAVQTPCGHRFCKGCIVKSIRDAGHKCPVDNE------ILLENQLFPDNFAKREILSLTVRCPNKGCRLKMELRHIEEHQLQCNFSCVECP----QC-LGFFQKNQMKEHMTQE--CPRRQVCCPNCATSMAYEDKEHHEQHCPLANVFCEYCNTMLIRQQMPNHYDNDCPTAPVPCTYSAFGCPEKMQRNELARHMQEFTQVHMRMMAQTLRSISMTATVPVSFSNGPSFEPALFSHPSSSPYECNPEVENFKETIQQLEGRLVRQDHQIRELIAKMETQSINMVELKRTIRNLEGKVAEMEAQQCNGIYIWKIENFSSLLKAQEEERPVVTHSPGFYTGKPGYKLCLRLHIQLPN---AQRCANFISLFVHTMQGEYDSYLPWPFQGTIRLSILDQSEGPERLNHEEVMEAKPELLAFQRPTIHRN-PKGFGYVTFMHLQALKQRTFVKDDTLLVRCEVV 554          
BLAST of TNF receptor-associated factor 6 vs. TrEMBL
Match: A0A1U7RAW4 (TNF receptor-associated factor OS=Alligator sinensis OX=38654 GN=TRAF6 PE=3 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 2.120e-17
Identity = 106/486 (21.81%), Postives = 194/486 (39.92%), Query Frame = 1
Query:   88 EIKISCEVSKELQCKICNKLMIKACHAPCGCRFCSDCIQHYLDGNDKFCPGTSRYCQNRMINYANDIAIDWPINIRISEIVVNCPRQNCEFKDELQLIENHMITCNKQPISCPFNSIGCG--MNEVRNEEMKSHLNEDIYCHSKXXXXXXXXXXXXMESMKXXXXXXXXXXX--XXXGNKLFNQQF---YNINLQLTNQQEKILEMGRREKANTREIEDLKRENSQIKQQLDIIELKSTNQQQEMIKMEKENLIKQSKIFSEKTN--------IESYKEIGEAIPAKFQQQIGGVKLEYHQWKHDETKENELSGVSSEIRXXXXXXXXXXXXGIFKWKIKNFSQKIGERIYSKP-------FYSGRFGYKLCLGVTSELAKDYLVYQCNVFVNL--HLMRGEFDENLAWPFKNSVKIDVIDSENGFTYKTKTIKYSDCPDDDGWGKPTTERNIPINVIFVPF-------DSPAVKNNRLEIECRVV 1452
            +++    +  + +C IC   + +A   PCG RFC  CI   +      CP  +       I   N +  D      I  + V CP + C  K EL+ IE H + CN       F+ + C   +   +  +MK H+ ++  C  + +           E  ++         +  E     L  QQ    Y+ +             G  EK    E+    +E +Q+  ++    L+S +    +          +  +FS  ++        +E++KE  + +  +  +Q   ++    + +       EL      +      +E+++ +GI+ WKI+NFS  +  +   +P       FY+G+ GYKLCL +  +L       +C  F++L  H M+GE+D  L WPF+ ++++ ++D   G             P+   + +PT  RN P    +V F           VK++ L + C VV
Sbjct:   57 DVEFDPPLESKYECPICLMALREAVQTPCGHRFCKGCIVKSIRDAGHKCPVDNE------ILLENQLFPDNFAKREILSLTVRCPNKGCRLKMELRHIEEHQLQCN-------FSCVECPQCLGFFQKNQMKEHMTQE--CPRRQVCCPNCATSMAYEDKEHHEQHCPLANVFCEYCNTMLIRQQMPNHYDNDCPTAPVPCTYSAFGCPEKMQRNELARHMQEFTQVHMRMMAQTLRSISMTATVPVSFSNGPSFEPALFSHPSSSPYECNPEVENFKETIQQLEGRLVRQDHQIRELIAKMETQSINMVELKRTIRNLEGKIAEMEAQQCNGIYIWKIENFSSLLKAQEEERPVVTHSPGFYTGKPGYKLCLRLHIQLPN---AQRCANFISLFVHTMQGEYDSYLPWPFQGTIRLSILDQSEGPERLNHEEVMEAKPELLAFQRPTIHRN-PKGFGYVTFMHLQALKQRTFVKDDTLLVRCEVV 523          
BLAST of TNF receptor-associated factor 6 vs. TrEMBL
Match: K7FW05 (TNF receptor-associated factor OS=Pelodiscus sinensis OX=13735 GN=TRAF6 PE=3 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 1.065e-16
Identity = 101/473 (21.35%), Postives = 193/473 (40.80%), Query Frame = 1
Query:  124 QCKICNKLMIKACHAPCGCRFCSDCIQHYLDGNDKFCPGTSRYCQNRMINYANDIAID---WPINIRISEIV---VNCPRQNCEFKDELQLIENHMITCNKQPISCPFNSIGCGMNEVRNEEMKSHLNEDIYCHSKXXXXXXXXXXXXMESMKXXXXXXXXXXXXXXGNKLFNQQFYNINLQLTNQQEKILEMGRREKANTREIEDLKRENSQIKQQLDIIELKSTNQQQEMIKMEKENLIKQSKIFSE--------KTNIESYKEIGEAIPAKFQQQIGGVKLEYHQWKHDETKENELSGVSSEIRXXXXXXXXXXXXGIFKWKIKNFSQKIGER-------IYSKPFYSGRFGYKLCLGVTSELAKDYLVYQCNVFVNL--HLMRGEFDENLAWPFKNSVKIDVIDSENGFTYKTKTIKYSDCPDDDGWGKPTTERNIPINVIFVPF-------DSPAVKNNRLEIECRVV 1452
            +C IC   + +A   PCG RFC  CI   +      CP              N+I ++   +P N    EI+   V CP + C  K EL+ +E H + C+   + C         N+++N  M       + C +        +     ++    N+        L   ++ N   Y+ +             G  EK    E+    +E +Q+  ++    L+S +            +  +S +FS           ++E++KE  + +  +  +Q   ++    + +       +L      + +    +E+++ +GI+ W+I+NFS  +  +       I+S  FY+G+ GYKLCL +  +L       +C  F++L  H M+G++D +L WPF+ ++++ ++D   G   +         P+   + +PT  RN P    +V F           VK++ L + C +V
Sbjct:   71 ECPICLMALREAVQTPCGHRFCKACIVKSIRDAGHKCP------------VDNEILLENQLFPDNFAKREILSLSVRCPNKGCLQKMELRHLEEHELNCDFSCVECLQCQGSFQKNQLQNHMMLECPRRQVSCPNCATSMSYEDQELHDQNCPLANVCCEYCNTVLIREQMPNH--YDNDCPTVPVPCTYSAFGCPEKMQRNELAHHMQEFTQVHMRMMAQSLRSLSITATTPMTFLSGVAFESSLFSHVPPAPYDCNPDVENFKETIQQLEGRLVRQDHQIRELIAKMETQSVHVTDLKRTIQNLEEKLTEMEAQQCNGIYIWRIENFSTHLKAQEEEKPVVIHSPGFYTGKPGYKLCLRLHIQLPNSQ---RCANFISLFVHTMQGKYDSHLPWPFQGTIRLSILDQSEGLERQNHEEVMETKPELLAFQRPTAHRN-PKGFGYVTFMHLQTLKQRTYVKDDTLLVRCEIV 525          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 77.411 bits (189), Expect = 1.098e-14
Identity = 40/130 (30.77%), Postives = 72/130 (55.38%), Query Frame = 1
Query: 1039 GIFKWKIKNFSQKIGER-------IYSKPFYSGRFGYKLCLGVTSELAKDYLVYQCNVFVNL--HLMRGEFDENLAWPFKNSVKIDVIDSENGFTYKTKTIKYSDCPDDDGWGKPTTERNIPINVIFVPF 1401
            G++ W+++ FS  I  +       ++S PFY+GR GYKLCL +  +        +C+ +++L  H M+GEFD  L+WP + ++++ V+D   G  +  + ++    PD   + +PT +RN P    +V F
Sbjct:  375 GVYVWRLEGFSTHIRNQEAGHPVVLHSPPFYTGRPGYKLCLRLHLQTPN---APRCSNYISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQAEG-QHHVEVMETK--PDLQAFQRPTVQRN-PKGFGYVTF 497          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 77.411 bits (189), Expect = 1.098e-14
Identity = 40/130 (30.77%), Postives = 72/130 (55.38%), Query Frame = 1
Query: 1039 GIFKWKIKNFSQKIGER-------IYSKPFYSGRFGYKLCLGVTSELAKDYLVYQCNVFVNL--HLMRGEFDENLAWPFKNSVKIDVIDSENGFTYKTKTIKYSDCPDDDGWGKPTTERNIPINVIFVPF 1401
            G++ W+++ FS  I  +       ++S PFY+GR GYKLCL +  +        +C+ +++L  H M+GEFD  L+WP + ++++ V+D   G  +  + ++    PD   + +PT +RN P    +V F
Sbjct:  375 GVYVWRLEGFSTHIRNQEAGHPVVLHSPPFYTGRPGYKLCLRLHLQTPN---APRCSNYISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQAEG-QHHVEVMETK--PDLQAFQRPTVQRN-PKGFGYVTF 497          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 77.411 bits (189), Expect = 1.114e-14
Identity = 40/130 (30.77%), Postives = 72/130 (55.38%), Query Frame = 1
Query: 1039 GIFKWKIKNFSQKIGER-------IYSKPFYSGRFGYKLCLGVTSELAKDYLVYQCNVFVNL--HLMRGEFDENLAWPFKNSVKIDVIDSENGFTYKTKTIKYSDCPDDDGWGKPTTERNIPINVIFVPF 1401
            G++ W+++ FS  I  +       ++S PFY+GR GYKLCL +  +        +C+ +++L  H M+GEFD  L+WP + ++++ V+D   G  +  + ++    PD   + +PT +RN P    +V F
Sbjct:  351 GVYVWRLEGFSTHIRNQEAGHPVVLHSPPFYTGRPGYKLCLRLHLQTPN---APRCSNYISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQAEG-QHHVEVMETK--PDLQAFQRPTVQRN-PKGFGYVTF 473          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Cavefish
Match: ENSAMXT00000035169.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:3354744:3362219:1 gene:ENSAMXG00000029095.1 transcript:ENSAMXT00000035169.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.1586 bits (152), Expect = 1.665e-11
Identity = 39/119 (32.77%), Postives = 61/119 (51.26%), Query Frame = 1
Query: 1039 GIFKWKIKNFSQKIGERI-------YSKPFYSGRFGYKLCLGVTSELAKDYLVYQCNVFVNLHLMRGEFDENLAWPFKNSVKIDVIDSENGFTYKTKTIKYSDCPDDDGWGKPTTERNI 1374
            G   WKI+++ ++  E +       YS+PFY+G FGYK+C  V   L  D +    ++ +   +MRGE+D  L WPFK  V + ++D   G   K     +   P+   + +PT E NI
Sbjct:    4 GTLIWKIRDYKRRKAEAVASKTLSLYSQPFYTGYFGYKMCARV--YLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMD--QGPARKHLGDAFKPDPNSSSFRRPTGEMNI 118          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Cavefish
Match: traf5 (TNF receptor-associated factor 5 [Source:NCBI gene;Acc:103031120])

