MIP20649p

Overview
NameMIP20649p
Smed IDSMED30022127
Length (bp)4528
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of MIP20649p (SMED30022127) t-SNE clustered cells

Violin plots show distribution of expression levels for MIP20649p (SMED30022127) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of MIP20649p (SMED30022127) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for MIP20649p (SMED30022127) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022127

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 19

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30022127SMESG000075164.1 dd_Smed_v4_13518_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30022127SMESG000075164.1 dd_Smed_v4_13518_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30022127SMESG000075164.1 dd_Smed_v4_6811_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30022127SMESG000075164.1 dd_Smed_v4_6811_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022127SMESG000075164.1 Contig48846newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022127SMESG000075164.1 Contig48846uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022127SMESG000075164.1 Contig40212newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022127SMESG000075164.1 Contig40212uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
enteric muscle cellSMED30022127SMESG000075164.1 dd_Smed_v4_13518_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
dorsal-ventral muscle cellSMED30022127SMESG000075164.1 dd_Smed_v4_6811_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal-ventral muscle cellSMED30022127SMESG000075164.1 dd_Smed_v4_6811_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
enteric muscle cellSMED30022127SMESG000075164.1 dd_Smed_v4_6811_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
enteric muscle cellSMED30022127SMESG000075164.1 dd_Smed_v4_6811_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
pharynx musculatureSMED30022127SMESG000075164.1 dd_Smed_v6_6811_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30022127SMESG000075164.1 dd_Smed_v4_6811_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30022127SMESG000075164.1 dd_Smed_v4_6811_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult fluorescence in situ hybridization evidence
muscle cellSMED30022127SMESG000075164.1 dd_Smed_v4_6811_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
enteric musculatureSMED30022127SMESG000075164.1 dd_Smed_v4_6811_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult fluorescence in situ hybridization evidence
dorsal-ventral muscle cellSMED30022127SMESG000075164.1 dd_Smed_v4_6811_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of MIP20649p vs. Ensembl Human
Match: COL18A1 (collagen type XVIII alpha 1 chain [Source:HGNC Symbol;Acc:HGNC:2195])

HSP 1 Score: 68.1662 bits (165), Expect = 1.091e-10
Identity = 69/280 (24.64%), Postives = 113/280 (40.36%), Query Frame = 1
Query: 3721 RELLEQTSNRLPAGSMVYISQSDIFLIKIDQSNNVWRTISMEPKSRTW----ILPIPMNIPK--------HETTY----------PPYQN--GFSKKLHLIALITPTMGDLKPMLRQPGGYSGAAFQCQQAGEMYGYGRFMHPFINTDPFHLKFSINQK--HMNLPIYNSRGETLASNFNALLSGND---DLQNEILDFKKEPISRDIL--SQCVWLGKEPSGNDIEYNVKTESRCVNWMSREPHIHGLAAFINSTKSLFDEYNRGLLSCSRQCYVLCIQ 4467
            R++  +    LP G+   ++     ++++  SN   R     P +R W    IL  P  +P+        H ++Y          PP  +   F   LHL+AL +P  G ++       G  GA FQC Q     G       F+++      +SI ++     +PI N + E L  ++ AL SG++        I  F  + + R      + VW G +P+G  +     TES C  W +  P   G A+ +   + L     +   SC     VLCI+
Sbjct:  417 RKVQLEARTPLPRGTDNEVAALQPPVVQLHDSNPYPRREHPHPTARPWRADDILASPPRLPEPQPYPGAPHHSSYVHLRPARPTSPPAHSHRDFQPVLHLVALNSPLSGGMR-------GIRGADFQCFQQARAVGLAGTFRAFLSSR-LQDLYSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHPTWPQKSVWHGSDPNGRRL-----TESYCETWRTEAPSATGQASSLLGGRLL----GQSAASCHHAYIVLCIE 679          
BLAST of MIP20649p vs. Ensembl Human
Match: COL18A1 (collagen type XVIII alpha 1 chain [Source:HGNC Symbol;Acc:HGNC:2195])

HSP 1 Score: 68.1662 bits (165), Expect = 1.233e-10
Identity = 69/280 (24.64%), Postives = 113/280 (40.36%), Query Frame = 1
Query: 3721 RELLEQTSNRLPAGSMVYISQSDIFLIKIDQSNNVWRTISMEPKSRTW----ILPIPMNIPK--------HETTY----------PPYQN--GFSKKLHLIALITPTMGDLKPMLRQPGGYSGAAFQCQQAGEMYGYGRFMHPFINTDPFHLKFSINQK--HMNLPIYNSRGETLASNFNALLSGND---DLQNEILDFKKEPISRDIL--SQCVWLGKEPSGNDIEYNVKTESRCVNWMSREPHIHGLAAFINSTKSLFDEYNRGLLSCSRQCYVLCIQ 4467
            R++  +    LP G+   ++     ++++  SN   R     P +R W    IL  P  +P+        H ++Y          PP  +   F   LHL+AL +P  G ++       G  GA FQC Q     G       F+++      +SI ++     +PI N + E L  ++ AL SG++        I  F  + + R      + VW G +P+G  +     TES C  W +  P   G A+ +   + L     +   SC     VLCI+
Sbjct: 1069 RKVQLEARTPLPRGTDNEVAALQPPVVQLHDSNPYPRREHPHPTARPWRADDILASPPRLPEPQPYPGAPHHSSYVHLRPARPTSPPAHSHRDFQPVLHLVALNSPLSGGMR-------GIRGADFQCFQQARAVGLAGTFRAFLSSR-LQDLYSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHPTWPQKSVWHGSDPNGRRL-----TESYCETWRTEAPSATGQASSLLGGRLL----GQSAASCHHAYIVLCIE 1331          
BLAST of MIP20649p vs. Ensembl Human
Match: COL18A1 (collagen type XVIII alpha 1 chain [Source:HGNC Symbol;Acc:HGNC:2195])

HSP 1 Score: 57.7658 bits (138), Expect = 2.008e-7
Identity = 70/280 (25.00%), Postives = 114/280 (40.71%), Query Frame = 1
Query: 3721 RELLEQTSNRLPAGSMVYISQSDIFLIKIDQSNNVWRTISMEPKSRTW----ILPIPMNIPK--------HETTY----------PPYQN--GFSKKLHLIALITPTMGDLKPMLRQPGGYSGAAFQCQQAGEMYGYGRFMHPFINTDPFHLKFSINQK--HMNLPIYNSRGETLASNFNALLSGNDDLQN---EILDFKKEPISRDIL--SQCVWLGKEPSGNDIEYNVKTESRCVNWMSREPHIHGLAAFINSTKSLFDEYNRGLLSCSRQCYVLCIQ 4467
            R++  +    LP G+   ++     ++++  SN   R     P +R W    IL  P  +P+        H ++Y          PP  +   F   LHL+AL +P  G ++       G  GA FQC Q     G       F+++    L +SI ++     +PI N + E L  ++ AL SG++        I  F  + + R      + VW G +P+G  +     TES C  W +  P   G A+ +   + L     +   SC     VLCI+
Sbjct: 1484 RKVQLEARTPLPRGTDNEVAALQPPVVQLHDSNPYPRREHPHPTARPWRADDILASPPRLPEPQPYPGAPHHSSYVHLRPARPTSPPAHSHRDFQPVLHLVALNSPLSGGMR-------GIRGADFQCFQQARAVGLAGTFRAFLSSRLQDL-YSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHPTWPQKSVWHGSDPNGRRL-----TESYCETWRTEAPSATGQASSLLGGRLL----GQSAASCHHAYIVLCIE 1746          
BLAST of MIP20649p vs. Ensembl Human
Match: COL18A1 (collagen type XVIII alpha 1 chain [Source:HGNC Symbol;Acc:HGNC:2195])

HSP 1 Score: 57.3806 bits (137), Expect = 2.589e-7
Identity = 70/280 (25.00%), Postives = 114/280 (40.71%), Query Frame = 1
Query: 3721 RELLEQTSNRLPAGSMVYISQSDIFLIKIDQSNNVWRTISMEPKSRTW----ILPIPMNIPK--------HETTY----------PPYQN--GFSKKLHLIALITPTMGDLKPMLRQPGGYSGAAFQCQQAGEMYGYGRFMHPFINTDPFHLKFSINQK--HMNLPIYNSRGETLASNFNALLSGNDDLQN---EILDFKKEPISRDIL--SQCVWLGKEPSGNDIEYNVKTESRCVNWMSREPHIHGLAAFINSTKSLFDEYNRGLLSCSRQCYVLCIQ 4467
            R++  +    LP G+   ++     ++++  SN   R     P +R W    IL  P  +P+        H ++Y          PP  +   F   LHL+AL +P  G ++       G  GA FQC Q     G       F+++    L +SI ++     +PI N + E L  ++ AL SG++        I  F  + + R      + VW G +P+G  +     TES C  W +  P   G A+ +   + L     +   SC     VLCI+
Sbjct: 1249 RKVQLEARTPLPRGTDNEVAALQPPVVQLHDSNPYPRREHPHPTARPWRADDILASPPRLPEPQPYPGAPHHSSYVHLRPARPTSPPAHSHRDFQPVLHLVALNSPLSGGMR-------GIRGADFQCFQQARAVGLAGTFRAFLSSRLQDL-YSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHPTWPQKSVWHGSDPNGRRL-----TESYCETWRTEAPSATGQASSLLGGRLL----GQSAASCHHAYIVLCIE 1511          
BLAST of MIP20649p vs. Ensembl Fly
Match: Mp (gene:FBgn0260660 transcript:FBtr0339904)

HSP 1 Score: 72.4034 bits (176), Expect = 2.863e-12
Identity = 101/457 (22.10%), Postives = 172/457 (37.64%), Query Frame = 1
Query: 3274 GAKGEMGLKGDIGEKGDRGPSGINGVCDASICSVNLPSKGDKGDPGQCNKSQCLVIKGERGPIGLKGDMGQKGERGESNDINIELIRYLTHSIIKAQIESMTLFQNG-KGEKGEPG----------ACKCAQKVPDKSFNANDIYEE-------------------NVNIGYGSLVFETRELLEQTSNRLPAGSMVYISQSDIFLIKIDQSNNVWRTISM-------EPKSRTWILPIP----------------MNIPKHETTYPPYQNGFSKKLHLIALITPTMGDLKPMLRQPGGYSGAAFQCQQAGEMYGYGRFMHPFINTDPFHLKFSINQKHMNLPIYNSRGETLASNFNALLSGNDDLQNE---ILDFKKEPISRDIL--SQCVWLGKEPSGNDIEYNVKTESRCVNWMSREPHIHGLAAFINSTKSLFDEYNRGLLSCSRQCYVLCIQT 4470
            G  G  G+ G  GE G +GP G +G  +          KGDKGD GQ  +       G  GP GL              D +   ++Y+             L      G KGEPG          A    +  P +    +  +EE                   N+ I  G++ F+  + + + S   P G++ YI++ +  L+++   N  W+ I++        P   T + P                  +N P   TT P Y+  + + L + AL  P+ GDL+       G  GA F C + G   G       F+++   +L   +     +LP+ N+RG+ L +++  + +G     ++   I  F  + +  D     + VW G  P+G         ++ C  W S + H+ G  A       L ++  +   SC  +  +LC++ 
Sbjct:  567 GHSGRPGMTGPKGEMGPKGPKGDSGGREGL--------KGDKGDRGQDGRD------GLPGPPGLPSTG--------GGDGDSGGVQYIPMPGPPGPPGPPGLPGLSISGPKGEPGVDSRSSFFGDASYYGRPEPPRQPGHSHKHEETLGLVDGEEPYFSASSSNMNMKIVPGAVTFQNIDEMTKKSALNPPGTLAYITEEEALLVRV---NKGWQYIALGTLVPIATPAPPTTVAPSMRFDLQSKNLLNSPPPLLNTPTF-TTAPEYETWYPRMLRVAALNEPSTGDLQ-------GIRGADFACYRQGRRAGLLGTFKAFLSSRVQNLDTIVRPADRDLPVVNTRGDVLFNSWKGIFNGQGGFFSQAPRIYSFSGKNVMTDSTWPMKMVWHGSLPNGER-----SMDTYCDAWHSGD-HLKGSFASNLDGHKLLEQKRQ---SCDSKLIILCVEA 981          
BLAST of MIP20649p vs. Ensembl Fly
Match: Mp (gene:FBgn0260660 transcript:FBtr0301958)

HSP 1 Score: 72.0182 bits (175), Expect = 3.163e-12
Identity = 101/457 (22.10%), Postives = 172/457 (37.64%), Query Frame = 1
Query: 3274 GAKGEMGLKGDIGEKGDRGPSGINGVCDASICSVNLPSKGDKGDPGQCNKSQCLVIKGERGPIGLKGDMGQKGERGESNDINIELIRYLTHSIIKAQIESMTLFQNG-KGEKGEPG----------ACKCAQKVPDKSFNANDIYEE-------------------NVNIGYGSLVFETRELLEQTSNRLPAGSMVYISQSDIFLIKIDQSNNVWRTISM-------EPKSRTWILPIP----------------MNIPKHETTYPPYQNGFSKKLHLIALITPTMGDLKPMLRQPGGYSGAAFQCQQAGEMYGYGRFMHPFINTDPFHLKFSINQKHMNLPIYNSRGETLASNFNALLSGNDDLQNE---ILDFKKEPISRDIL--SQCVWLGKEPSGNDIEYNVKTESRCVNWMSREPHIHGLAAFINSTKSLFDEYNRGLLSCSRQCYVLCIQT 4470
            G  G  G+ G  GE G +GP G +G  +          KGDKGD GQ  +       G  GP GL              D +   ++Y+             L      G KGEPG          A    +  P +    +  +EE                   N+ I  G++ F+  + + + S   P G++ YI++ +  L+++   N  W+ I++        P   T + P                  +N P   TT P Y+  + + L + AL  P+ GDL+       G  GA F C + G   G       F+++   +L   +     +LP+ N+RG+ L +++  + +G     ++   I  F  + +  D     + VW G  P+G         ++ C  W S + H+ G  A       L ++  +   SC  +  +LC++ 
Sbjct:  337 GHSGRPGMTGPKGEMGPKGPKGDSGGREGL--------KGDKGDRGQDGRD------GLPGPPGLPSTG--------GGDGDSGGVQYIPMPGPPGPPGPPGLPGLSISGPKGEPGVDSRSSFFGDASYYGRPEPPRQPGHSHKHEETLGLVDGEEPYFSASSSNMNMKIVPGAVTFQNIDEMTKKSALNPPGTLAYITEEEALLVRV---NKGWQYIALGTLVPIATPAPPTTVAPSMRFDLQSKNLLNSPPPLLNTPTF-TTAPEYETWYPRMLRVAALNEPSTGDLQ-------GIRGADFACYRQGRRAGLLGTFKAFLSSRVQNLDTIVRPADRDLPVVNTRGDVLFNSWKGIFNGQGGFFSQAPRIYSFSGKNVMTDSTWPMKMVWHGSLPNGER-----SMDTYCDAWHSGD-HLKGSFASNLDGHKLLEQKRQ---SCDSKLIILCVEA 751          
BLAST of MIP20649p vs. Ensembl Fly
Match: Mp (gene:FBgn0260660 transcript:FBtr0306638)