HSP 1 Score: 67.0106 bits (162), Expect = 2.334e-11
Identity = 62/285 (21.75%), Postives = 124/285 (43.51%), Query Frame = 1
Query:  643 NLQLTNQQEKILEMGRREKANTREIEDLKRENSQIKQQL----DIIELKSTNQQQEMIKMEKENLIKQSKIFSEKTNIESYKEIGEAIPAKFQQQIGGVKLEYHQWKHDETKENELSGVSSEIRXXXXXXXXXXXXGIFKWKIKNFSQK--IGERIYSKPFYSGRFGYKLCLGVTSELAKDYLVYQCNVFVNLHLMRGEFDENLAWPFKNSVKIDVIDSENGFTYKTKTIKYSDCPD--DDGWGKPTTERNIPINV--------IFVPFDSPAVKNNRLEIECRV 1449
            NL ++N + ++ +      A  R +E+ +   S +K++L    D++E   T ++   ++   ++L +Q  +       +S +E   A+    Q     + +   Q +  E +  +L   S +              G   WK+ ++ +K   G  + S PFY+   GYKL   V   L  +      ++ + + LMRG+FD  L WPF+ +V + V+D      +    +  S  PD   + + +PT+E N  +          +  P ++  V+++ L I+ +V
Sbjct:  284 NLLVSNLKREVSKCDTTVSAMQRSVEEQRELVSSVKRELKDLRDVLEADLTKEELVSLRASLDSLREQVAM------TQSLREHLGALGQTCQSHTRLLDIHVQQLQCSEQRFQQLESTSYD--------------GKLIWKVHDYHRKKEAGTALNSPPFYTSHSGYKLSARVY--LGGEGTARGTHLSLYVMLMRGDFDSLLPWPFRQNVTLAVLDQSGNRNH----VSLSFTPDLASNNFRRPTSETNAALGFPRFITHADLEAPRNAAYVRDDTLFIKVKV 542          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000074.1 (pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-1 gene:ENSPMAG00000000066.1 transcript:ENSPMAT00000000074.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.6994 bits (156), Expect = 2.168e-11
Identity = 38/136 (27.94%), Postives = 69/136 (50.74%), Query Frame = 1
Query: 1039 GIFKWKIKNFSQK----IGER---IYSKPFYSGRFGYKLCLGVTSELAKDYLVYQCNVFVNLHLMRGEFDENLAWPFKNSVKIDVIDSENGFTYKTKTIKYSDCPDDDGWGKPTTERNI----PINVIFVPFDSPA 1413
            G   WKI++++++    +  R   +YS+PFY+  FGY++C    + L  D +    ++ +   +MRGE+D  L WPF+  V + ++D        + T K    P    + +PT++ NI    P+ V  V  +S +
Sbjct:  325 GKLVWKIRDYARRKQDAVSGRTLSLYSQPFYTSPFGYRMC--ARAYLNGDGVGRGTHLSLFFVVMRGEYDALLPWPFRQRVTLTLLDQGAARRQLSDTFKPD--PASSSFRRPTSDMNIASGCPLFVSHVALESAS 456          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002130.1 (pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 gene:ENSPMAG00000001936.1 transcript:ENSPMAT00000002130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.4622 bits (145), Expect = 4.136e-10
Identity = 35/133 (26.32%), Postives = 66/133 (49.62%), Query Frame = 1
Query: 1039 GIFKWKIKNFSQKIGE-------RIYSKPFYSGRFGYKLCLGVTSELAKDYLVYQCNVFVNLHLMRGEFDENLAWPFKNSVKIDVIDSENGFTYKTKTIKYSDCPDDDGWGKPTTERNI----PINVIFVPFD 1404
            G   WKI++++++  E        +YS+PFY+  FGYK+C    + L  D +    ++ +   +MRGE+D  L WPF+  V + ++D   G   +  +  ++  P    + +P  + N+    P+ V  V  +
Sbjct:  268 GKLVWKIRDYARRKQEAASGRTLSLYSQPFYTSPFGYKMC--ARAYLNGDGVGRGTHLSLFFVVMRGEYDALLEWPFRRRVTLSLLD--QGAARRHLSDTFTPDPASGSFRRPDGDMNVASGCPLFVSHVALE 396          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Sea Lamprey
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 60.077 bits (144), Expect = 6.324e-10
Identity = 44/184 (23.91%), Postives = 80/184 (43.48%), Query Frame = 1
Query:  925 VKLEYHQWKHDETKENELSGVSSE-------IRXXXXXXXXXXXXGIFKWKIKNFSQKIG-----------------ERIYSKPFYSGRFGYKLCLG--------VTSELAKDYLVY---QCNVFVNLHLMRGEFDENLAWPFKNSVKIDVIDSENGFTYKTKTIKYSDCPDDDGWGKPTTERN 1371
            V L+ HQ +    K +   G+ +E       +       ES   +GIF W+++ FS+ +                    ++S  FY+G  GY+LCL         V +  A   ++    Q ++ + +HL++G++D  L WPFK  ++I V+D     +     +  +D P    + +P+  RN
Sbjct:  348 VVLQLHQIRELSAKTDNQQGLLAEATRLVRSLEARVAESESRLCAGIFTWRVERFSRLLPGGLASGFASDGMHPDAPAVMHSSGFYTGVPGYRLCLRLQVLSGREVPAGAASPSVLLAGRQPHLALFVHLLQGDYDHRLPWPFKGRIRISVVDQCERDSVHVTEMMDAD-PQLSAFQRPSVHRN 530          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Nematostella
Match: EDO49464 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG36])