HSP 1 Score: 67.3958 bits (163), Expect = 9.521e-11
Identity = 98/447 (21.92%), Postives = 169/447 (37.81%), Query Frame = 1
Query: 3274 GAKGEMGLKGDIGEKGDRGPSGINGVCDASICSVNLPSKGDKGDPGQCNKSQCLVIKGERGPIGLKGDMGQKGERGESNDINIELIRYLTHSIIKAQIESMTLFQNG-KGEKGEPG----------ACKCAQKVPDKSFNANDIYEE-------------------NVNIGYGSLVFETRELLEQTSNRLPAGSMVYISQSDIFLIKIDQSNNVWRTISM-------EPKSRTWILP---IPMNIPKHETTYPPYQNG---FSKKLHLIALITPTMGDLKPMLRQPGGYSGAAFQCQQAGEMYGYGRFMHPFINTDPFHLKFSINQKHMNLPIYNSRGETLASNFNALLSGNDDLQNE---ILDFKKEPISRDIL--SQCVWLGKEPSGNDIEYNVKTESRCVNWMSREPHIHGLAAFINSTKSLFDEYNRGLLSCSRQCYVLCIQT 4470
            G  G  G+ G  GE G +GP G +G  +          KGDKGD GQ  +       G  GP GL              D +   ++Y+             L      G KGEPG          A    +  P +    +  +EE                   N+ I  G++ F+  + + + S   P G++ YI++ +  L+++   N  W+ I++        P   T + P     +       + PP  N    + + L + AL  P+ GDL+       G  GA F C + G   G       F+++   +L   +     +LP+ N+RG+ L +++  + +G     ++   I  F  + +  D     + VW G  P+G         ++ C  W S + H+ G  A       L ++  +   SC  +  +LC++ 
Sbjct:  567 GHSGRPGMTGPKGEMGPKGPKGDSGGREGL--------KGDKGDRGQDGRD------GLPGPPGLPSTG--------GGDGDSGGVQYIPMPGPPGPPGPPGLPGLSISGPKGEPGVDSRSSFFGDASYYGRPEPPRQPGHSHKHEETLGLVDGEEPYFSASSSNMNMKIVPGAVTFQNIDEMTKKSALNPPGTLAYITEEEALLVRV---NKGWQYIALGTLVPIATPAPPTTVAPSMRFDLQSKNLLNSPPPLLNTPTWYPRMLRVAALNEPSTGDLQ-------GIRGADFACYRQGRRAGLLGTFKAFLSSRVQNLDTIVRPADRDLPVVNTRGDVLFNSWKGIFNGQGGFFSQAPRIYSFSGKNVMTDSTWPMKMVWHGSLPNGER-----SMDTYCDAWHSGD-HLKGSFASNLDGHKLLEQKRQ---SCDSKLIILCVEA 972          
BLAST of MIP20649p vs. Ensembl Fly
Match: Mp (gene:FBgn0260660 transcript:FBtr0339905)

HSP 1 Score: 67.3958 bits (163), Expect = 9.861e-11
Identity = 98/444 (22.07%), Postives = 168/444 (37.84%), Query Frame = 1
Query: 3274 GAKGEMGLKGDIGEKGDRGPSGINGVCDASICSVNLPSKGDKGDPGQCNKSQCLVIKGERGPIGLKGDMGQKGERGESNDINIELIRYLTHSIIKAQIESMTLFQNG-KGEKGEPG----------ACKCAQKVPDKSFNANDIYEE-------------------NVNIGYGSLVFETRELLEQTSNRLPAGSMVYISQSDIFLIKIDQSNNVWRTISM-------EPKSRTWILP---IPMNIPKHETTYPPYQNGFSKKLHLIALITPTMGDLKPMLRQPGGYSGAAFQCQQAGEMYGYGRFMHPFINTDPFHLKFSINQKHMNLPIYNSRGETLASNFNALLSGNDDLQNE---ILDFKKEPISRDIL--SQCVWLGKEPSGNDIEYNVKTESRCVNWMSREPHIHGLAAFINSTKSLFDEYNRGLLSCSRQCYVLCIQT 4470
            G  G  G+ G  GE G +GP G +G  +          KGDKGD GQ  +       G  GP GL              D +   ++Y+             L      G KGEPG          A    +  P +    +  +EE                   N+ I  G++ F+  + + + S   P G++ YI++ +  L+++   N  W+ I++        P   T + P     +       + PP  N  +  L + AL  P+ GDL+       G  GA F C + G   G       F+++   +L   +     +LP+ N+RG+ L +++  + +G     ++   I  F  + +  D     + VW G  P+G         ++ C  W S + H+ G  A       L ++  +   SC  +  +LC++ 
Sbjct:  532 GHSGRPGMTGPKGEMGPKGPKGDSGGREGL--------KGDKGDRGQDGRD------GLPGPPGLPSTG--------GGDGDSGGVQYIPMPGPPGPPGPPGLPGLSISGPKGEPGVDSRSSFFGDASYYGRPEPPRQPGHSHKHEETLGLVDGEEPYFSASSSNMNMKIVPGAVTFQNIDEMTKKSALNPPGTLAYITEEEALLVRV---NKGWQYIALGTLVPIATPAPPTTVAPSMRFDLQSKNLLNSPPPLLN--TPTLRVAALNEPSTGDLQ-------GIRGADFACYRQGRRAGLLGTFKAFLSSRVQNLDTIVRPADRDLPVVNTRGDVLFNSWKGIFNGQGGFFSQAPRIYSFSGKNVMTDSTWPMKMVWHGSLPNGER-----SMDTYCDAWHSGD-HLKGSFASNLDGHKLLEQKRQ---SCDSKLIILCVEA 932          
BLAST of MIP20649p vs. Ensembl Fly
Match: Mp (gene:FBgn0260660 transcript:FBtr0301108)

HSP 1 Score: 67.3958 bits (163), Expect = 1.014e-10
Identity = 98/447 (21.92%), Postives = 169/447 (37.81%), Query Frame = 1
Query: 3274 GAKGEMGLKGDIGEKGDRGPSGINGVCDASICSVNLPSKGDKGDPGQCNKSQCLVIKGERGPIGLKGDMGQKGERGESNDINIELIRYLTHSIIKAQIESMTLFQNG-KGEKGEPG----------ACKCAQKVPDKSFNANDIYEE-------------------NVNIGYGSLVFETRELLEQTSNRLPAGSMVYISQSDIFLIKIDQSNNVWRTISM-------EPKSRTWILP---IPMNIPKHETTYPPYQNG---FSKKLHLIALITPTMGDLKPMLRQPGGYSGAAFQCQQAGEMYGYGRFMHPFINTDPFHLKFSINQKHMNLPIYNSRGETLASNFNALLSGNDDLQNE---ILDFKKEPISRDIL--SQCVWLGKEPSGNDIEYNVKTESRCVNWMSREPHIHGLAAFINSTKSLFDEYNRGLLSCSRQCYVLCIQT 4470
            G  G  G+ G  GE G +GP G +G  +          KGDKGD GQ  +       G  GP GL              D +   ++Y+             L      G KGEPG          A    +  P +    +  +EE                   N+ I  G++ F+  + + + S   P G++ YI++ +  L+++   N  W+ I++        P   T + P     +       + PP  N    + + L + AL  P+ GDL+       G  GA F C + G   G       F+++   +L   +     +LP+ N+RG+ L +++  + +G     ++   I  F  + +  D     + VW G  P+G         ++ C  W S + H+ G  A       L ++  +   SC  +  +LC++ 
Sbjct:  577 GHSGRPGMTGPKGEMGPKGPKGDSGGREGL--------KGDKGDRGQDGRD------GLPGPPGLPSTG--------GGDGDSGGVQYIPMPGPPGPPGPPGLPGLSISGPKGEPGVDSRSSFFGDASYYGRPEPPRQPGHSHKHEETLGLVDGEEPYFSASSSNMNMKIVPGAVTFQNIDEMTKKSALNPPGTLAYITEEEALLVRV---NKGWQYIALGTLVPIATPAPPTTVAPSMRFDLQSKNLLNSPPPLLNTPTWYPRMLRVAALNEPSTGDLQ-------GIRGADFACYRQGRRAGLLGTFKAFLSSRVQNLDTIVRPADRDLPVVNTRGDVLFNSWKGIFNGQGGFFSQAPRIYSFSGKNVMTDSTWPMKMVWHGSLPNGER-----SMDTYCDAWHSGD-HLKGSFASNLDGHKLLEQKRQ---SCDSKLIILCVEA 982          
BLAST of MIP20649p vs. Ensembl Zebrafish
Match: col15a1b (collagen, type XV, alpha 1b [Source:ZFIN;Acc:ZDB-GENE-070912-689])

HSP 1 Score: 60.8474 bits (146), Expect = 1.276e-8
Identity = 50/181 (27.62%), Postives = 78/181 (43.09%), Query Frame = 1
Query: 3940 LHLIALITPTMGDLKPMLRQPGGYSGAAFQCQQAGEMYGYGRFMHPFINTDPFHLKFSINQK-HMNLPIYNSRGETLASNFNALLSGND---DLQNEILDFKKEPISRDILSQCVWLGKEPSGNDIEYNVK-TESRCVNWMSREPHIHGLAAFINSTKSLFDEYNRGLLSCSRQCYVLCIQ 4467
            LHL+AL  P  GD+        G  GA +QC Q     G       F+++    L   + +    NLP+ N +GE L S++ A+ SGN    D    I  F      R++L+   W  K          ++ T + C  W + +  + G A+ +  T  L  ++ R   SCS    +LCI+
Sbjct: 1070 LHLVALNAPFSGDMH-------GIRGADYQCYQQARARGLTSTYRAFLSSHLQDLSTIVKKADRFNLPVVNLKGEVLFSSWMAMFSGNGGVFDPLTPIYSFD----GRNVLTDQAWSQKLVWHGSSTVGIRMTTNYCEAWRTGDMAVTGQASLLQ-TGRLLGQHTR---SCSNHFIILCIE 1235          
BLAST of MIP20649p vs. Ensembl Zebrafish
Match: col15a1b (collagen, type XV, alpha 1b [Source:ZFIN;Acc:ZDB-GENE-070912-689])

HSP 1 Score: 60.8474 bits (146), Expect = 1.288e-8
Identity = 50/181 (27.62%), Postives = 78/181 (43.09%), Query Frame = 1
Query: 3940 LHLIALITPTMGDLKPMLRQPGGYSGAAFQCQQAGEMYGYGRFMHPFINTDPFHLKFSINQK-HMNLPIYNSRGETLASNFNALLSGND---DLQNEILDFKKEPISRDILSQCVWLGKEPSGNDIEYNVK-TESRCVNWMSREPHIHGLAAFINSTKSLFDEYNRGLLSCSRQCYVLCIQ 4467
            LHL+AL  P  GD+        G  GA +QC Q     G       F+++    L   + +    NLP+ N +GE L S++ A+ SGN    D    I  F      R++L+   W  K          ++ T + C  W + +  + G A+ +  T  L  ++ R   SCS    +LCI+
Sbjct:  995 LHLVALNAPFSGDMH-------GIRGADYQCYQQARARGLTSTYRAFLSSHLQDLSTIVKKADRFNLPVVNLKGEVLFSSWMAMFSGNGGVFDPLTPIYSFD----GRNVLTDQAWSQKLVWHGSSTVGIRMTTNYCEAWRTGDMAVTGQASLLQ-TGRLLGQHTR---SCSNHFIILCIE 1160          
BLAST of MIP20649p vs. Ensembl Zebrafish
Match: col15a1b (collagen, type XV, alpha 1b [Source:ZFIN;Acc:ZDB-GENE-070912-689])

HSP 1 Score: 60.8474 bits (146), Expect = 1.321e-8
Identity = 50/181 (27.62%), Postives = 78/181 (43.09%), Query Frame = 1
Query: 3940 LHLIALITPTMGDLKPMLRQPGGYSGAAFQCQQAGEMYGYGRFMHPFINTDPFHLKFSINQK-HMNLPIYNSRGETLASNFNALLSGND---DLQNEILDFKKEPISRDILSQCVWLGKEPSGNDIEYNVK-TESRCVNWMSREPHIHGLAAFINSTKSLFDEYNRGLLSCSRQCYVLCIQ 4467
            LHL+AL  P  GD+        G  GA +QC Q     G       F+++    L   + +    NLP+ N +GE L S++ A+ SGN    D    I  F      R++L+   W  K          ++ T + C  W + +  + G A+ +  T  L  ++ R   SCS    +LCI+
Sbjct:  995 LHLVALNAPFSGDMH-------GIRGADYQCYQQARARGLTSTYRAFLSSHLQDLSTIVKKADRFNLPVVNLKGEVLFSSWMAMFSGNGGVFDPLTPIYSFD----GRNVLTDQAWSQKLVWHGSSTVGIRMTTNYCEAWRTGDMAVTGQASLLQ-TGRLLGQHTR---SCSNHFIILCIE 1160          
BLAST of MIP20649p vs. Ensembl Zebrafish
Match: otol1b (otolin 1b [Source:ZFIN;Acc:ZDB-GENE-080416-3])

HSP 1 Score: 55.4546 bits (132), Expect = 3.938e-7
Identity = 47/130 (36.15%), Postives = 59/130 (45.38%), Query Frame = 1
Query: 3271 KGAKGEMGLKGDIGEKGDRGPSGINGVCDASICSVNLPSKGDKGDPGQCNKSQCLVIKGERGPIGLKGDMGQ------------KGERGESNDINIELIRYLTHSIIKAQIESMTLFQNGKGEKGEPGAC 3624
            +G KG+MGL G  GEKG  GPSG+ G         N  SKGDKG+ G    +      G +G  G+KG+MG             KGE+GE  D N  + +       K  +         KGEKGE G C
Sbjct:  137 QGFKGDMGLPGPPGEKGAPGPSGLPGPIGP---KGNSGSKGDKGEKGDQGNTGFAGTPGNQGKAGMKGEMGNKGEKGAAGLPGFKGEKGEKGDPNFNVSKGDQGEPGKDGLPGPQGSAGEKGEKGERGEC 263          
BLAST of MIP20649p vs. Ensembl Xenopus
Match: COL18A1 (collagen type XVIII alpha 1 [Source:NCBI gene;Acc:394845])

HSP 1 Score: 58.5362 bits (140), Expect = 1.057e-7
Identity = 52/187 (27.81%), Postives = 83/187 (44.39%), Query Frame = 1
Query: 3928 FSKKLHLIALITPTMGDLKPMLRQPGGYSGAAFQCQQAGEMYGYGRFMHPFINTDPFHLKFSINQK--HMNLPIYNSRGETLASNFNALLSGNDDLQN---EILDFKKEPISRDIL--SQCVWLGKEPSGNDIEYNVKTESRCVNWMSREPHIHGLAAFINSTKSLFDEYNRGLLSCSRQCYVLCIQ 4467
            F+  LHL+AL TP  G +K +        G  FQC +     G       F+++    L +SI ++    ++ I N R E L  N+ +L SG++        I  F  + ++ D     + VW G +  G  +     TES C  W + E  + G A+ + S K L     +   SC++   VLCI+
Sbjct:  959 FNPVLHLVALNTPLSGSMKSI-------RGVDFQCFEQARKAGLHGTFRAFLSSRLQDL-YSIVRRADRQSVQIVNLRDEVLFDNWESLFSGSEAQMRPGASIFSFDGKDVATDPTWPQKMVWHGSDSKGRRL-----TESYCETWRTDEGAVTGQASSLTSGKLL----EQRPQSCNKNFIVLCIE 1128          
BLAST of MIP20649p vs. Ensembl Xenopus
Match: COL18A1 (collagen type XVIII alpha 1 [Source:NCBI gene;Acc:394845])

HSP 1 Score: 58.151 bits (139), Expect = 1.468e-7
Identity = 52/187 (27.81%), Postives = 82/187 (43.85%), Query Frame = 1
Query: 3928 FSKKLHLIALITPTMGDLKPMLRQPGGYSGAAFQCQQAGEMYGYGRFMHPFINTDPFHLKFSINQK--HMNLPIYNSRGETLASNFNALLSGNDDLQN---EILDFKKEPISRDIL--SQCVWLGKEPSGNDIEYNVKTESRCVNWMSREPHIHGLAAFINSTKSLFDEYNRGLLSCSRQCYVLCIQ 4467
            F+  LHL+AL TP  G +K +        G  FQC +     G       F+++    L +SI ++    ++ I N R E L  N+ +L SG++        I  F  + ++ D     + VW G +  G  +     TES C  W + E  + G A+ + S K L         SC++   VLCI+
Sbjct: 1123 FNPVLHLVALNTPLSGSMKSI-------RGVDFQCFEQARKAGLHGTFRAFLSSRLQDL-YSIVRRADRQSVQIVNLRDEVLFDNWESLFSGSEAQMRPGASIFSFDGKDVATDPTWPQKMVWHGSDSKGRRL-----TESYCETWRTDEGAVTGQASSLTSGKLLEQRPQ----SCNKNFIVLCIE 1292          
BLAST of MIP20649p vs. Ensembl Xenopus
Match: COL18A1 (collagen type XVIII alpha 1 [Source:NCBI gene;Acc:394845])

HSP 1 Score: 58.151 bits (139), Expect = 1.581e-7
Identity = 52/187 (27.81%), Postives = 82/187 (43.85%), Query Frame = 1
Query: 3928 FSKKLHLIALITPTMGDLKPMLRQPGGYSGAAFQCQQAGEMYGYGRFMHPFINTDPFHLKFSINQK--HMNLPIYNSRGETLASNFNALLSGNDDLQN---EILDFKKEPISRDIL--SQCVWLGKEPSGNDIEYNVKTESRCVNWMSREPHIHGLAAFINSTKSLFDEYNRGLLSCSRQCYVLCIQ 4467
            F+  LHL+AL TP  G +K +        G  FQC +     G       F+++    L +SI ++    ++ I N R E L  N+ +L SG++        I  F  + ++ D     + VW G +  G  +     TES C  W + E  + G A+ + S K L         SC++   VLCI+
Sbjct: 1111 FNPVLHLVALNTPLSGSMKSI-------RGVDFQCFEQARKAGLHGTFRAFLSSRLQDL-YSIVRRADRQSVQIVNLRDEVLFDNWESLFSGSEAQMRPGASIFSFDGKDVATDPTWPQKMVWHGSDSKGRRL-----TESYCETWRTDEGAVTGQASSLTSGKLLEQRPQ----SCNKNFIVLCIE 1280          
BLAST of MIP20649p vs. Ensembl Xenopus
Match: COL18A1 (collagen type XVIII alpha 1 [Source:NCBI gene;Acc:394845])

HSP 1 Score: 57.3806 bits (137), Expect = 2.251e-7
Identity = 52/187 (27.81%), Postives = 85/187 (45.45%), Query Frame = 1
Query: 3928 FSKKLHLIALITPTMGDLKPMLRQPGGYSGAAFQCQQAGEMYGYGRFMHPFINTDPFHLKFSINQK--HMNLPIYNSRGETLASNFNALLSGNDDLQN---EILDFKKEPISRDIL--SQCVWLGKEPSGNDIEYNVKTESRCVNWMSREPHIHGLAAFINSTKSLFDEYNRGLLSCSRQCYVLCIQ 4467
            F+  LHL+AL TP  G +K +        G  FQC +     G       F+++    L +SI ++    ++ I N R E L  N+ +L SG++        I  F  + ++ D     + VW G +  G  +     TES C  W + E  + G A+ + S K L ++  +   SC++   VLCI+
Sbjct: 1419 FNPVLHLVALNTPLSGSMKSI-------RGVDFQCFEQARKAGLHGTFRAFLSSRLQDL-YSIVRRADRQSVQIVNLRDEVLFDNWESLFSGSEAQMRPGASIFSFDGKDVATDPTWPQKMVWHGSDSKGRRL-----TESYCETWRTDEGAVTGQASSLTSGK-LLEQRPQ---SCNKNFIVLCIE 1588          
BLAST of MIP20649p vs. Ensembl Xenopus
Match: COL18A1 (collagen type XVIII alpha 1 [Source:NCBI gene;Acc:394845])

HSP 1 Score: 57.3806 bits (137), Expect = 2.306e-7
Identity = 52/187 (27.81%), Postives = 85/187 (45.45%), Query Frame = 1
Query: 3928 FSKKLHLIALITPTMGDLKPMLRQPGGYSGAAFQCQQAGEMYGYGRFMHPFINTDPFHLKFSINQK--HMNLPIYNSRGETLASNFNALLSGNDDLQN---EILDFKKEPISRDIL--SQCVWLGKEPSGNDIEYNVKTESRCVNWMSREPHIHGLAAFINSTKSLFDEYNRGLLSCSRQCYVLCIQ 4467
            F+  LHL+AL TP  G +K +        G  FQC +     G       F+++    L +SI ++    ++ I N R E L  N+ +L SG++        I  F  + ++ D     + VW G +  G  +     TES C  W + E  + G A+ + S K L ++  +   SC++   VLCI+
Sbjct: 1410 FNPVLHLVALNTPLSGSMKSI-------RGVDFQCFEQARKAGLHGTFRAFLSSRLQDL-YSIVRRADRQSVQIVNLRDEVLFDNWESLFSGSEAQMRPGASIFSFDGKDVATDPTWPQKMVWHGSDSKGRRL-----TESYCETWRTDEGAVTGQASSLTSGK-LLEQRPQ---SCNKNFIVLCIE 1579          
BLAST of MIP20649p vs. Ensembl Mouse
Match: Col15a1 (collagen, type XV, alpha 1 [Source:MGI Symbol;Acc:MGI:88449])

HSP 1 Score: 59.6918 bits (143), Expect = 2.213e-8
Identity = 48/186 (25.81%), Postives = 83/186 (44.62%), Query Frame = 1
Query: 3940 LHLIALITPTMGDLKPMLRQPGGYSGAAFQCQQAGEMYGYGRFMHPFINTDPFHLKFSINQ-KHMNLPIYNSRGETLASNFNALLSGNDDLQNE---ILDFKKEPISRDILS------QCVWLGKEPSGNDIEYNVKTESRCVNWMSREPHIHGLAAFINSTKSLFDEYNRGLLSCSRQCYVLCIQ 4467
            LHL+AL TP  GD++           A FQC Q     G       F+++    L   + + +   LPI N +G+ L +N++++ SG+    N    I  F      RD+++      + VW G  P G  +      +  C  W + +  + G A+ +++ K L    ++   SC+ +  VLCI+
Sbjct:  363 LHLVALNTPVAGDIR-----------ADFQCFQQARAAGLLSTFRAFLSSHLQDLSTVVRKAERFGLPIVNLKGQVLFNNWDSIFSGDGGQFNTHIPIYSFD----GRDVMTDPSWPQKVVWHGSNPHGVRL-----VDKYCEAWRTTDMAVTGFASPLSTGKIL----DQKAYSCANRLIVLCIE 524          
BLAST of MIP20649p vs. Ensembl Mouse
Match: Col15a1 (collagen, type XV, alpha 1 [Source:MGI Symbol;Acc:MGI:88449])

HSP 1 Score: 60.077 bits (144), Expect = 2.417e-8
Identity = 48/186 (25.81%), Postives = 83/186 (44.62%), Query Frame = 1
Query: 3940 LHLIALITPTMGDLKPMLRQPGGYSGAAFQCQQAGEMYGYGRFMHPFINTDPFHLKFSINQ-KHMNLPIYNSRGETLASNFNALLSGNDDLQNE---ILDFKKEPISRDILS------QCVWLGKEPSGNDIEYNVKTESRCVNWMSREPHIHGLAAFINSTKSLFDEYNRGLLSCSRQCYVLCIQ 4467
            LHL+AL TP  GD++           A FQC Q     G       F+++    L   + + +   LPI N +G+ L +N++++ SG+    N    I  F      RD+++      + VW G  P G  +      +  C  W + +  + G A+ +++ K L    ++   SC+ +  VLCI+
Sbjct: 1197 LHLVALNTPVAGDIR-----------ADFQCFQQARAAGLLSTFRAFLSSHLQDLSTVVRKAERFGLPIVNLKGQVLFNNWDSIFSGDGGQFNTHIPIYSFD----GRDVMTDPSWPQKVVWHGSNPHGVRL-----VDKYCEAWRTTDMAVTGFASPLSTGKIL----DQKAYSCANRLIVLCIE 1358          
BLAST of MIP20649p vs. Ensembl Mouse
Match: Col15a1 (collagen, type XV, alpha 1 [Source:MGI Symbol;Acc:MGI:88449])

HSP 1 Score: 60.077 bits (144), Expect = 2.512e-8
Identity = 48/186 (25.81%), Postives = 83/186 (44.62%), Query Frame = 1
Query: 3940 LHLIALITPTMGDLKPMLRQPGGYSGAAFQCQQAGEMYGYGRFMHPFINTDPFHLKFSINQ-KHMNLPIYNSRGETLASNFNALLSGNDDLQNE---ILDFKKEPISRDILS------QCVWLGKEPSGNDIEYNVKTESRCVNWMSREPHIHGLAAFINSTKSLFDEYNRGLLSCSRQCYVLCIQ 4467
            LHL+AL TP  GD++           A FQC Q     G       F+++    L   + + +   LPI N +G+ L +N++++ SG+    N    I  F      RD+++      + VW G  P G  +      +  C  W + +  + G A+ +++ K L    ++   SC+ +  VLCI+
Sbjct: 1175 LHLVALNTPVAGDIR-----------ADFQCFQQARAAGLLSTFRAFLSSHLQDLSTVVRKAERFGLPIVNLKGQVLFNNWDSIFSGDGGQFNTHIPIYSFD----GRDVMTDPSWPQKVVWHGSNPHGVRL-----VDKYCEAWRTTDMAVTGFASPLSTGKIL----DQKAYSCANRLIVLCIE 1336          
BLAST of MIP20649p vs. Ensembl Mouse
Match: Col15a1 (collagen, type XV, alpha 1 [Source:MGI Symbol;Acc:MGI:88449])

HSP 1 Score: 57.3806 bits (137), Expect = 4.352e-8
Identity = 48/186 (25.81%), Postives = 83/186 (44.62%), Query Frame = 1
Query: 3940 LHLIALITPTMGDLKPMLRQPGGYSGAAFQCQQAGEMYGYGRFMHPFINTDPFHLKFSINQ-KHMNLPIYNSRGETLASNFNALLSGNDDLQNE---ILDFKKEPISRDILS------QCVWLGKEPSGNDIEYNVKTESRCVNWMSREPHIHGLAAFINSTKSLFDEYNRGLLSCSRQCYVLCIQ 4467
            LHL+AL TP  GD++           A FQC Q     G       F+++    L   + + +   LPI N +G+ L +N++++ SG+    N    I  F      RD+++      + VW G  P G  +      +  C  W + +  + G A+ +++ K L    ++   SC+ +  VLCI+
Sbjct:  108 LHLVALNTPVAGDIR-----------ADFQCFQQARAAGLLSTFRAFLSSHLQDLSTVVRKAERFGLPIVNLKGQVLFNNWDSIFSGDGGQFNTHIPIYSFD----GRDVMTDPSWPQKVVWHGSNPHGVRL-----VDKYCEAWRTTDMAVTGFASPLSTGKIL----DQKAYSCANRLIVLCIE 269          
BLAST of MIP20649p vs. UniProt/SwissProt
Match: sp|Q5UQ50|COLL6_MIMIV (Collagen-like protein 6 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_L668 PE=4 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 1.595e-8
Identity = 50/131 (38.17%), Postives = 67/131 (51.15%), Query Frame = 1
Query: 3250 LWF-QIPQKGAKGEMGLKGDIGEKGDRGPSGINGVCDASICSVNLPSKGD---KGDPGQCNKSQCLVIKGERGPIGLKGDMGQKGERGESNDI----NIELIRYLTHSIIKAQIESMTLFQNGKGEKGEPG 3618
            LW  +I  KG KGE G +G++G+KG++G  G+ G         N+  KGD   KGD G       + IKGE+G IG KGD+G KG++G+  DI    NI          +K  I         KGEKG+ G
Sbjct:  443 LWVPEIDIKGDKGEKGDRGNVGDKGEKGDIGLKGDKGEKGEKGNVGDKGDIGTKGDKGNVGDKGDIGIKGEKGDIGTKGDIGNKGDKGDKGDIGNKGNIGNKGEKGDKGVKGDIGE-------KGEKGDKG 566          