HSP 1 Score: 82.0333 bits (201), Expect = 1.307e-16
Identity = 112/513 (21.83%), Postives = 194/513 (37.82%), Query Frame = 1
Query:  124 QCKICNKLMIKACHAPCGCRFCSDCIQHYLDGNDKFCPGTSR----------------------YCQNRMINYANDIAIDWPINIR-ISEIVVNCPR-----------------------QNCEFKDE-----LQLI-----ENHMITCNKQPISCPFNSIGCGMNEVRNEEMKSHLN-----EDIYCHSKXXXXXXXXXXXXMESMKXXXXXXXXXXXXXXGNKLFNQQFYNINLQLTNQQ-------EKILEMGRREKANTREIEDL--KRENSQIKQQ--------LDIIELKSTNQQQEMIKMEKENLIKQSKIFSEKTN-----IESYKEIGEAIPAKFQQQIGG-VKLEYHQWKHD-ETKENELSGVSSEIRXXXXXXXXXXXXGIFKWKIKNFSQKIGE-------RIYSKPFYSGRFGYKLCLGVTSELAKDYLVYQCNVFVNLHLMRGEFDENLAWPFKNSVKIDVIDSEN----GFTYKTKTIKYSDCPDDDGWGKPTTERNI 1374
            +C +C   +      PCG RFC  C++  L G  K CP                          YC NR       +  +W  +++ + E   NC                         + CEFK       LQ I     E+H+ TC K P+ CP     CG   +  +E+  H        ++ C            R  +E+                     +Q   ++NL LT  Q       E   ++ + EK   ++ E +  +RE   +  Q        L++IE     Q++E+ ++++   +++ +    + +     IE+    G A P+     +GG + LE  Q +++ +   +++     +++       S +  G + WKI  ++++  E        IYS PFY GR+GYK C  V      D +    ++ +   LMRGEFD  L WPF+  V   ++D +     G T++         P    + +PT+  NI
Sbjct:   20 RCPVCGNALKHPVQTPCGHRFCEGCLEPILRGPSK-CPVDGEELKIDGVFKDVCCRREILCLACYCPNR------QLGCEWMKDLQYLEEHRANCEYKGVQCHNPGCQEKVAKRDLEAHLERCEFKPSDCQYCLQRIPAASMEDHLQTCEKHPVVCPH----CGAEGICRDELLHHQTNICEQAELPCSFAKHGCHFKGTREALET------------------HFRDQASVHVNLLLTATQNEEKARSEMAAKLSQMEKERAKQQEQMYEQREALAVANQNLRTYQGKLNVIERSVAEQRRELAELKERIQLQEVEAAIREQDRRLGMIENEASRG-AAPSSGPGSMGGTMALERRQDRNEHQLALHDIQLAEHDLKLQMLEATSYD--GTYIWKIDEYTRRYQEGVSGKTPSIYSPPFYVGRYGYKACARVYPN--GDGMGKGSHLSLFFVLMRGEFDALLPWPFRQKVTFKLLDQDRVHDIGDTFRPD-------PTSSSFKRPTSNMNI 491          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Nematostella
Match: EDO35237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM27])

HSP 1 Score: 73.1738 bits (178), Expect = 8.821e-14
Identity = 40/96 (41.67%), Postives = 55/96 (57.29%), Query Frame = 1
Query: 1039 GIFKWKIKNFSQKIGE-------RIYSKPFYSGRFGYKLCLGVTSE---LAKD-YLVYQCNVFVNLHLMRGEFDENLAWPFKNSVKIDVIDSENGF 1293
            G F WKI  F+++  E        IYS PFY+ RFGYKLC  +       A+D YL    ++F+ L  MRGE+D  L WPF+ ++ I +ID +NG 
Sbjct:  380 GTFLWKIDKFTERYAEAKSGNATSIYSSPFYTHRFGYKLCARLFPNGDGSARDNYL----SIFIAL--MRGEYDSILPWPFQETITITLIDQDNGM 469          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Nematostella
Match: EDO40665 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6K0])

HSP 1 Score: 60.4622 bits (145), Expect = 5.454e-10
Identity = 38/123 (30.89%), Postives = 67/123 (54.47%), Query Frame = 1
Query: 1039 GIFKWKIKNFSQ--------KIGERIYSKPFYSGRFGYKLCLGVTSELAKDYLVYQCNVFVNLH--LMRGEFDENLAWPFKNSVKIDVIDSENGFTYK-TKTIKYSDCPDDDGWGKPTTERNI 1374
            G F WKI N++Q        K  E++ S PFY+G++GYKL     +E   + L       ++L+  +M+G++D  L WPF+  V   +ID ++ FT +  KT + +   + D +G+P   +++
Sbjct:  229 GKFLWKISNYTQLFQQSATKKEKEKLCSPPFYTGQYGYKL----RAEAFLNGLGQGKGTHLSLYVVIMKGDYDSVLPWPFQQRVDFILIDQDDDFTSRQNKTWRLTCDRNSDYFGRPNKAKSL 347          