HSP 2 Score: 59.3066 bits (142), Expect = 3.304e-7
Identity = 41/96 (42.71%), Postives = 54/96 (56.25%), Query Frame = 1
Query: 3241 DIILWFQIPQKGAKGEMGLKGDIGEKGDRGPSGINGVCDASI--------CSVNLPSKGDKGDPGQCNKSQCLVIKGERGPIGLKGDMGQKGERGE 3504
            DI L     +KG KG +G KGDIG KGD+G  G  G  D  I           ++ +KGDKGD G       +  KGE+G  G+KGD+G+KGE+G+
Sbjct:  471 DIGLKGDKGEKGEKGNVGDKGDIGTKGDKGNVGDKG--DIGIKGEKGDIGTKGDIGNKGDKGDKGDIGNKGNIGNKGEKGDKGVKGDIGEKGEKGD 564          
BLAST of MIP20649p vs. UniProt/SwissProt
Match: sp|Q5UNS9|COLL7_MIMIV (Collagen-like protein 7 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_L669 PE=4 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 6.015e-8
Identity = 37/82 (45.12%), Postives = 48/82 (58.54%), Query Frame = 1
Query: 3259 QIPQKGAKGEMGLKGDIGEKGDRGPSGINGVCDASICSVNLPSKGDKGDPGQCNKSQCLVIKGERGPIGLKGDMGQKGERGE 3504
             +  KG KG+ G KGD G KGDRG  GI G   +     ++ +KGDKGD G         +KG++G IG KGD G KG+RG+
Sbjct:  694 DLGSKGEKGDTGEKGDKGNKGDRGDKGIKGDIGSKGDKGDIGNKGDKGDRGDKGIKGDAGLKGDKGDIGQKGDKGTKGDRGD 775          

HSP 2 Score: 56.6102 bits (135), Expect = 2.429e-6
Identity = 37/85 (43.53%), Postives = 46/85 (54.12%), Query Frame = 1
Query: 3271 KGAKGEMGLKGDIGEKGDRGPSGINGVCDASICSVNLPSKGDKGDPGQCNKSQCLVIKGERGPIGLKGDMGQKGERGESNDINIE 3525
            KG KG++GLKGD G KGDRG  G  G             +GDKGD G          KG+RG  G+KGD G KG +G+  +I I+
Sbjct:  785 KGNKGDIGLKGDKGTKGDRGDKGTKG------------DRGDKGDIGNKGDKGDKGTKGDRGDKGVKGDKGDKGNKGDKGNIGIK 857          
BLAST of MIP20649p vs. UniProt/SwissProt
Match: sp|O35206|COFA1_MOUSE (Collagen alpha-1(XV) chain OS=Mus musculus OX=10090 GN=Col15a1 PE=1 SV=2)

HSP 1 Score: 60.077 bits (144), Expect = 1.691e-7
Identity = 48/186 (25.81%), Postives = 83/186 (44.62%), Query Frame = 1
Query: 3940 LHLIALITPTMGDLKPMLRQPGGYSGAAFQCQQAGEMYGYGRFMHPFINTDPFHLKFSINQ-KHMNLPIYNSRGETLASNFNALLSGNDDLQNE---ILDFKKEPISRDILS------QCVWLGKEPSGNDIEYNVKTESRCVNWMSREPHIHGLAAFINSTKSLFDEYNRGLLSCSRQCYVLCIQ 4467
            LHL+AL TP  GD++           A FQC Q     G       F+++    L   + + +   LPI N +G+ L +N++++ SG+    N    I  F      RD+++      + VW G  P G  +      +  C  W + +  + G A+ +++ K L    ++   SC+ +  VLCI+
Sbjct: 1197 LHLVALNTPVAGDIR-----------ADFQCFQQARAAGLLSTFRAFLSSHLQDLSTVVRKAERFGLPIVNLKGQVLFNNWDSIFSGDGGQFNTHIPIYSFD----GRDVMTDPSWPQKVVWHGSNPHGVRL-----VDKYCEAWRTTDMAVTGFASPLSTGKIL----DQKAYSCANRLIVLCIE 1358          
BLAST of MIP20649p vs. UniProt/SwissProt
Match: sp|P39060|COIA1_HUMAN (Collagen alpha-1(XVIII) chain OS=Homo sapiens OX=9606 GN=COL18A1 PE=1 SV=5)

HSP 1 Score: 57.7658 bits (138), Expect = 9.641e-7
Identity = 70/280 (25.00%), Postives = 114/280 (40.71%), Query Frame = 1
Query: 3721 RELLEQTSNRLPAGSMVYISQSDIFLIKIDQSNNVWRTISMEPKSRTW----ILPIPMNIPK--------HETTY----------PPYQN--GFSKKLHLIALITPTMGDLKPMLRQPGGYSGAAFQCQQAGEMYGYGRFMHPFINTDPFHLKFSINQK--HMNLPIYNSRGETLASNFNALLSGNDDLQN---EILDFKKEPISRDIL--SQCVWLGKEPSGNDIEYNVKTESRCVNWMSREPHIHGLAAFINSTKSLFDEYNRGLLSCSRQCYVLCIQ 4467
            R++  +    LP G+   ++     ++++  SN   R     P +R W    IL  P  +P+        H ++Y          PP  +   F   LHL+AL +P  G ++       G  GA FQC Q     G       F+++    L +SI ++     +PI N + E L  ++ AL SG++        I  F  + + R      + VW G +P+G  +     TES C  W +  P   G A+ +   + L     +   SC     VLCI+
Sbjct: 1484 RKVQLEARTPLPRGTDNEVAALQPPVVQLHDSNPYPRREHPHPTARPWRADDILASPPRLPEPQPYPGAPHHSSYVHLRPARPTSPPAHSHRDFQPVLHLVALNSPLSGGMR-------GIRGADFQCFQQARAVGLAGTFRAFLSSRLQDL-YSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHPTWPQKSVWHGSDPNGRRL-----TESYCETWRTEAPSATGQASSLLGGRLL----GQSAASCHHAYIVLCIE 1746          
BLAST of MIP20649p vs. UniProt/SwissProt
Match: sp|Q5UPS6|COLL5_MIMIV (Collagen-like protein 5 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_R241 PE=4 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 3.447e-6
Identity = 41/92 (44.57%), Postives = 55/92 (59.78%), Query Frame = 1
Query: 3268 QKGAKGEMGLKGD---IGEKGDRGPSGINGVCDASICSVNLPSKGDKGDPGQCNKSQCLVIKGERGPIGLKGD------MGQKGERGESNDI 3516
             KG+KGE GLKGD   IG+KGD+G  G +G+  +      + +KGDKGD G       + IKG++G IG KGD       G+KGE+G+  DI
Sbjct:  258 DKGSKGEDGLKGDKGDIGDKGDKGSKGEDGLKGSKGDKGEIGNKGDKGDKGD------IGIKGDKGDIGDKGDKGDPGLKGEKGEKGDKGDI 343          
BLAST of MIP20649p vs. TrEMBL
Match: A0A4D6FZI3 (Mp-1 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=mp-1 PE=2 SV=1)

HSP 1 Score: 251.136 bits (640), Expect = 5.324e-115
Identity = 120/124 (96.77%), Postives = 120/124 (96.77%), Query Frame = 1
Query: 3250 LWFQIPQKGAKGEMGLKGDIGEKGDRGPSGINGVCDASICSVNLPSKGDKGDPGQCNKSQCLVIKGERGPIGLKGDMGQKGERGESNDINIELIRYLTHSIIKAQIESMTLFQNGKGEKGEPGA 3621
            L   IPQKGAKGE GLKGDIGEKGDRGPSGINGVCDASICSVNLPSKGDKGDPGQCNKSQCLVIKGERGPIGLKGDMGQKGERGESNDINIELIRYLTHSIIKAQIESMTLFQNGKGEKGEPGA
Sbjct:  149 LRLSIPQKGAKGERGLKGDIGEKGDRGPSGINGVCDASICSVNLPSKGDKGDPGQCNKSQCLVIKGERGPIGLKGDMGQKGERGESNDINIELIRYLTHSIIKAQIESMTLFQNGKGEKGEPGA 272          

HSP 2 Score: 196.823 bits (499), Expect = 5.324e-115
Identity = 139/155 (89.68%), Postives = 144/155 (92.90%), Query Frame = 2
Query: 2756 NQTLMKSNETVTXXXXXXXXXXXXXXXXXXNTMKMTEPSNISTPTTESSSINNTQSPIIDSKT--DDMXXXXXXXXXXXXGIPTSRFPGNATSARSGTIFENICKRVIFSKKVQSPTYSPSLTILQTSTIEKEKTQPSESSQDECSVLSKLRLSV 3214
            NQTLMKSNETVTQSPSQSSSKEYSTFSSSSNTM+MTEPSNISTPTTES  I N  + I ++    DDMTKTAINTKQTTTGIPTSRFPGNATSARSGTIFENICKRVIFSKKVQSPTYSPSLTILQTSTIEKEKTQPSESSQDECSVLSKLRLS+
Sbjct:    1 NQTLMKSNETVTQSPSQSSSKEYSTFSSSSNTMEMTEPSNISTPTTES--IFNXSANIHNNXALPDDMTKTAINTKQTTTGIPTSRFPGNATSARSGTIFENICKRVIFSKKVQSPTYSPSLTILQTSTIEKEKTQPSESSQDECSVLSKLRLSI 153          
BLAST of MIP20649p vs. TrEMBL
Match: A0A5K4EKS9 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 8.260e-55
Identity = 142/413 (34.38%), Postives = 208/413 (50.36%), Query Frame = 1
Query: 3328 GPSGINGVCDASICSVNLPS-----KGDKGDPGQCNKSQC--LVIKGERGPIGLKGDMGQKGERGESNDINIELIRYLTHSIIKAQIESMTLFQNGKGEKGEPGACKCAQKVPDKSFNANDIYEENVN---------------IGYGSLVFETRELLEQTSNRLPAGSMVYISQSDIFLIKIDQSNNVWRTISMEPKSRTWILPIPMNIPK--HETTYPPYQNGFSKKLHLIALITPTMGDLKPMLRQPGGYSGAAFQCQQAGEMYGYGRFMHPFINTDPFHLKFSINQKH-MNLPIYNSRGETLASNFNALLSGNDDLQNEILDFKKEPISRDILSQCVWLGKEPSGNDIEYNVKTESRCVNWMSREPHIHGLAA---FINSTKSLFDEYNRGLLSCSRQCYVLCIQTEPYD 4482
            GP G  G C A+ C  NL +     KGD G PG C   QC    I G +GP G KG+ G  GE   ++D +I +I+   H  I  Q E    F   +G KG+PG C C     D      D   E  +               +GYG++V  T   L + S+  P G+M YI ++D F +K  +  N WR I++  K+    LPIP   P    E  Y P   G  KKL+LIA   P  GDLK   R  G ++G+ F CQ+A  + G GR  +P ++TD F++ + +   +   +P+ N  GE L  +F +L+ G    Q ++L+F    I+ DI++ C+W+G++P   + +Y    +S+C NW S  P  +GLA     +++   LF + N  L+SCS+ C +LCIQ  P D
Sbjct:    2 GPEGPPGTCPAT-CGSNLSTVIQGPKGDPGPPGFCTIDQCKEAAIPGPQGPPGEKGEKGDPGEVDLTSDQSISVIKQAIHDFI-LQPEIQKQF---RGPKGDPGECSCLSDAADNPSPKKDSNNELNSFKNNHNTKSNNNGEILGYGAMVLNTEMDLSKVSHTFPVGTMAYIREADTFYLKTMEQTNTWRIINLLSKADAINLPIPKPTPAPVFEPQYYPVHKG--KKLYLIAQNEPLRGDLKYNDRITGAHAGSIFACQRAANLKGLGRAFYPLLSTDMFNMDYVVPPTYRYGVPLVNLHGEILFDDFMSLVEGRSKPQAKLLNFDGVDITDDIVAPCLWIGQKPIYLNGDYEFAAQSKCRNWQSTYPGENGLAVSLPIVDNAPGLFSKQNFKLISCSKFCRMLCIQITPSD 407          
BLAST of MIP20649p vs. TrEMBL
Match: A0A0X3NU02 (Endostatin domain-containing protein (Fragment) OS=Schistocephalus solidus OX=70667 GN=TR97739 PE=4 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 2.161e-46
Identity = 137/413 (33.17%), Postives = 201/413 (48.67%), Query Frame = 1
Query: 3292 GLKGDIGEKGDRGPSGINGVCDASICSVNLPSK---------GDKGDPGQCNKSQC--LVIKGERGPIGLKGDMGQKGERGESNDINIELIRYLTHSIIKAQIESMTLFQNGKGEKGEPGACKCAQK--VPDKSFN-ANDIYEENVNIGYGSLVFETRELLEQTSNRLPAGSMVYISQSDIFLIKIDQSNNVWRTISMEPKSRTWILPIPMNIPKHETTYPPYQNGFSKKLHLIALITPTMGDLKPMLRQPGGYSGAAFQCQQAGEMYGYGRFMHPFINTDPFHLKFSI-NQKHMNLPIYNSRGETLASNFNALLSGNDDLQNEILDFKKEPISRDILSQCVWLGKEPSGNDIEYNVKTESRCVNWMSREPH---IHGLAAFINSTKSLFDEYNRGLLSCSRQCYVLCIQTEP 4476
            G +G  G+KGD GP G +GVC  S C V L ++         GD G PGQC    C    I G +GP   KGD G+ G     +   ++L+R       K  +E     +  +  +G PG C C      P+ + N ++DI E    I YG++V E    L + +  LP GSMVY+ Q D F +K D  +NVWR + ME  S+   +P P  I   +    P+ N   K+L+LIA      G L+   +  GG+SGA F CQ+       G+  +P ++TD F++ + +       LP+ N RGET+  +F  L+ G    Q  IL F  + I  + L+ C+WLG +P   + +Y     S+C NW S  P    +        +   L D+ N    SCS++C++LCIQ  P
Sbjct:  121 GPQGPKGDKGDAGPPGQDGVC-PSKCDVRLTTEEIERLRGPKGDPGPPGQCTLEMCNATAIPGPQGP---KGDPGEPGIFDPEDPKVVDLLR-------KTVVEYFNRPEVREQFRGTPGDCSCTGNPGAPNNTNNPSDDILESLRKISYGAMVMENETSLAKIAYSLPPGSMVYVRQDDTFYLKTDTKDNVWRIVQMETASQAIKIPSPPPIQTTQPPQAPFPNISGKQLYLIAQSEALDGRLRFRAKLGGGHSGAIFACQREANNKRLGQSFYPLLSTDMFNMDYVVPPMNRYGLPLVNIRGETIFDDFMHLIRGQQKPQAPILSFDGKDIFENPLASCLWLGAKPIYLNGDYEYAARSKCRNWQSNYPSEHALAAHLPPAANASGLVDQGNIYEESCSKRCHILCIQIIP 522          
BLAST of MIP20649p vs. TrEMBL
Match: A0A0X3NUG7 (Collagen alpha-1(XVIII) chain (Fragment) OS=Schistocephalus solidus OX=70667 GN=COIA1 PE=4 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 1.339e-43
Identity = 137/413 (33.17%), Postives = 201/413 (48.67%), Query Frame = 1
Query: 3292 GLKGDIGEKGDRGPSGINGVCDASICSVNLPSK---------GDKGDPGQCNKSQC--LVIKGERGPIGLKGDMGQKGERGESNDINIELIRYLTHSIIKAQIESMTLFQNGKGEKGEPGACKCAQK--VPDKSFN-ANDIYEENVNIGYGSLVFETRELLEQTSNRLPAGSMVYISQSDIFLIKIDQSNNVWRTISMEPKSRTWILPIPMNIPKHETTYPPYQNGFSKKLHLIALITPTMGDLKPMLRQPGGYSGAAFQCQQAGEMYGYGRFMHPFINTDPFHLKFSI-NQKHMNLPIYNSRGETLASNFNALLSGNDDLQNEILDFKKEPISRDILSQCVWLGKEPSGNDIEYNVKTESRCVNWMSREPH---IHGLAAFINSTKSLFDEYNRGLLSCSRQCYVLCIQTEP 4476
            G +G  G+KGD GP G +GVC  S C V L ++         GD G PGQC    C    I G +GP   KGD G+ G     +   ++L+R       K  +E     +  +  +G PG C C      P+ + N ++DI E    I YG++V E    L + +  LP GSMVY+ Q D F +K D  +NVWR + ME  S+   +P P  I   +    P+ N   K+L+LIA      G L+   +  GG+SGA F CQ+       G+  +P ++TD F++ + +       LP+ N RGET+  +F  L+ G    Q  IL F  + I  + L+ C+WLG +P   + +Y     S+C NW S  P    +        +   L D+ N    SCS++C++LCIQ  P
Sbjct:  956 GPQGPKGDKGDAGPPGQDGVC-PSKCDVRLTTEEIERLRGPKGDPGPPGQCTLEMCNATAIPGPQGP---KGDPGEPGIFDPEDPKVVDLLR-------KTVVEYFNRPEVREQFRGTPGDCSCTGNPGAPNNTNNPSDDILESLRKISYGAMVMENETSLAKIAYSLPPGSMVYVRQDDTFYLKTDTKDNVWRIVQMETASQAIKIPSPPPIQTTQPPQAPFPNISGKQLYLIAQSEALDGRLRFRAKLGGGHSGAIFACQREANNKRLGQSFYPLLSTDMFNMDYVVPPMNRYGLPLVNIRGETIFDDFMHLIRGQQKPQAPILSFDGKDIFENPLASCLWLGAKPIYLNGDYEYAARSKCRNWQSNYPSEHALAAHLPPAANASGLVDQGNIYEESCSKRCHILCIQIIP 1357          
BLAST of MIP20649p vs. TrEMBL
Match: A0A0X3PDF3 (Endostatin domain-containing protein (Fragment) OS=Schistocephalus solidus OX=70667 GN=TR97739 PE=4 SV=1)

HSP 1 Score: 186.037 bits (471), Expect = 1.905e-43
Identity = 137/413 (33.17%), Postives = 201/413 (48.67%), Query Frame = 1
Query: 3292 GLKGDIGEKGDRGPSGINGVCDASICSVNLPSK---------GDKGDPGQCNKSQC--LVIKGERGPIGLKGDMGQKGERGESNDINIELIRYLTHSIIKAQIESMTLFQNGKGEKGEPGACKCAQK--VPDKSFN-ANDIYEENVNIGYGSLVFETRELLEQTSNRLPAGSMVYISQSDIFLIKIDQSNNVWRTISMEPKSRTWILPIPMNIPKHETTYPPYQNGFSKKLHLIALITPTMGDLKPMLRQPGGYSGAAFQCQQAGEMYGYGRFMHPFINTDPFHLKFSI-NQKHMNLPIYNSRGETLASNFNALLSGNDDLQNEILDFKKEPISRDILSQCVWLGKEPSGNDIEYNVKTESRCVNWMSREPH---IHGLAAFINSTKSLFDEYNRGLLSCSRQCYVLCIQTEP 4476
            G +G  G+KGD GP G +GVC  S C V L ++         GD G PGQC    C    I G +GP   KGD G+ G     +   ++L+R       K  +E     +  +  +G PG C C      P+ + N ++DI E    I YG++V E    L + +  LP GSMVY+ Q D F +K D  +NVWR + ME  S+   +P P  I   +    P+ N   K+L+LIA      G L+   +  GG+SGA F CQ+       G+  +P ++TD F++ + +       LP+ N RGET+  +F  L+ G    Q  IL F  + I  + L+ C+WLG +P   + +Y     S+C NW S  P    +        +   L D+ N    SCS++C++LCIQ  P
Sbjct: 1096 GPQGPKGDKGDAGPPGQDGVC-PSKCDVRLTTEEIERLRGPKGDPGPPGQCTLEMCNATAIPGPQGP---KGDPGEPGIFDPEDPKVVDLLR-------KTVVEYFNRPEVREQFRGTPGDCSCTGNPGAPNNTNNPSDDILESLRKISYGAMVMENETSLAKIAYSLPPGSMVYVRQDDTFYLKTDTKDNVWRIVQMETASQAIKIPSPPPIQTTQPPQAPFPNISGKQLYLIAQSEALDGRLRFRAKLGGGHSGAIFACQREANNKRLGQSFYPLLSTDMFNMDYVVPPMNRYGLPLVNIRGETIFDDFMHLIRGQQKPQAPILSFDGKDIFENPLASCLWLGAKPIYLNGDYEYAARSKCRNWQSNYPSEHALAAHLPPAANASGLVDQGNIYEESCSKRCHILCIQIIP 1497          
BLAST of MIP20649p vs. Ensembl Cavefish
Match: ENSAMXT00000057821.1 (pep primary_assembly:Astyanax_mexicanus-2.0:13:7857215:7863508:-1 gene:ENSAMXG00000033545.1 transcript:ENSAMXT00000057821.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.3882 bits (150), Expect = 2.740e-10
Identity = 53/183 (28.96%), Postives = 81/183 (44.26%), Query Frame = 1
Query: 3931 SKKLHLIALITPTMGDLKPMLRQPGGYSGAAFQCQQAGEMYGYGRFMHPFINTDPFHLKFSINQKHMN-LPIYNSRGETLASNFNALLSGNDDLQNE---ILDFKKEPISRDILSQCVWLGKEPSGNDIEYNVKTESRCVNWMSREPHIHGLAAFINSTKSLFDEYNRGLLSCSRQCYVLCIQ 4467
            SKKLHLIAL +P  GD++       G  G   QC    +  G       F+++    L   + +   +  PI N R E L SN++A+ S N+    +   I  F    +  D   Q VW G   +G+      +T+S C  W +    + G+A+ +     L  +  R   SCSR   +LCI+
Sbjct:   34 SKKLHLIALNSPQDGDMQ-------GIRGVDHQCFLQAQAIGLKGTFRAFLSSRLQDLYSIVRRSDRDQYPIVNLRDEELFSNWDAIFSDNEGKIRDNIRIYSFDGRDVLEDDAWQVVWHGSSTAGHR-----QTDSFCETWRTDNHAVTGMASSLQDGH-LLQQTPR---SCSRSSILLCIE 200          
BLAST of MIP20649p vs. Ensembl Cavefish
Match: ENSAMXT00000043399.1 (pep primary_assembly:Astyanax_mexicanus-2.0:13:7857215:7862257:-1 gene:ENSAMXG00000033545.1 transcript:ENSAMXT00000043399.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.151 bits (139), Expect = 1.401e-8
Identity = 53/192 (27.60%), Postives = 83/192 (43.23%), Query Frame = 1
Query: 3907 YPPYQNGFSK-KLHLIALITPTMGDLKPMLRQPGGYSGAAFQCQQAGEMYGYGRFMHPFINTDPFHLKFSINQKHMN-LPIYNSRGETLASNFNALLSGNDDLQNE---ILDFKKEPISRDILSQCVWLGKEPSGNDIEYNVKTESRCVNWMSREPHIHGLAAFINSTKSLFDEYNRGLLSCSRQCYVLCIQ 4467
            Y   ++G  K  LHLIAL +P  GD++       G  G   QC    +  G       F+++    L   + +   +  PI N R E L SN++A+ S N+    +   I  F    +  D   Q VW G   +G+      +T+S C  W +    + G+A+ +     L  +  R   SCSR   +LCI+
Sbjct:   55 YVRVRDGVRKVMLHLIALNSPQDGDMQ-------GIRGVDHQCFLQAQAIGLKGTFRAFLSSRLQDLYSIVRRSDRDQYPIVNLRDEELFSNWDAIFSDNEGKIRDNIRIYSFDGRDVLEDDAWQVVWHGSSTAGHR-----QTDSFCETWRTDNHAVTGMASSLQDGH-LLQQTPR---SCSRSSILLCIE 230          
BLAST of MIP20649p vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009156.1 (pep scaffold:Pmarinus_7.0:GL476573:61536:110082:-1 gene:ENSPMAG00000008210.1 transcript:ENSPMAT00000009156.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 2.769e-8
Identity = 53/182 (29.12%), Postives = 75/182 (41.21%), Query Frame = 1
Query: 3937 KLHLIALITPTMGDLKPMLRQPGGYSGAAFQCQQAGEMYGYGRFMHPFINTDPFHLKFSINQKHMN-LPIYNSRGETLASNFNALLSGNDDLQN---EILDFKKEPISRDILSQCVWLGKEP-SGNDIEYNVKTESRCVNWMSREPHIHGLAAFINSTKSLFDEYNRGLLSCSRQCYVLCIQ 4467
            +LHLIAL  P  G +        G  GA FQC Q     G       F+++    L   + +   + +PI N RGE L  N+N + SG++   N    I  F      RDIL+   W  K    G+D          C  W   +  + G A+ + S + L  +     L CS    VLCI+
Sbjct: 1175 QLHLIALNEPQPGAMH-------GIRGADFQCFQQARAIGLHGTFRAFLSSKVQDLVSIVRRADRDSMPIINLRGEVLYRNWNEIFSGSEGQLNYNVPIYSFD----GRDILTDPAWPQKHVWHGSDAHGRRLVTQYCEMWRVGDSAVTGQASPLASRRLLQQQP----LGCSSVLAVLCIE 1341          
BLAST of MIP20649p vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003519.1 (pep scaffold:Pmarinus_7.0:GL476336:685424:702873:1 gene:ENSPMAG00000003217.1 transcript:ENSPMAT00000003519.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.7582 bits (125), Expect = 5.850e-7
Identity = 65/267 (24.34%), Postives = 107/267 (40.07%), Query Frame = 1
Query: 3706 LVFETRELLEQTSNRLPAGSMVYISQSDIFLIKIDQSNNVWRTISM-------EPKSRTWILPIPMNIPKHETTYPPYQNGFSKKLHLIALITPTMGDLKPMLRQPGGYSGAAFQCQQAGEMYGYGRFMHPFINTDPFHLKFSINQKHMN-LPIYNSRGETLASNFNALLSGNDDLQN---EILDFKKEPISRDIL--SQCVWLGKEPSGNDIEYNVKTESRCVNWMSREPHIHGLAAFINSTKSLFDEYNRGLLSCSRQCYVLCIQ 4467
            LVF      E  S+R   GS+ Y++QS      +      WR +++        P S T   P+   +  + T  P +  G + +L++ AL TP MG +       GG  GA   C +     G       F+ +    L   +++   + +PI N + E L  N+N+L +G+    N    I  F    +  D     + VW G +  G       K    C  W S    + G A+ + S + L D++      C+    VLC++
Sbjct:  322 LVFGNHH--ELVSHRARDGSLAYVTQSGNLYFCVPGG---WRKLALGLSVFNTTPYSPTQP-PLRFFLISNVTLTPQHPAGPAPQLYMAALNTPIMGSM-------GGLRGADTLCFRQARSAGLAGTFRAFLASPNQDLHAIVDRDEASQVPILNLKNELLFFNWNSLFTGDGASFNPNAPIYSFDGGNVLTDSKWPFKLVWHGADEQGRH-----KNGHSCTGWRSSSDDV-GQASALQSGR-LLDQHTH---HCASHFVVLCVE 565          
BLAST of MIP20649p vs. Ensembl Medaka
Match: ENSORLT00000031348.1 (pep primary_assembly:ASM223467v1:17:19717601:19722917:1 gene:ENSORLG00000023987.1 transcript:ENSORLT00000031348.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.9954 bits (136), Expect = 3.107e-8
Identity = 48/178 (26.97%), Postives = 74/178 (41.57%), Query Frame = 1
Query: 3949 IALITPTMGDLKPMLRQPGGYSGAAFQCQQAGEMYGYGRFMHPFINTDPFHLKFSINQK-HMNLPIYNSRGETLASNFNALLSGNDDL---QNEILDFKKEPISRDIL-SQCVWLGKEPSGNDIEYNVKTESRCVNWMSREPHIHGLAAFINSTKSLFDEYNRGLLSCSRQCYVLCIQ 4467
            +AL  P  GD++       G  GA  QC Q     G+      F+++    L   + +    NLP+ N +GE L S++ ++ SGN  +      I  F    +  D    + VW G    G  +  N      C  W + +  + G AA +  T  L  ++ R   SCS    VLCI+
Sbjct:   57 VALNAPLKGDMR-------GIRGADLQCYQQARSMGHTSTYRAFLSSHLQDLATIVRKADRHNLPVVNLKGEVLFSSWMSIFSGNGGVFEPSASIYSFNGRDVMTDSAPEKMVWHGSNAVGTRLTTNY-----CEAWRTADMAVTGQAALLQ-TGRLLGQHAR---SCSNHYIVLCIE 218          
BLAST of MIP20649p vs. Ensembl Medaka
Match: ENSORLT00000037359.1 (collagen alpha-1(X) chain-like [Source:NCBI gene;Acc:101165002])