HSP 2 Score: 53.1434 bits (126), Expect = 1.355e-7
Identity = 42/154 (27.27%), Postives = 61/154 (39.61%), Query Frame = 1
Query:   88 EIKISCEVSKELQCKICNKLMIKACHA-PCGCRFCSDCIQHYLDGNDKFCPGTSRYCQNRMINYANDIAIDWPINIRISEIVVNCPRQ--NCEFKDELQ------------LIENHMITCNKQPISCPFNSIGCGMNEVRNEEMKSHLNEDIYC 504
            E    C +  + QC IC            CG RFC  C++  L     FCP   R C +R     + +  D      +  + V CP    +CE+  EL             L++ H+  C + PI C  N   CG  ++  EEM  H++ D  C
Sbjct:   29 EADFVCTIPPDYQCPICQLPFRDPVQTRDCGHRFCESCLEPILRKPPAFCP-IDRRCISR-----DKVYPDKACKRTVLSLTVKCPNHVTDCEWVGELGNLPSNSSNSYEVLVKVHIEACKRVPIKCVNN---CGRTDIAREEMAVHIDVDGDC 173          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Nematostella
Match: EDO48773 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI91])

HSP 1 Score: 60.8474 bits (146), Expect = 6.956e-10
Identity = 34/121 (28.10%), Postives = 61/121 (50.41%), Query Frame = 1
Query: 1039 GIFKWKIKNFSQ-------KIGERIYSKPFYSGRFGYKLCLGVTSELAKDYLVYQCNVFVNLHLMRGEFDENLAWPFKNSVKIDVIDSENGFTYK---TKTIKYSDCPDDDGWGKPTTERN 1371
            G F WK+ NF Q        +   I+S PFY+  +GYK+CL +        L    ++F+  H+M+G++D  L WPF   + + ++D  +    +   ++T+     P+   + +PT+ RN
Sbjct:  332 GTFIWKLDNFRQCREGSIAGLTAAIHSPPFYTSMYGYKMCLRMNLNGVDGGLGEHVSLFI--HMMQGDWDGILEWPFIGRITLSILDQSDQIDSRRPISETLVAK--PNLLAFQRPTSPRN 448          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Nematostella
Match: EDO43806 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXN6])

HSP 1 Score: 51.9878 bits (123), Expect = 3.097e-8
Identity = 37/149 (24.83%), Postives = 69/149 (46.31%), Query Frame = 1
Query:   52 MSESVWKFMRENEIKISCEVSKELQCKICNKLMIKACHAPCGCRFCSDCIQHYLD---GNDKFCPGTSRYCQNRMINYANDIAIDWPINIRISEIVVNCPRQN--CEFKDELQLIENHMITCNKQPISCPFNSIGCGMNEVRNEEMKSH 483
            M  SV +F+ +        V   L C IC +++ +A   PCG  FC  C++ +++   G ++ CP +   C+  +  Y  D      +   +  ++V+CP  +  C+   +L+ +E H+ +C+  P+ C     GC     R E  + H
Sbjct:    1 MGYSVQQFIEK--------VDPNLLCGICAEVLERAVLTPCGHSFCGVCLETWMNAKLGENEKCPASCPSCRADL--YQGDTIPVLALRGIVDGLIVHCPNADNGCKLVLKLEGVEGHLKSCSHAPVQC----CGCSAFLKRGELAEHH 135          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Medaka
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:101161132])

HSP 1 Score: 73.1738 bits (178), Expect = 2.354e-13
Identity = 48/154 (31.17%), Postives = 77/154 (50.00%), Query Frame = 1
Query: 1039 GIFKWKIKNFS-----QKIGERI--YSKPFYSGRFGYKLCLGVTSELAKDYLVYQCNVFVNL--HLMRGEFDENLAWPFKNSVKIDVIDSENGFTYKTKTIKYSDCPDDDGWGKPTTERNIPINVIFVPF-------DSPAVKNNRLEIECRVV 1452
            GIF W++K FS     Q+ G  +  +S  FY+GR GYKLCL +  +        +C+ F++L  H M+G FD  L WPF+ ++++ ++D      +  + ++    PD   + KP  +RN P    +V F           VK++ L I C V 
Sbjct:  396 GIFIWRLKAFSTHLRSQEAGIPVVEHSPGFYTGRPGYKLCLRLHLQTPT---APRCSNFISLFVHTMQGVFDSQLTWPFQGTIRLAILDQGPEGQHHMEVMETK--PDLQAFQKPINQRN-PKGFGYVTFMHRSLLSQRAYVKDDTLLIRCEVT 543          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Medaka
Match: traf3 (TNF receptor associated factor 3 [Source:NCBI gene;Acc:101161601])

HSP 1 Score: 62.003 bits (149), Expect = 6.109e-10
Identity = 37/119 (31.09%), Postives = 60/119 (50.42%), Query Frame = 1
Query: 1039 GIFKWKIKNFSQKIGERI-------YSKPFYSGRFGYKLCLGVTSELAKDYLVYQCNVFVNLHLMRGEFDENLAWPFKNSVKIDVIDSENGFTYKTKTIKYSDCPDDDGWGKPTTERNI 1374
            G   WKI+++ ++  + +       YS+PFY+G FGYK+C  V   L  D +    ++ +   +MRGE+D  L WPFK  V + ++D   G + K     +   P    + +P  E NI
Sbjct:  298 GTLIWKIRDYKRRKQDAVAGKTLSLYSQPFYTGYFGYKMCARVY--LNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMD--QGPSRKHLGDAFKPDPSSSSFRRPVAEMNI 412          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 58.151 bits (139), Expect = 1.164e-8
Identity = 35/120 (29.17%), Postives = 61/120 (50.83%), Query Frame = 1
Query: 1039 GIFKWKIKNFSQKIGE-------RIYSKPFYSGRFGYKLCLGVTSELAKDYLVYQCNVFVNLHLMRGEFDENLAWPFKNSVKIDVIDSENGFTYKTKTIKYSDCPDDD--GWGKPTTERN 1371
            G+  WK+ ++S+K+ E         +S PFY+ R+GYKL   V++ L  +      ++ V + ++ GE+D  L WPF   V   ++D  +    K + I  +  PD +   + KP + RN
Sbjct:  308 GVLIWKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKL--QVSAFLNGNGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNFQKPCSTRN 425          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 58.151 bits (139), Expect = 1.218e-8
Identity = 35/120 (29.17%), Postives = 61/120 (50.83%), Query Frame = 1
Query: 1039 GIFKWKIKNFSQKIGE-------RIYSKPFYSGRFGYKLCLGVTSELAKDYLVYQCNVFVNLHLMRGEFDENLAWPFKNSVKIDVIDSENGFTYKTKTIKYSDCPDDD--GWGKPTTERN 1371
            G+  WK+ ++S+K+ E         +S PFY+ R+GYKL   V++ L  +      ++ V + ++ GE+D  L WPF   V   ++D  +    K + I  +  PD +   + KP + RN
Sbjct:  308 GVLIWKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKL--QVSAFLNGNGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNFQKPCSTRN 425          
BLAST of TNF receptor-associated factor 6 vs. Ensembl Medaka
Match: ENSORLT00000001369.2 (TNF receptor-associated factor 5 [Source:NCBI gene;Acc:101170323])

HSP 1 Score: 57.3806 bits (137), Expect = 2.163e-8
Identity = 37/130 (28.46%), Postives = 63/130 (48.46%), Query Frame = 1
Query: 1039 GIFKWKIKNF-----SQKIGER--IYSKPFYSGRFGYKLCLGVTSELAKDYLVYQCNVFVNLHLMRGEFDENLAWPFKNSVKIDVIDSENGFTYKTKTIKYSDCPDDDGWGKPTTERNIPINVIFVPFDS 1407
            G   WKIK+F     ++  G+   + S PF++GR GYK+   + + L  D      ++ + + LM G+FD  L WPFK +V + V+D      +++   +    P +  + +P  E    + V F  F S
Sbjct:  428 GRLIWKIKDFQKRREAEATGQHPCLSSVPFHTGRCGYKM--AMKAYLNGDGEGRGTHLSLYVVLMPGDFDALLPWPFKQTVSLSVLDQSGARNHQSFNFRPD--PTNTCFHQPAAESASNVAVGFPCFIS 553          
BLAST of TNF receptor-associated factor 6 vs. Planmine SMEST
Match: SMESG000015050.1 (SMESG000015050.1)

HSP 1 Score: 747.658 bits (1929), Expect = 0.000e+0
Identity = 405/467 (86.72%), Postives = 432/467 (92.51%), Query Frame = 1
Query:   52 MSESVWKFMRENEIKISCEVSKELQCKICNKLMIKACHAPCGCRFCSDCIQHYLDGNDKFCPGTSRYCQNRMINYANDIAIDWPINIRISEIVVNCPRQNCEFKDELQLIENHMITCNKQPISCPFNSIGCGMNEVRNEEMKSHLNEDIYCHSKXXXXXXXXXXXXMESMKXXXXXXXXXXXXXXGNKLFNQQFYNINLQLTNQQEKILEMGRREKANTREIEDLKRENSQIKQQLDIIELKSTNQQQEMIKMEKENLIKQSKIFSEKTNIESYKEIGEAIPAKFQQQIGGVKLEYHQWKHDETKENELSGVSSEIRXXXXXXXXXXXXGIFKWKIKNFSQKIGERIYSKPFYSGRFGYKLCLGVTSELAKDYLVYQCNVFVNLHLMRGEFDENLAWPFKNSVKIDVIDSENGFTYKTKTIKYSDCPDDDGWGKPTTERNIPINVIFVPFDSPAVKNNRLEIECRVV 1452
            M  ++WK M+EN+ ++  E+S +L C IC  LMI AC+APC CRFCSDCI+HYLDGN KFCPG ++ CQ  +INYANDI  DWPINIRIS ++V CPR+NC+FK+EL LIE+H+ TC+KQ +SCPFN+IGC  NEV ++E+  HLN   Y H KLL+ELINNLRNEMESMKNENIELRNEILELRGNKLFNQQFYNINLQLTNQQEKILEMGRREKANTREIEDLKRENSQIKQQLDIIELKSTNQQQEMIKMEKENLIKQSKIFSEKTNIESYKEIGEAIPAKFQQQIGGVKLEYHQWKHDETKENELSGVSSEIRKLEKYLESEEESGIFKWKIKNFSQKIGERIYSKPFYSGRFGYKLCLGVTSELAKDYLVYQCNVFVNLHLMRGEFDENLAWPFKNSVKIDVIDSENGFTYKTKTIKYSDCPDDDGWGKPTTERNIPINVIFVPFDSPAVKNNRLEIECRVV
Sbjct:    1 MFTNIWKIMKENKFEVDSEISNDLICGICKCLMINACNAPCECRFCSDCIEHYLDGNYKFCPGATKNCQ--IINYANDILTDWPINIRISRLIVKCPRENCQFKEELDLIEHHIKTCDKQTVSCPFNAIGCETNEVMHDEINDHLNVSNYSHIKLLLELINNLRNEMESMKNENIELRNEILELRGNKLFNQQFYNINLQLTNQQEKILEMGRREKANTREIEDLKRENSQIKQQLDIIELKSTNQQQEMIKMEKENLIKQSKIFSEKTNIESYKEIGEAIPAKFQQQIGGVKLEYHQWKHDETKENELSGVSSEIRKLEKYLESEEESGIFKWKIKNFSQKIGERIYSKPFYSGRFGYKLCLGVTSELAKDYLVYQCNVFVNLHLMRGEFDENLAWPFKNSVKIDVIDSENGFTYKTKTIKYSDCPDDDGWGKPTTERNIPINVIFVPFDSPAVKNNRLEIECRVV 465          
BLAST of TNF receptor-associated factor 6 vs. Planmine SMEST
Match: SMESG000000559.1 (SMESG000000559.1)

HSP 1 Score: 458.373 bits (1178), Expect = 2.223e-157
Identity = 279/518 (53.86%), Postives = 332/518 (64.09%), Query Frame = 1
Query:   52 MSESVWKFMRENEIKISCEVSKELQCKICNKLMIKACHAPCGCRFCSDCIQHYLDGNDKFCPGTSRYCQNRMINYANDIAIDWPINIRISEIVVNCPRQNCEFKDELQLIENHMITCNKQPISCPFNSIGCGMNEVRNEEMKSHLNEDIYCHSKXXXXXXXXXXXXMESMKXXXXXXXXXX--------XXXXGNKLFNQQFYNINLQLTNQQEKILEMGRREKANTREIE----------------------------DLKRENSQIKQQLDIIELKSTNQQQEMIKMEKENLIKQSKIFSEKTNIESYKEI--GEAIP-----AKFQQQIGGVKL--EYHQWKHDETKENELSGVSSEIRXXXXX--XXXXXXXGIFKWKIKNFSQ-KIGERIYSKPFYSGRFGYKLCLGV-TSELAKDYLVYQCNVFVNLHLMRGEFDENLAWPFKNSVKIDVIDSENGFTYKTKTIKYSDCP---DDDGWGKPTTERNIPINVIFVPFDSPAVKNNRLEIECRV 1449
            MSESVWKFMRENEIKISCEVSKELQCKICNKLMIKACHAPCGCRFCSDCIQHYLDGNDKFCPGT+RYCQNRMINYANDIAIDWP NIRISEIVVNCPRQNCEF DELQ+IENH  TC+K+ ISCPFN+IGCGMNE+RNEEMKSHLNE+IYCHSKLLIELINNLRNEMESMK EN E+RN               N+ F QQ  NI  Q  NQQ+K+ EM  +E+ NT EIE                             LKRE SQ KQQ   IEL+ TNQQQ+M +ME +    + +I  E   + +       E I      +KF+QQI   K   E HQ + +   +NE+   ++EIR ++           GI  W+I   SQ +  + IYSKPFYSG  GYK+CL V   +     LVY        HLMRG+ D  L WPFK +VK+D I+  +G  Y ++++K  D P      GWG+P  +RN PI          A+KN++L ++CR+
Sbjct:    1 MSESVWKFMRENEIKISCEVSKELQCKICNKLMIKACHAPCGCRFCSDCIQHYLDGNDKFCPGTTRYCQNRMINYANDIAIDWPFNIRISEIVVNCPRQNCEFNDELQMIENHTRTCDKRSISCPFNAIGCGMNEIRNEEMKSHLNEEIYCHSKLLIELINNLRNEMESMKRENTEMRNYNIELRNDIIELRNANEQFKQQIDNIERQFINQQQKMCEMEAKEQENTAEIEQLNEEMVVIKNANRALQDEMIELRNDNIQLKREISQSKQQNQNIELQLTNQQQKMCEMEAKEQENRGEINEEIAAVNNANRALQNEMIELRREISKFKQQIDAFKQISEQHQLQQNIKIQNEMEKCANEIRLIQTKFGNAEFINFGILDWQIDKLSQLERKKSIYSKPFYSGPGGYKMCLAVIIRDFGGAILVY-------FHLMRGDCDAGLEWPFKYAVKVDAINPADGNVYSSQSVKCPDSPAAAAAAGWGRPARDRNDPICYYITKL--SAIKNDKLLLKCRI 509          
BLAST of TNF receptor-associated factor 6 vs. Planmine SMEST
Match: SMESG000000563.1 (SMESG000000563.1)