HSP 1 Score: 52.7582 bits (125), Expect = 2.833e-6
Identity = 39/121 (32.23%), Postives = 52/121 (42.98%), Query Frame = 1
Query: 3268 QKGAKGEMGLKGDIGEKGDRGPSGINGVCDASICSVNLPSKGDKGDPGQCNKSQCLVIKGERGPIGLKGDMGQKGERGESNDINIELIRYLTHSIIKAQIESMTLFQNGKGEKGEPGACKC 3630
            ++G KGE G +GD+G  G +GP G  G C A+  S+  P  G +G PG         ++G  GP GLKGD G  G  G      I                        KG++G+ G C C
Sbjct:  186 ERGFKGEKGDQGDMGPAGSQGPQGETGTCPATCESIPGP-PGMQGTPGPVGPRGLPGVEGPLGPKGLKGDKGDMGTPGVPGSNGI------------------------KGDQGDQGVCHC 281          
BLAST of MIP20649p vs. Planmine SMEST
Match: SMESG000075164.1 (SMESG000075164.1)

HSP 1 Score: 1890.55 bits (4896), Expect = 0.000e+0
Identity = 1064/1071 (99.35%), Postives = 1068/1071 (99.72%), Query Frame = 2
Query:    2 KVYFILGLFVNFTNICQSVQDKEWDLLYLLKKENNIHLSDDITLSLSGSTNYSQFILAAKQIFSQNNLPSTFVVYIKVQLKTLTISPMTIFSLRDPNNKARFQMKLRMIPGFIKKTELNVVLNPVSSNGIEVNVNFTLPFIHTDIWTFGMLFKSSKITLYAVCDDINRTFGYQTMQIPSGLGKMLFSEGAVMHLFSDDHQTDLLEGEIYEITFANFFRKLNQICNQGGIEGSGGHEKQKIERKSPGNHLLVTEKMDXXXXXXXXXXXXXXXXXNFRSVTSSRKSEREQTLIKQIEREKNVTGEKDQVLEFSMNDMDSSKSDGKIFNQSLQSLTTKTDNKKNITFNIPINHRKEFSEVSNMSLIKKTSMNLETSSSVKKTTIKQNALNXXXXXXXXXXIGKDEDDLGEIDLNMFDIESTSGTLTTEKLTDEIKTDSEIRYGKSTRRNKIYDKKLSNESLQNDTVINNNVNKKFKMENSSIKDDNTVEKAINILTQNPNIRSTTIPVLDTSSMPPRSNTNSGTSTYVSSQTQDKLNYEPMVENXXXXXXXXXXXXXXXXXISSGLIETSKESSQILTEVTEISYDSNSQISVEISKKHVSEGTEGKKSNTSPPQETDETIKVKTTENSTILQSTTFPIYSHSKQPVSNASGNITHKYFEQKTSDNLKLITESNKETKTTSIGSTKRLMNTTYIXXXXXXXXXXXXXYDXXXXXXXXXXXXXXXNSTIFSPLVPNVRDSAHNLSKATTESIQTGIYNHTKERIILRISGNLTEFDQNEYTSTPIKVLEFNETKPNGTFSKITTAPILFNKSITSLTRQSESQTSTHAITSSTRKVKTEKSTTLSSMKLDTRLPMESNKTLGIIANGRKNETNKYQFYTTTNLSLANKTDISQKSEISTNSSEFLIRSTSPSNISSTEILIENQTLMKSNETVTXXXXXXXXXXXXXXXXXXNTMKMTEPSNISTPTTESSSINNTQSPIIDSKTDDMXXXXXXXXXXXXGIPTSRFPGNATSARSGTIFENICKRVIFSKKVQSPTYSPSLTILQTSTIEKEKTQPSESSQDECSVLSKLRLSV 3214
            KVYFILGLFVNFTNICQSVQDKEWDLLYLLKKENNIHLSDDITLSLSGSTNYSQFILAAKQIFSQNNLPSTFVVYIKVQLKTLTISPMTIFSLRDPNNKARFQMKLRMIPGFIKKTELNVVLNPVSSNGIEVNVNFTLPFIHTDIWTFGMLFKSSKITLYAVCDDINRTFGYQTMQIPSGLGKMLFSEGAVMHLFSDDHQTDLLEGEIYEITFANFFRKLNQICNQGGIEGSGGHEKQKIERKSPGNHLLVTEKMDEDDTTTLSTTTETLSTTNFRSVTSSRKSEREQTLIKQIEREKNVTGEKDQVLEFSMNDMDSSKSDGKIFNQSLQSLT KTDNKKNITFNIPINHRKEFSEVSNMSLIKKTSMNLETSSSVKKTTIKQNALNTTTLYTSTSTIGKDEDDLGEIDLNMFDIESTSGTLTTEKLTDEIKTDSEIRYGKSTRRNKIYDKKLSNESLQNDTVINNNVNKKFKMENSSIKDDNTVEKAINILTQNPNIRSTTIPVLDTSSMPPRSNTNSGTSTYVSSQTQDKLNYEPMVENKEMSSTEKSTKYSKSDKI SGLIETSKESSQILTEVTEISYDSNSQISVEISKKHVSEGTEGKKSNTSPPQETDETIKVKTTENSTILQSTTFPIYSHSKQ VSNASGNITHKYFEQKTSDNLKLITESNKETKTTSIGSTKRLMNTTYISKSKSSIGKVKSKYDVTQQSQTVTPTSAPQNSTIFSPLVPNVRDSAHNLSKATTESIQTGIYNHTKERIILRISGNLTEFDQNEYTSTPIKVLEFNETKPNGTFSKITTAPILFNKSITSLTRQSESQTSTHAITSSTRKVKTEKSTTLSSMKLDTRLPMESNKTLGIIANG+KNETNKYQFYTTTNLSLANKTDISQKSEISTNSSEFLIRSTSPSNISSTEILIENQTLMKSNETVTQSPSQSSSKEYSTFSSSSNTM+MTEPSNISTPTTESSSINNTQSPIIDSKTDDMTKTAINTKQTTTGIPTSRFPGNATSARSGTIFENICKRVIFSKKVQSPTYSPSLTILQTSTIEKEKTQPSESSQDECS+LSKLRLS+
Sbjct:    3 KVYFILGLFVNFTNICQSVQDKEWDLLYLLKKENNIHLSDDITLSLSGSTNYSQFILAAKQIFSQNNLPSTFVVYIKVQLKTLTISPMTIFSLRDPNNKARFQMKLRMIPGFIKKTELNVVLNPVSSNGIEVNVNFTLPFIHTDIWTFGMLFKSSKITLYAVCDDINRTFGYQTMQIPSGLGKMLFSEGAVMHLFSDDHQTDLLEGEIYEITFANFFRKLNQICNQGGIEGSGGHEKQKIERKSPGNHLLVTEKMDEDDTTTLSTTTETLSTTNFRSVTSSRKSEREQTLIKQIEREKNVTGEKDQVLEFSMNDMDSSKSDGKIFNQSLQSLTIKTDNKKNITFNIPINHRKEFSEVSNMSLIKKTSMNLETSSSVKKTTIKQNALNTTTLYTSTSTIGKDEDDLGEIDLNMFDIESTSGTLTTEKLTDEIKTDSEIRYGKSTRRNKIYDKKLSNESLQNDTVINNNVNKKFKMENSSIKDDNTVEKAINILTQNPNIRSTTIPVLDTSSMPPRSNTNSGTSTYVSSQTQDKLNYEPMVENKEMSSTEKSTKYSKSDKIYSGLIETSKESSQILTEVTEISYDSNSQISVEISKKHVSEGTEGKKSNTSPPQETDETIKVKTTENSTILQSTTFPIYSHSKQSVSNASGNITHKYFEQKTSDNLKLITESNKETKTTSIGSTKRLMNTTYISKSKSSIGKVKSKYDVTQQSQTVTPTSAPQNSTIFSPLVPNVRDSAHNLSKATTESIQTGIYNHTKERIILRISGNLTEFDQNEYTSTPIKVLEFNETKPNGTFSKITTAPILFNKSITSLTRQSESQTSTHAITSSTRKVKTEKSTTLSSMKLDTRLPMESNKTLGIIANGQKNETNKYQFYTTTNLSLANKTDISQKSEISTNSSEFLIRSTSPSNISSTEILIENQTLMKSNETVTQSPSQSSSKEYSTFSSSSNTMEMTEPSNISTPTTESSSINNTQSPIIDSKTDDMTKTAINTKQTTTGIPTSRFPGNATSARSGTIFENICKRVIFSKKVQSPTYSPSLTILQTSTIEKEKTQPSESSQDECSILSKLRLSI 1073          

HSP 2 Score: 884.789 bits (2285), Expect = 0.000e+0
Identity = 408/412 (99.03%), Postives = 409/412 (99.27%), Query Frame = 1
Query: 3250 LWFQIPQKGAKGEMGLKGDIGEKGDRGPSGINGVCDASICSVNLPSKGDKGDPGQCNKSQCLVIKGERGPIGLKGDMGQKGERGESNDINIELIRYLTHSIIKAQIESMTLFQNGKGEKGEPGACKCAQKVPDKSFNANDIYEENVNIGYGSLVFETRELLEQTSNRLPAGSMVYISQSDIFLIKIDQSNNVWRTISMEPKSRTWILPIPMNIPKHETTYPPYQNGFSKKLHLIALITPTMGDLKPMLRQPGGYSGAAFQCQQAGEMYGYGRFMHPFINTDPFHLKFSINQKHMNLPIYNSRGETLASNFNALLSGNDDLQNEILDFKKEPISRDILSQCVWLGKEPSGNDIEYNVKTESRCVNWMSREPHIHGLAAFINSTKSLFDEYNRGLLSCSRQCYVLCIQTEPYDL 4485
            L   IPQKGAKGEMGLKGDIGEKGDRGPSGINGVC+ASICSVNLPSKGDKGDPGQCNKSQCLVIKGERGPIGLKGDMGQKGERGESNDINIELIRYLTHSIIKAQIESMTLFQNGKGEKGEPGACKCAQKVPDKSFNANDIYEENVNIGYGSLVFETRELLEQTSNRLPAGSMVYISQSDIFLIKIDQSNNVWRTISMEPKSRTWILPIPMNIPKHETTYPPYQNGFSKKLHLIALITPTMGDLKPMLRQPGGYSGAAFQCQQAGEMYGYGRFMHPFINTDPFHLKFSINQKHMNLPIYNSRGETLASNFNALLSGNDDLQNEILDFKKEPISRDILSQCVWLGKEPSGNDIEYNVKTESRCVNWMSREPHIHGLAAFINSTKSLFDEYNRGLLSCSRQCYVLCIQTEPYDL
Sbjct: 1069 LRLSIPQKGAKGEMGLKGDIGEKGDRGPSGINGVCNASICSVNLPSKGDKGDPGQCNKSQCLVIKGERGPIGLKGDMGQKGERGESNDINIELIRYLTHSIIKAQIESMTLFQNGKGEKGEPGACKCAQKVPDKSFNANDIYEENVNIGYGSLVFETRELLEQTSNRLPAGSMVYISQSDIFLIKIDQSNNVWRTISMEPKSRTWILPIPMNIPKHETTYPPYQNGFSKKLHLIALITPTMGDLKPMLRQPGGYSGAAFQCQQAGEMYGYGRFMHPFINTDPFHLKFSINQKHMNLPIYNSRGETLASNFNALLSGNDDLQNEILDFKKEPISRDILSQCVWLGKEPSGNDIEYNVKTESRCVNWMSREPHIHGLAAFINSTKSLFDEYNRGLLSCSRQCYVLCIQTEPYDL 1480          
BLAST of MIP20649p vs. Planmine SMEST
Match: SMESG000081921.1 (SMESG000081921.1)

HSP 1 Score: 183.726 bits (465), Expect = 8.789e-47
Identity = 125/371 (33.69%), Postives = 195/371 (52.56%), Query Frame = 1
Query: 3250 LWFQIPQKGAKGEMGLKGDIGEKGDRGPSGINGVCDASICSVNLP----SKGDKGDPGQCNKSQC---LVIKGERGPIGLKGDMGQKGERGESND-INIELIRYLTHSIIKAQIESMTLFQNGKGEKGEPGACKCAQKVPDKSFNANDIYEENVNIGYGSLVFETRELLEQTSNRLPAGSMVYISQSDIFLIKIDQSNNVWRTISMEPKSRTWILPIPMNIPKHET---TYPPYQNGFSK--KLHLIALITPTMGDLKPMLRQPGGYSGAAFQCQQAGEMYGYGRFMHPFINTDPFHLKFSINQKH-MNLPIYNSRGETLASNFNALLSGNDDLQNEILDFKKEPISRDILSQCVWLGKEPSGNDIEYNVK 4320
            L F I QKG KGE G  G  GE+G  G  G +G C  + C+ +LP    +KGD+G+ G C+   C   ++I+      G+KGD G++G + ++ D + I  +  +    IK+ I+   + +N    KGEPG+C C    P ++            I   S+V    + L+  S  +P G MV++   +I L+KID   N WR + +E     W          H+T   T+ P  + F+   KL LIAL  PT GDL+    +PG YSG+++ CQ+    YG GR  +P +NTD F   + + +K+   +P+ N R E +AS+F  LL  + ++Q  ILDF+ + I  +I   CVW+G++PS  +I+  +K
Sbjct:  589 LRFDILQKGVKGEKGGYGQQGERGTTGMPGKDGKCLLNQCN-SLPPIKGTKGDRGETGYCSLDNCKSNIIIEK-----GVKGDKGEQGIKEDNGDGLKISDVLAILVPEIKSSIDDY-VSRNVINMKGEPGSCSC----PVETSRGEG------KIKTQSIVLNDGKTLKSLSFNMPVGQMVFLIVENILLVKIDDVKNRWRIVKLESAESDWYFATETQ--NHQTLLPTFGPISSMFNTAFKLMLIALPKPTGGDLRSDQFEPGAYSGSSYLCQKQAYNYGLGRAFYPLLNTDMFDFNYLLPEKYRYGVPVVNRRNEKIASSFTDLLKPSVEMQASILDFRGDSIMSEINEPCVWIGEKPSLYEIKVLLK 940          