HSP 1 Score: 437.573 bits (1124), Expect = 3.641e-149
Identity = 266/516 (51.55%), Postives = 334/516 (64.73%), Query Frame = 1
Query:   52 MSESVWKFMRENEIKISCEVSKELQCKICNKLMIKACHAPCGCRFCSDCIQHYLDGNDKFCPGTSRYCQNRMINYANDIAIDWPINIRISEIVVNCPRQNCEFKDELQLIENHMITCNKQPISCPFNSIGCGMNEVRNEEMKSHLNEDIYCHSKXXXXXXXXXXXXMESMKXXXXXXXXXX--------XXXXGNKLFNQQFYNINLQLTNQQEKILEMGRREKANTREIE----------------------------DLKRENSQIKQQLDIIELKSTNQQQEMIKMEKENLIKQSKIFSEKTNIESYKEIGEAIPAKFQQQIGGVKLEYHQWKHDETK---------ENELSGVSSEIRXXXXXXXXXX--XXGIFKWKIKNFSQ-KIGERIYSKPFYSGRFGYKLCLGV-TSELAKDYLVYQCNVFVNLHLMRGEFDENLAWPFKNSVKIDVIDSENGFTYKTKTIKYSDCPDDDGWGKPTTERNIPINVI-FVPFDSPAVKNNRLEIECRV 1449
            MSESVWKFMRENEIKISCEVSKELQCKICNKLMIKAC APCGCRFCSDCIQH+LDGNDKFCPGTSRYCQNRMINYANDIAIDWP NIRISEIVVNCP QNCEF DELQ+IENHM TC+K+ ISCPFN+IGCGMNE+RNEEMKSHLNE+IYCHSKLLIELINNLRNEMESMK+EN E+RN               NK F QQ  NI  Q  NQQ+K+ EM  +E+ NT EIE                             LKRE SQ +QQ   IEL+ TNQQQ+M +ME +    + +I  E   + +     +    + +++I   K +   +K +  +         +NE+   ++EI  ++    + E    GI  W+I   +Q +  + IYS+PFYS   GYK+CL V  + L      Y  ++ V  HLMRG+ D  + WPFK +VK+D I+  +G  Y ++++K  D P    WG+P ++RN  I+   +  F S A+KN++L ++CR+
Sbjct:    1 MSESVWKFMRENEIKISCEVSKELQCKICNKLMIKACQAPCGCRFCSDCIQHHLDGNDKFCPGTSRYCQNRMINYANDIAIDWPFNIRISEIVVNCPMQNCEFNDELQMIENHMRTCDKRSISCPFNAIGCGMNEIRNEEMKSHLNEEIYCHSKLLIELINNLRNEMESMKSENTEMRNYNIELRNDIIELRNANKQFKQQIDNIERQFINQQQKMCEMEAKEQENTGEIEQLNEEMVVIKNANRALQDEMIELRNDNIQLKREISQSRQQNQNIELQLTNQQQKMCEMEAKEQENRGEINEEIAAVNNANRALQNEMIELRREISQSKQQIDAFKQNCEQQQLQQNIKIQNEMEKCANEIPPIQTKFGNAEFINFGILDWQIDKLAQLERNKPIYSEPFYSVPGGYKMCLAVDINSLFGGPTRYDGDIRVGFHLMRGDCDAGMEWPFKYAVKVDAINPADGNVYSSQSVKCPDSPAAAKWGRPASDRNDAISFTNYFTFLS-AIKNDKLLLKCRI 515          
BLAST of TNF receptor-associated factor 6 vs. Planmine SMEST
Match: SMESG000016032.1 (SMESG000016032.1)

HSP 1 Score: 435.261 bits (1118), Expect = 2.231e-148
Identity = 274/516 (53.10%), Postives = 347/516 (67.25%), Query Frame = 1
Query:   52 MSESVWKFMRENEIKISCEVSKELQCKICNKLMIKACHAPCGCRFCSDCIQHYLDGNDKFCPGTSRYCQNRMINYANDIAIDWPINIRISEIVVNCPRQNCEFKDELQLIENHMITCNKQPISCPFNSIGCGMNEVRNEEMKSHLNEDIYCHSKXXXXXXXXXXXXMESMKXXXXXXXXXXXXXXGNKLFNQQFYNINLQLTNQQEKILEMGRREKANTREIED----------------------------LKRENSQIKQQLDIIELKSTNQQQEMIKM---EKENLIKQSKIFSEKTN---------IESYKEIGEAIPAKFQQQIGGVK--LEYHQWKHDETKENELSGVSSEIRXXXXXXXXXX--XXGIFKWKIKNFSQ-KIGERIYSKPFYSGRFGYKLCLGV--TSELAKDYLVYQCNVFVNLHLMRGEFDENLAWPFKNSVKIDVIDSENGFTYKTKTIKYSDCP---DDDGWGKPTTERNIPINVIFVPFDSPAVKNNRLEIECRV 1449
            MSESVWKFMRENEIK+SCEVSKELQCKICNKLMIKACHAPCGCRFCSDCI HYLDGNDKFCPGTSR CQNRMI+YANDI+IDWPINIRISEIVVNCPRQNCEF DEL  IENHM TC+K+PISCPF++I C MNE+RNEEMKSHLNEDIYCHSKLLIELI+NLRNEMESMK+ENIEL+ EI + +      Q+  NI LQLTNQQ+K+ EM  +E+ NT EIE+                            LKRE SQ KQQ   IEL+ TNQQQ+M +M   E+EN  + ++  +E  N         IE  +EI ++     +QQI   K   E  Q + +   +NE+   ++EI+ ++    + +    GI  W+I   SQ + G+ IYS+PFYSG  GYK+CL V  TS  +   LV    ++V+ +LMRG+ D  L WPFK +VK+D+I+  +G  Y ++++K  D P       WG+P ++ N  I+  +      A+KN++L ++CR+
Sbjct:    1 MSESVWKFMRENEIKVSCEVSKELQCKICNKLMIKACHAPCGCRFCSDCIDHYLDGNDKFCPGTSRRCQNRMISYANDISIDWPINIRISEIVVNCPRQNCEFNDELDRIENHMRTCDKRPISCPFSAIRCEMNEIRNEEMKSHLNEDIYCHSKLLIELIDNLRNEMESMKSENIELKKEISQSK------QKIENIQLQLTNQQQKMCEMEAKEQENTGEIEELNEEMVVIKNANRALQDEMIELRNDNIQLKREISQSKQQNQNIELQLTNQQQKMCEMKAKEQENRGEINEEIAEVNNANRALQNEMIELRREISQS-----KQQIDAFKQISEQQQLQQNIKIQNEMEKCANEIQLIQTKFVNAKFINFGILDWQIDKLSQLERGKYIYSEPFYSGPGGYKMCLAVKITSITSNASLVGA--IWVDFYLMRGDCDAGLEWPFKYAVKVDMINPADGNVYSSQSVKCPDSPAAAAAANWGRPASDINNRISFTYHFTILSAIKNDKLLLKCRI 503          
BLAST of TNF receptor-associated factor 6 vs. Planmine SMEST
Match: SMESG000000493.1 (SMESG000000493.1)