HSP 2 Score: 92.4337 bits (228), Expect = 2.023e-18
Identity = 72/245 (29.39%), Postives = 126/245 (51.43%), Query Frame = 2
Query:   65 KEWDLLYLLKKENNIHLS---DDITLSLSGSTNYSQFILAAKQIFSQNNLPSTFVVYIKVQLKTLTIS-PMTIFSLRDPNNKARFQMKLRMIPGFIKKTELNVVLNPVSS--NGIEVNVNFTLPFIHTDIWTFGMLFKSSKITLYAVCDDINRTFGYQTMQIPSGLGKMLFSEGAVMHLFSD---DHQTDLLEGEIYEITFANFFRKLNQICN-QGGIEGSGGHEKQKIERKSPGNHLLVTEKMD 769
            KEW+LL +++++  I LS    D  L+L+   +  QF   A+ IF +  + S   +YIK       IS   TI  +RDP NK R  ++     G  K+  L +V +P+S+  N  +  +  T+PF+++  WT G+L ++ KIT+Y  CDDI + +GY  +     + + LF  G  ++L ++   +   ++ EG + E    N       +C  +  +EGSG   K K + K  GN+++ +  ++
Sbjct:   30 KEWNLLTMIEEKYKIGLSATDSDFLLNLTSKEHGFQF--PAQTIFPKLKIVSNAFIYIKF----FPISTAFTILKIRDPLNKVRLDIRGYQQLGHFKQFRLVIVYSPISNIENRFKNYMELTIPFLNSA-WTLGVLIENKKITVYTSCDDIFKPYGYHQVSNTYPVNQQLFYSGTTLYLLNNGEINGNKEIFEGTVSEFVLTNKNNLNEYMCRKEEMLEGSGSQTK-KWKPKYIGNYVITSSTIE 266          
BLAST of MIP20649p vs. Planmine SMEST
Match: SMESG000081921.1 (SMESG000081921.1)

HSP 1 Score: 183.341 bits (464), Expect = 9.146e-47
Identity = 125/371 (33.69%), Postives = 195/371 (52.56%), Query Frame = 1
Query: 3250 LWFQIPQKGAKGEMGLKGDIGEKGDRGPSGINGVCDASICSVNLP----SKGDKGDPGQCNKSQC---LVIKGERGPIGLKGDMGQKGERGESND-INIELIRYLTHSIIKAQIESMTLFQNGKGEKGEPGACKCAQKVPDKSFNANDIYEENVNIGYGSLVFETRELLEQTSNRLPAGSMVYISQSDIFLIKIDQSNNVWRTISMEPKSRTWILPIPMNIPKHET---TYPPYQNGFSK--KLHLIALITPTMGDLKPMLRQPGGYSGAAFQCQQAGEMYGYGRFMHPFINTDPFHLKFSINQKH-MNLPIYNSRGETLASNFNALLSGNDDLQNEILDFKKEPISRDILSQCVWLGKEPSGNDIEYNVK 4320
            L F I QKG KGE G  G  GE+G  G  G +G C  + C+ +LP    +KGD+G+ G C+   C   ++I+      G+KGD G++G + ++ D + I  +  +    IK+ I+   + +N    KGEPG+C C    P ++            I   S+V    + L+  S  +P G MV++   +I L+KID   N WR + +E     W          H+T   T+ P  + F+   KL LIAL  PT GDL+    +PG YSG+++ CQ+    YG GR  +P +NTD F   + + +K+   +P+ N R E +AS+F  LL  + ++Q  ILDF+ + I  +I   CVW+G++PS  +I+  +K
Sbjct:  553 LRFDILQKGVKGEKGGYGQQGERGTTGMPGKDGKCLLNQCN-SLPPIKGTKGDRGETGYCSLDNCKSNIIIEK-----GVKGDKGEQGIKEDNGDGLKISDVLAILVPEIKSSIDDY-VSRNVINMKGEPGSCSC----PVETSRGEG------KIKTQSIVLNDGKTLKSLSFNMPVGQMVFLIVENILLVKIDDVKNRWRIVKLESAESDWYFATETQ--NHQTLLPTFGPISSMFNTAFKLMLIALPKPTGGDLRSDQFEPGAYSGSSYLCQKQAYNYGLGRAFYPLLNTDMFDFNYLLPEKYRYGVPVVNRRNEKIASSFTDLLKPSVEMQASILDFRGDSIMSEINEPCVWIGEKPSLYEIKVLLK 904          

HSP 2 Score: 81.2629 bits (199), Expect = 4.547e-15
Identity = 64/223 (28.70%), Postives = 112/223 (50.22%), Query Frame = 2
Query:  122 DITLSLSGSTNYSQFILAAKQIFSQNNLPSTFVVYIKVQLKTLTIS-PMTIFSLRDPNNKARFQMKLRMIPGFIKKTELNVVLNPVSS--NGIEVNVNFTLPFIHTDIWTFGMLFKSSKITLYAVCDDINRTFGYQTMQIPSGLGKMLFSEGAVMHLFSD---DHQTDLLEGEIYEITFANFFRKLNQICN-QGGIEGSGGHEKQKIERKSPGNHLLVTEKMD 769
            D  L+L+   +  QF   A+ IF +  + S   +YIK       IS   TI  +RDP NK R  ++     G  K+  L +V +P+S+  N  +  +  T+PF+++  WT G+L ++ KIT+Y  CDDI + +GY  +     + + LF  G  ++L ++   +   ++ EG + E    N       +C  +  +EGSG   K K + K  GN+++ +  ++
Sbjct:   16 DFLLNLTSKEHGFQF--PAQTIFPKLKIVSNAFIYIKF----FPISTAFTILKIRDPLNKVRLDIRGYQQLGHFKQFRLVIVYSPISNIENRFKNYMELTIPFLNS-AWTLGVLIENKKITVYTSCDDIFKPYGYHQVSNTYPVNQQLFYSGTTLYLLNNGEINGNKEIFEGTVSEFVLTNKNNLNEYMCRKEEMLEGSGSQTK-KWKPKYIGNYVITSSTIE 230          
BLAST of MIP20649p vs. Planmine SMEST
Match: SMESG000081921.1 (SMESG000081921.1)

HSP 1 Score: 183.341 bits (464), Expect = 1.140e-46
Identity = 125/371 (33.69%), Postives = 195/371 (52.56%), Query Frame = 1
Query: 3250 LWFQIPQKGAKGEMGLKGDIGEKGDRGPSGINGVCDASICSVNLP----SKGDKGDPGQCNKSQC---LVIKGERGPIGLKGDMGQKGERGESND-INIELIRYLTHSIIKAQIESMTLFQNGKGEKGEPGACKCAQKVPDKSFNANDIYEENVNIGYGSLVFETRELLEQTSNRLPAGSMVYISQSDIFLIKIDQSNNVWRTISMEPKSRTWILPIPMNIPKHET---TYPPYQNGFSK--KLHLIALITPTMGDLKPMLRQPGGYSGAAFQCQQAGEMYGYGRFMHPFINTDPFHLKFSINQKH-MNLPIYNSRGETLASNFNALLSGNDDLQNEILDFKKEPISRDILSQCVWLGKEPSGNDIEYNVK 4320
            L F I QKG KGE G  G  GE+G  G  G +G C  + C+ +LP    +KGD+G+ G C+   C   ++I+      G+KGD G++G + ++ D + I  +  +    IK+ I+   + +N    KGEPG+C C    P ++            I   S+V    + L+  S  +P G MV++   +I L+KID   N WR + +E     W          H+T   T+ P  + F+   KL LIAL  PT GDL+    +PG YSG+++ CQ+    YG GR  +P +NTD F   + + +K+   +P+ N R E +AS+F  LL  + ++Q  ILDF+ + I  +I   CVW+G++PS  +I+  +K
Sbjct:  612 LRFDILQKGVKGEKGGYGQQGERGTTGMPGKDGKCLLNQCN-SLPPIKGTKGDRGETGYCSLDNCKSNIIIEK-----GVKGDKGEQGIKEDNGDGLKISDVLAILVPEIKSSIDDY-VSRNVINMKGEPGSCSC----PVETSRGEG------KIKTQSIVLNDGKTLKSLSFNMPVGQMVFLIVENILLVKIDDVKNRWRIVKLESAESDWYFATETQ--NHQTLLPTFGPISSMFNTAFKLMLIALPKPTGGDLRSDQFEPGAYSGSSYLCQKQAYNYGLGRAFYPLLNTDMFDFNYLLPEKYRYGVPVVNRRNEKIASSFTDLLKPSVEMQASILDFRGDSIMSEINEPCVWIGEKPSLYEIKVLLK 963          

HSP 2 Score: 92.4337 bits (228), Expect = 1.664e-18
Identity = 72/245 (29.39%), Postives = 126/245 (51.43%), Query Frame = 2
Query:   65 KEWDLLYLLKKENNIHLS---DDITLSLSGSTNYSQFILAAKQIFSQNNLPSTFVVYIKVQLKTLTIS-PMTIFSLRDPNNKARFQMKLRMIPGFIKKTELNVVLNPVSS--NGIEVNVNFTLPFIHTDIWTFGMLFKSSKITLYAVCDDINRTFGYQTMQIPSGLGKMLFSEGAVMHLFSD---DHQTDLLEGEIYEITFANFFRKLNQICN-QGGIEGSGGHEKQKIERKSPGNHLLVTEKMD 769
            KEW+LL +++++  I LS    D  L+L+   +  QF   A+ IF +  + S   +YIK       IS   TI  +RDP NK R  ++     G  K+  L +V +P+S+  N  +  +  T+PF+++  WT G+L ++ KIT+Y  CDDI + +GY  +     + + LF  G  ++L ++   +   ++ EG + E    N       +C  +  +EGSG   K K + K  GN+++ +  ++
Sbjct:   30 KEWNLLTMIEEKYKIGLSATDSDFLLNLTSKEHGFQF--PAQTIFPKLKIVSNAFIYIKF----FPISTAFTILKIRDPLNKVRLDIRGYQQLGHFKQFRLVIVYSPISNIENRFKNYMELTIPFLNS-AWTLGVLIENKKITVYTSCDDIFKPYGYHQVSNTYPVNQQLFYSGTTLYLLNNGEINGNKEIFEGTVSEFVLTNKNNLNEYMCRKEEMLEGSGSQTK-KWKPKYIGNYVITSSTIE 266          
BLAST of MIP20649p vs. Planmine SMEST
Match: SMESG000081921.1 (SMESG000081921.1)

HSP 1 Score: 183.341 bits (464), Expect = 1.198e-46
Identity = 125/371 (33.69%), Postives = 195/371 (52.56%), Query Frame = 1
Query: 3250 LWFQIPQKGAKGEMGLKGDIGEKGDRGPSGINGVCDASICSVNLP----SKGDKGDPGQCNKSQC---LVIKGERGPIGLKGDMGQKGERGESND-INIELIRYLTHSIIKAQIESMTLFQNGKGEKGEPGACKCAQKVPDKSFNANDIYEENVNIGYGSLVFETRELLEQTSNRLPAGSMVYISQSDIFLIKIDQSNNVWRTISMEPKSRTWILPIPMNIPKHET---TYPPYQNGFSK--KLHLIALITPTMGDLKPMLRQPGGYSGAAFQCQQAGEMYGYGRFMHPFINTDPFHLKFSINQKH-MNLPIYNSRGETLASNFNALLSGNDDLQNEILDFKKEPISRDILSQCVWLGKEPSGNDIEYNVK 4320
            L F I QKG KGE G  G  GE+G  G  G +G C  + C+ +LP    +KGD+G+ G C+   C   ++I+      G+KGD G++G + ++ D + I  +  +    IK+ I+   + +N    KGEPG+C C    P ++            I   S+V    + L+  S  +P G MV++   +I L+KID   N WR + +E     W          H+T   T+ P  + F+   KL LIAL  PT GDL+    +PG YSG+++ CQ+    YG GR  +P +NTD F   + + +K+   +P+ N R E +AS+F  LL  + ++Q  ILDF+ + I  +I   CVW+G++PS  +I+  +K
Sbjct:  631 LRFDILQKGVKGEKGGYGQQGERGTTGMPGKDGKCLLNQCN-SLPPIKGTKGDRGETGYCSLDNCKSNIIIEK-----GVKGDKGEQGIKEDNGDGLKISDVLAILVPEIKSSIDDY-VSRNVINMKGEPGSCSC----PVETSRGEG------KIKTQSIVLNDGKTLKSLSFNMPVGQMVFLIVENILLVKIDDVKNRWRIVKLESAESDWYFATETQ--NHQTLLPTFGPISSMFNTAFKLMLIALPKPTGGDLRSDQFEPGAYSGSSYLCQKQAYNYGLGRAFYPLLNTDMFDFNYLLPEKYRYGVPVVNRRNEKIASSFTDLLKPSVEMQASILDFRGDSIMSEINEPCVWIGEKPSLYEIKVLLK 982          