HSP 1 Score: 432.18 bits (1110), Expect = 4.099e-148
Identity = 265/479 (55.32%), Postives = 322/479 (67.22%), Query Frame = 1
Query:   52 MSESVWKFMRENEIKISCEVSKELQCKICNKLMIKACHAPCGCRFCSDCIQHYLDGNDKFCPGTSRYCQNRMINYANDIAIDWPINIRISEIVVNCPRQNCEFKDELQLIENHMITCNKQPISCPFNSIGCGMNEVRNEEMKSHLNEDIYCHSKXXXXXXXXXXXXMESMKXXXXXXXXXX-XXXXGNKLFNQQFYNINLQLTNQQEKILEMGRREKANTREIEDLKRENSQIKQQLDIIELKSTNQ--QQEMIKMEKENLIKQSKIFSEKTNIESYKEIGEAIPAKFQQQIGGVKLEYHQWKHDETKENELSGVSSEIRXXXXX--XXXXXXXGIFKWKIKNFSQKIGER-IYSKPFYSGRFGYKLCLGVTSELAKDYLVYQCN-VFVNLHLMRGEFDENLAWPFKNSVKIDVIDSENGFTYKTKTIKYSDCP----DDDGWGKPTTERNIPI--NVIFVPFDSPAVKNNRLEIECRV 1449
            MSESVWKFMRENEIKISCEVSKELQCKICNKLMIKACHAPCGCRFCSDCIQH+LDGNDKFCPGTSRYCQNRMINYANDIAIDWP NIRISEIVVNCPRQNCEF DELQ+IENHM TC+KQ I+CPFN+IGCGMNE+RNEEMKSHLNE+IYCHSKLLIELINNLRNEMESMK+EN E+RN        NK F QQ  NI  Q  NQQ+K+ EM  +E+ NT EIE+L  E         ++ +K+ N+  Q EMI++ +E  I QS     K  I+++K+ GE    +   +I                +NE+  +++EIR +            GI  W+I   SQ   ++ IYS+PFYSG  GYK+CL V  E   D +      + V  +LM G+ D  L WPFK SVK+D I+  NG  Y ++++K  DCP        WG+P + RN  I  N  F       +KN++L ++CR+
Sbjct:    1 MSESVWKFMRENEIKISCEVSKELQCKICNKLMIKACHAPCGCRFCSDCIQHHLDGNDKFCPGTSRYCQNRMINYANDIAIDWPCNIRISEIVVNCPRQNCEFNDELQMIENHMRTCDKQSINCPFNAIGCGMNEIRNEEMKSHLNEEIYCHSKLLIELINNLRNEMESMKSENTEMRNYNIELRNANKQFKQQIDNIERQFINQQQKMCEMEAKEQENTGEIEELNEE---------MVVIKNANRALQDEMIELRRE--ISQS-----KQQIDAFKQNGEQQQLQQNIKI----------------QNEMEKIANEIRLIPTKFGNAEFINFGILDWQIDKLSQLRRDKWIYSEPFYSGPGGYKICLAVFIEYWWDDIRDDLGAICVGFYLMCGDCDAGLEWPFKYSVKVDAINPANGNVYCSQSVKCPDCPAATAAAANWGRPASYRNYAICFNNHFTKLSD--IKNDKLLLKCRI 445          
The following BLAST results are available for this feature:
BLAST of TNF receptor-associated factor 6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF64.760e-1227.45TNF receptor associated factor 6 [Source:HGNC Symb... [more]
TRAF64.760e-1227.45TNF receptor associated factor 6 [Source:HGNC Symb... [more]
TRAF38.125e-1232.77TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF39.072e-1232.28TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF39.072e-1232.28TNF receptor associated factor 3 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor-associated factor 6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
trf-13.845e-837.50TNF Receptor Associated Factor (TRAF) homolog; TRF... [more]
trf-27.694e-734.41TNF Receptor Associated Factor (TRAF) homolog [So... [more]
back to top
BLAST of TNF receptor-associated factor 6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor 6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf32.235e-1621.86TNF receptor-associated factor 3 [Source:ZFIN;Acc:... [more]
traf61.839e-1534.62TNF receptor-associated factor 6 [Source:NCBI gene... [more]
traf61.839e-1534.62TNF receptor-associated factor 6 [Source:NCBI gene... [more]
traf61.839e-1534.62TNF receptor-associated factor 6 [Source:NCBI gene... [more]
traf56.693e-1026.81Tnf receptor-associated factor 5 [Source:ZFIN;Acc:... [more]
back to top
BLAST of TNF receptor-associated factor 6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ssh21.651e-1523.39slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
egf6.496e-1429.22epidermal growth factor [Source:Xenbase;Acc:XB-GEN... [more]
ssh21.296e-1224.40slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
hspb64.809e-833.33heat shock protein family B (small) member 6 [Sour... [more]
sytl24.800e-730.00synaptotagmin like 2 [Source:Xenbase;Acc:XB-GENE-9... [more]
back to top
BLAST of TNF receptor-associated factor 6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf61.036e-1328.10TNF receptor-associated factor 6 [Source:MGI Symbo... [more]
Traf34.863e-1232.28TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf34.863e-1232.28TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf35.580e-1232.28TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf17.889e-1028.76TNF receptor-associated factor 1 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor-associated factor 6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6DJN2|TRF6B_XENLA1.288e-1433.33TNF receptor-associated factor 6-B OS=Xenopus laev... [more]
sp|Q6IWL4|TRAF6_DANRE1.388e-1434.62TNF receptor-associated factor 6 OS=Danio rerio OX... [more]
sp|Q28DL4|TRAF6_XENTR3.565e-1329.22TNF receptor-associated factor 6 OS=Xenopus tropic... [more]
sp|P70196|TRAF6_MOUSE7.246e-1328.10TNF receptor-associated factor 6 OS=Mus musculus O... [more]
sp|B5DF45|TRAF6_RAT1.096e-1228.10TNF receptor-associated factor 6 OS=Rattus norvegi... [more]
back to top
BLAST of TNF receptor-associated factor 6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1E1015.293e-2135.56TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
I1ZID81.312e-2030.07TNF receptor associated factor-2 (Fragment) OS=Sch... [more]
A0A151MBD13.618e-1822.11TNF receptor-associated factor OS=Alligator missis... [more]
A0A1U7RAW42.120e-1721.81TNF receptor-associated factor OS=Alligator sinens... [more]
K7FW051.065e-1621.35TNF receptor-associated factor OS=Pelodiscus sinen... [more]
back to top
BLAST of TNF receptor-associated factor 6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf61.098e-1430.77TNF receptor associated factor 6 [Source:NCBI gene... [more]
traf61.098e-1430.77TNF receptor associated factor 6 [Source:NCBI gene... [more]
traf61.114e-1430.77TNF receptor associated factor 6 [Source:NCBI gene... [more]
ENSAMXT00000035169.11.665e-1132.77pep primary_assembly:Astyanax_mexicanus-2.0:9:3354... [more]
traf52.334e-1121.75TNF receptor-associated factor 5 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor 6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000000074.12.168e-1127.94pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-... [more]
ENSPMAT00000002130.14.136e-1026.32pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 g... [more]
traf66.324e-1023.91TNF receptor-associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor 6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor 6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO494641.307e-1621.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352378.821e-1441.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO406655.454e-1030.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487736.956e-1028.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO438063.097e-824.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor-associated factor 6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf62.354e-1331.17TNF receptor associated factor 6 [Source:NCBI gene... [more]
traf36.109e-1031.09TNF receptor associated factor 3 [Source:NCBI gene... [more]
traf4a1.164e-829.17TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf4a1.218e-829.17TNF receptor associated factor 4 [Source:NCBI gene... [more]
ENSORLT00000001369.22.163e-828.46TNF receptor-associated factor 5 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor 6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000015050.10.000e+086.72SMESG000015050.1[more]
SMESG000000559.12.223e-15753.86SMESG000000559.1[more]
SMESG000000563.13.641e-14951.55SMESG000000563.1[more]
SMESG000016032.12.231e-14853.10SMESG000016032.1[more]
SMESG000000493.14.099e-14855.32SMESG000000493.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022138 ID=SMED30022138|Name=TNF receptor-associated factor 6|organism=Schmidtea mediterranea sexual|type=transcript|length=1549bp
AAACTTTCAAATTTTAATTATTTACGGAAATTATAACTAGAAAAAATAAA
AATGTCTGAAAGCGTTTGGAAGTTTATGAGAGAAAATGAAATAAAAATTT
CGTGTGAAGTTAGCAAAGAATTGCAATGCAAAATCTGTAATAAATTGATG
ATAAAAGCTTGCCATGCTCCTTGCGGATGTCGTTTTTGTTCCGATTGTAT
TCAGCATTATTTGGACGGTAATGATAAATTCTGTCCAGGAACATCAAGAT
ATTGTCAAAACCGAATGATAAATTATGCAAATGACATCGCTATCGATTGG
CCAATCAACATTCGCATATCAGAAATTGTGGTGAATTGCCCGAGGCAAAA
TTGTGAATTCAAGGATGAGTTGCAATTGATAGAGAATCACATGATAACGT
GCAACAAACAGCCAATTAGCTGCCCATTCAACTCCATCGGATGCGGAATG
AATGAAGTGAGGAATGAGGAAATGAAATCACATCTGAATGAGGACATTTA
TTGCCATAGCAAATTGCTGATTGAGTTAATCAATAATTTACGCAATGAAA
TGGAATCAATGAAGAATGAAAATATCGAATTGAGAAATGAAATTCTCGAG
CTGAGAGGAAACAAGCTATTCAATCAACAATTTTATAATATAAATTTGCA
ATTAACAAATCAACAAGAGAAAATACTGGAAATGGGAAGGAGAGAAAAAG
CAAACACGAGAGAAATAGAAGATTTGAAAAGAGAAAATAGTCAAATCAAA
CAACAATTAGACATTATCGAGTTGAAATCAACAAACCAACAACAGGAAAT
GATAAAAATGGAAAAGGAAAACCTTATAAAACAATCGAAAATATTCTCCG
AAAAAACAAATATCGAATCTTACAAAGAAATCGGTGAGGCGATTCCAGCA
AAATTCCAGCAGCAAATCGGTGGAGTGAAATTAGAATATCACCAATGGAA
ACACGATGAGACTAAAGAAAACGAATTATCCGGCGTCAGCAGTGAAATTA
GGAAGTTGGAGAAATATTTGGAAAGTGAAGAAGAAAGCGGAATATTCAAA
TGGAAAATTAAGAATTTTTCACAAAAGATTGGCGAAAGGATTTACAGTAA
GCCATTTTATTCTGGGCGATTTGGATACAAATTGTGTTTGGGGGTGACAT
CTGAGTTGGCCAAGGATTATTTGGTCTATCAGTGTAATGTCTTTGTCAAT
TTACATTTGATGCGAGGAGAATTCGATGAGAATTTGGCTTGGCCATTCAA
AAATTCCGTTAAAATTGATGTGATCGATAGTGAAAACGGTTTCACCTATA
AGACTAAAACGATAAAATATTCGGATTGTCCCGATGATGACGGATGGGGA
AAACCAACGACGGAGAGAAATATTCCGATCAATGTTATTTTTGTGCCATT
CGATTCTCCAGCTGTCAAAAATAACCGATTGGAAATCGAATGCAGAGTTG
TGAAAAAATTATAAAAAAAAATGCAAAAAAAATATTTATAAATTGTTTTA
TTTAAAATATGCAATAATGTGCGTTGTATATAATTAATAAATGCGCTTG
back to top

protein sequence of SMED30022138-orf-1

>SMED30022138-orf-1 ID=SMED30022138-orf-1|Name=SMED30022138-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=471bp
MSESVWKFMRENEIKISCEVSKELQCKICNKLMIKACHAPCGCRFCSDCI
QHYLDGNDKFCPGTSRYCQNRMINYANDIAIDWPINIRISEIVVNCPRQN
CEFKDELQLIENHMITCNKQPISCPFNSIGCGMNEVRNEEMKSHLNEDIY
CHSKLLIELINNLRNEMESMKNENIELRNEILELRGNKLFNQQFYNINLQ
LTNQQEKILEMGRREKANTREIEDLKRENSQIKQQLDIIELKSTNQQQEM
IKMEKENLIKQSKIFSEKTNIESYKEIGEAIPAKFQQQIGGVKLEYHQWK
HDETKENELSGVSSEIRKLEKYLESEEESGIFKWKIKNFSQKIGERIYSK
PFYSGRFGYKLCLGVTSELAKDYLVYQCNVFVNLHLMRGEFDENLAWPFK
NSVKIDVIDSENGFTYKTKTIKYSDCPDDDGWGKPTTERNIPINVIFVPF
DSPAVKNNRLEIECRVVKKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005164tumor necrosis factor receptor binding
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0004842ubiquitin-protein transferase activity
GO:0046872metal ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR008974TRAF-like
IPR013083Znf_RING/FYVE/PHD
IPR002083MATH/TRAF_dom
IPR001841Znf_RING
Vocabulary: biological process
TermDefinition
GO:0006955immune response
GO:0007165signal transduction
GO:0016567protein ubiquitination
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 4..52
e-value: 1.5E-6
score: 30.1
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 10..51