HSP 2 Score: 92.4337 bits (228), Expect = 1.616e-18
Identity = 72/245 (29.39%), Postives = 126/245 (51.43%), Query Frame = 2
Query:   65 KEWDLLYLLKKENNIHLS---DDITLSLSGSTNYSQFILAAKQIFSQNNLPSTFVVYIKVQLKTLTIS-PMTIFSLRDPNNKARFQMKLRMIPGFIKKTELNVVLNPVSS--NGIEVNVNFTLPFIHTDIWTFGMLFKSSKITLYAVCDDINRTFGYQTMQIPSGLGKMLFSEGAVMHLFSD---DHQTDLLEGEIYEITFANFFRKLNQICN-QGGIEGSGGHEKQKIERKSPGNHLLVTEKMD 769
            KEW+LL +++++  I LS    D  L+L+   +  QF   A+ IF +  + S   +YIK       IS   TI  +RDP NK R  ++     G  K+  L +V +P+S+  N  +  +  T+PF+++  WT G+L ++ KIT+Y  CDDI + +GY  +     + + LF  G  ++L ++   +   ++ EG + E    N       +C  +  +EGSG   K K + K  GN+++ +  ++
Sbjct:   30 KEWNLLTMIEEKYKIGLSATDSDFLLNLTSKEHGFQF--PAQTIFPKLKIVSNAFIYIKF----FPISTAFTILKIRDPLNKVRLDIRGYQQLGHFKQFRLVIVYSPISNIENRFKNYMELTIPFLNS-AWTLGVLIENKKITVYTSCDDIFKPYGYHQVSNTYPVNQQLFYSGTTLYLLNNGEINGNKEIFEGTVSEFVLTNKNNLNEYMCRKEEMLEGSGSQTK-KWKPKYIGNYVITSSTIE 266          
The following BLAST results are available for this feature:
BLAST of MIP20649p vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
COL18A11.091e-1024.64collagen type XVIII alpha 1 chain [Source:HGNC Sym... [more]
COL18A11.233e-1024.64collagen type XVIII alpha 1 chain [Source:HGNC Sym... [more]
COL18A12.008e-725.00collagen type XVIII alpha 1 chain [Source:HGNC Sym... [more]
COL18A12.589e-725.00collagen type XVIII alpha 1 chain [Source:HGNC Sym... [more]
back to top
BLAST of MIP20649p vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MIP20649p vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mp2.863e-1222.10gene:FBgn0260660 transcript:FBtr0339904[more]
Mp3.163e-1222.10gene:FBgn0260660 transcript:FBtr0301958[more]
Mp9.521e-1121.92gene:FBgn0260660 transcript:FBtr0306638[more]
Mp9.861e-1122.07gene:FBgn0260660 transcript:FBtr0339905[more]
Mp1.014e-1021.92gene:FBgn0260660 transcript:FBtr0301108[more]
back to top
BLAST of MIP20649p vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
col15a1b1.276e-827.62collagen, type XV, alpha 1b [Source:ZFIN;Acc:ZDB-G... [more]
col15a1b1.288e-827.62collagen, type XV, alpha 1b [Source:ZFIN;Acc:ZDB-G... [more]
col15a1b1.321e-827.62collagen, type XV, alpha 1b [Source:ZFIN;Acc:ZDB-G... [more]
otol1b3.938e-736.15otolin 1b [Source:ZFIN;Acc:ZDB-GENE-080416-3][more]
back to top
BLAST of MIP20649p vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
COL18A11.057e-727.81collagen type XVIII alpha 1 [Source:NCBI gene;Acc:... [more]
COL18A11.468e-727.81collagen type XVIII alpha 1 [Source:NCBI gene;Acc:... [more]
COL18A11.581e-727.81collagen type XVIII alpha 1 [Source:NCBI gene;Acc:... [more]
COL18A12.251e-727.81collagen type XVIII alpha 1 [Source:NCBI gene;Acc:... [more]
COL18A12.306e-727.81collagen type XVIII alpha 1 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of MIP20649p vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Col15a12.213e-825.81collagen, type XV, alpha 1 [Source:MGI Symbol;Acc:... [more]
Col15a12.417e-825.81collagen, type XV, alpha 1 [Source:MGI Symbol;Acc:... [more]
Col15a12.512e-825.81collagen, type XV, alpha 1 [Source:MGI Symbol;Acc:... [more]
Col15a14.352e-825.81collagen, type XV, alpha 1 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of MIP20649p vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5UQ50|COLL6_MIMIV1.595e-838.17Collagen-like protein 6 OS=Acanthamoeba polyphaga ... [more]
sp|Q5UNS9|COLL7_MIMIV6.015e-845.12Collagen-like protein 7 OS=Acanthamoeba polyphaga ... [more]
sp|O35206|COFA1_MOUSE1.691e-725.81Collagen alpha-1(XV) chain OS=Mus musculus OX=1009... [more]
sp|P39060|COIA1_HUMAN9.641e-725.00Collagen alpha-1(XVIII) chain OS=Homo sapiens OX=9... [more]
sp|Q5UPS6|COLL5_MIMIV3.447e-644.57Collagen-like protein 5 OS=Acanthamoeba polyphaga ... [more]
back to top
BLAST of MIP20649p vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4D6FZI35.324e-11596.77Mp-1 (Fragment) OS=Schmidtea mediterranea OX=79327... [more]
A0A5K4EKS98.260e-5534.38Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A0X3NU022.161e-4633.17Endostatin domain-containing protein (Fragment) OS... [more]
A0A0X3NUG71.339e-4333.17Collagen alpha-1(XVIII) chain (Fragment) OS=Schist... [more]
A0A0X3PDF31.905e-4333.17Endostatin domain-containing protein (Fragment) OS... [more]
back to top
BLAST of MIP20649p vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSAMXT00000057821.12.740e-1028.96pep primary_assembly:Astyanax_mexicanus-2.0:13:785... [more]
ENSAMXT00000043399.11.401e-827.60pep primary_assembly:Astyanax_mexicanus-2.0:13:785... [more]
back to top
BLAST of MIP20649p vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000009156.12.769e-829.12pep scaffold:Pmarinus_7.0:GL476573:61536:110082:-1... [more]
ENSPMAT00000003519.15.850e-724.34pep scaffold:Pmarinus_7.0:GL476336:685424:702873:1... [more]
back to top
BLAST of MIP20649p vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MIP20649p vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MIP20649p vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSORLT00000031348.13.107e-826.97pep primary_assembly:ASM223467v1:17:19717601:19722... [more]
ENSORLT00000037359.12.833e-632.23collagen alpha-1(X) chain-like [Source:NCBI gene;A... [more]
back to top
BLAST of MIP20649p vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000075164.10.000e+099.35SMESG000075164.1[more]
SMESG000081921.18.789e-4733.69SMESG000081921.1[more]
SMESG000081921.19.146e-4733.69SMESG000081921.1[more]
SMESG000081921.11.140e-4633.69SMESG000081921.1[more]
SMESG000081921.11.198e-4633.69SMESG000081921.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022127 ID=SMED30022127|Name=MIP20649p|organism=Schmidtea mediterranea sexual|type=transcript|length=4528bp
GAAAGTTTATTTTATACTTGGATTATTTGTCAATTTTACAAATATATGTC
AGTCTGTTCAAGACAAAGAATGGGATCTACTTTATTTATTGAAAAAAGAA
AATAATATTCACTTGTCTGATGATATTACACTAAGCTTATCGGGATCGAC
AAATTATTCTCAGTTCATTTTGGCCGCCAAACAGATTTTCTCCCAAAACA
ATTTGCCGAGCACATTTGTCGTTTACATCAAGGTTCAACTCAAGACTTTG
ACGATATCTCCGATGACGATTTTCAGTTTGAGAGATCCAAATAACAAAGC
TCGATTTCAAATGAAATTGAGAATGATCCCTGGATTTATTAAAAAAACGG
AATTAAACGTCGTACTGAACCCGGTATCCTCGAATGGAATCGAAGTGAAC
GTCAATTTTACACTCCCATTTATACACACAGATATTTGGACATTTGGAAT
GTTGTTTAAGAGTTCAAAGATAACTCTGTATGCGGTTTGTGATGATATCA
ATAGGACTTTCGGTTATCAAACAATGCAAATCCCGAGTGGTCTCGGTAAA
ATGTTATTCAGTGAAGGAGCGGTAATGCACTTGTTTAGCGACGATCATCA
AACAGATTTATTAGAAGGCGAAATTTATGAAATAACATTTGCAAACTTTT
TCCGCAAGTTGAATCAAATTTGTAATCAAGGGGGAATAGAAGGAAGTGGA
GGTCACGAAAAGCAGAAAATCGAAAGGAAATCTCCTGGAAATCATCTTTT
AGTTACAGAGAAGATGGATGAAGATGATACAACAACTCTTTCTACAACAA
CTGAAACTCTTTCTACAACAAATTTTAGGAGTGTGACATCTAGCAGGAAA
TCAGAAAGGGAACAGACATTAATAAAACAAATTGAAAGAGAAAAGAATGT
TACAGGGGAAAAAGATCAAGTCCTGGAATTTTCAATGAACGATATGGATA
GTTCAAAGTCTGATGGAAAGATATTCAATCAAAGCTTGCAAAGCTTAACA
ACTAAAACAGACAATAAGAAGAACATAACATTTAATATACCAATTAATCA
TAGAAAAGAATTCAGTGAAGTTAGCAACATGTCTTTAATTAAAAAGACAT
CAATGAATTTAGAAACAAGTAGTAGTGTAAAAAAGACCACCATCAAACAA
AATGCCCTCAATACTACAACTCTGTATACGTCTACTTCAACCATTGGCAA
AGATGAGGACGATCTTGGAGAGATTGATTTGAATATGTTCGATATTGAAT
CCACATCAGGAACTTTGACTACTGAAAAGTTAACTGATGAAATTAAAACC
GATTCAGAAATAAGATATGGAAAGAGCACAAGACGTAATAAAATATATGA
TAAAAAGTTATCAAATGAAAGTTTGCAAAATGACACGGTAATAAATAATA
ATGTGAATAAAAAATTTAAAATGGAAAATAGTTCGATTAAAGATGATAAT
ACTGTTGAAAAGGCTATCAATATTTTAACACAGAATCCAAATATTAGATC
CACGACTATCCCAGTTTTAGACACCTCATCCATGCCTCCCAGATCTAATA
CGAATTCTGGTACATCTACATATGTCTCTAGTCAAACCCAGGACAAACTC
AACTATGAGCCTATGGTCGAGAATAAAGAAATGTCATCTACTGAAAAATC
AACTAAATACTCTAAAAGTGATAAAATATCTTCAGGTTTAATAGAAACCT
CAAAGGAATCTTCTCAAATATTGACTGAGGTCACTGAGATTTCTTATGAC
AGTAATTCTCAAATTTCTGTTGAAATAAGTAAGAAGCATGTCTCAGAAGG
TACTGAAGGTAAAAAATCAAATACTTCTCCACCACAGGAAACAGACGAAA
CTATAAAAGTGAAAACTACGGAAAATAGCACAATCTTACAATCAACTACT
TTCCCAATTTATTCACATTCCAAGCAGCCTGTTTCGAACGCATCGGGCAA
TATCACTCATAAATACTTTGAGCAAAAGACTTCTGACAATTTAAAATTAA
TAACTGAAAGCAATAAAGAAACCAAAACAACCTCAATAGGTTCCACGAAA
CGTTTGATGAATACTACCTACATTTCCAAATCTAAGTCATCAATAGGAAA
AGTTAAGAGTAAGTATGATGTCACTCAGCAATCCCAAACAGTAACTCCCA
CAAGTGCTCCACAAAATTCAACCATATTTTCCCCATTGGTACCCAATGTC
AGAGATTCTGCACATAATTTATCAAAAGCAACTACAGAATCTATTCAAAC
AGGAATTTACAATCATACTAAAGAAAGAATAATATTAAGAATTTCCGGTA
ATCTGACAGAGTTTGACCAAAATGAATATACAAGTACACCTATAAAGGTC
TTGGAATTTAATGAAACCAAACCGAATGGAACTTTTTCCAAAATTACAAC
TGCTCCAATTCTTTTCAATAAGTCAATAACCAGCTTAACAAGGCAAAGTG
AATCCCAAACCTCCACACATGCGATAACATCTTCAACTAGAAAAGTAAAA
ACTGAAAAGAGTACAACTTTATCGTCAATGAAATTGGATACGAGACTTCC
AATGGAGTCGAACAAAACGCTTGGTATCATAGCTAATGGTCGAAAAAATG
AGACAAATAAATACCAATTCTATACTACAACAAATTTGTCTTTAGCAAAT
AAAACAGATATCTCACAGAAGTCTGAGATTAGCACCAATTCCTCTGAATT
CTTAATTCGTTCTACCTCTCCTTCAAATATTTCTTCAACGGAAATTCTCA
TTGAAAATCAAACACTGATGAAAAGTAATGAGACTGTCACTCAAAGTCCT
TCTCAATCCAGCAGTAAAGAATATTCCACCTTTTCATCATCCTCAAATAC
AATGAAAATGACTGAACCTTCCAATATTTCAACGCCAACCACAGAAAGTA
GTTCCATTAACAATACTCAGTCACCAATTATTGATTCCAAAACAGATGAT
ATGACAAAAACAGCAATAAATACTAAACAAACAACAACTGGTATACCAAC
CTCCCGGTTTCCAGGAAACGCAACCTCCGCCAGATCGGGCACCATATTTG
AAAACATATGCAAGAGGGTTATATTTTCAAAAAAAGTCCAAAGCCCCACT
TATTCACCAAGTTTAACAATTTTGCAGACATCCACAATAGAAAAAGAAAA
AACCCAGCCTTCAGAGAGCTCACAAGACGAATGTAGCGTTCTTTCAAAAT
TGAGGTTGTCGGTATGGTTTACAATTATATTTCCACATGGGATATCATTT
TATGGTTTCAGATACCACAGAAAGGTGCTAAAGGAGAAATGGGACTGAAA
GGCGATATTGGGGAAAAAGGCGATAGAGGTCCATCAGGAATAAATGGTGT
ATGCGATGCTTCAATATGTAGCGTTAATCTTCCATCAAAAGGTGATAAAG
GTGATCCAGGACAATGCAATAAAAGTCAATGCCTAGTAATTAAGGGTGAA
AGAGGACCAATAGGTTTGAAAGGCGATATGGGTCAAAAGGGTGAAAGGGG
AGAAAGCAACGACATAAATATAGAATTAATTCGATATCTTACTCATTCTA
TAATTAAAGCTCAAATAGAATCAATGACCTTATTCCAAAATGGTAAAGGA
GAAAAGGGTGAGCCAGGAGCATGTAAATGTGCTCAGAAAGTTCCTGATAA
AAGTTTTAATGCCAATGACATTTATGAAGAAAATGTAAATATTGGATATG
GATCCTTAGTTTTTGAAACTCGAGAACTTTTGGAACAAACATCTAATCGG
CTGCCAGCGGGATCTATGGTGTACATTTCACAAAGCGATATTTTCTTAAT
AAAAATTGACCAGAGCAATAATGTATGGAGAACTATTTCTATGGAACCAA
AATCGAGAACTTGGATATTACCAATTCCAATGAACATTCCTAAACACGAA
ACTACTTATCCACCTTACCAAAATGGTTTTTCGAAGAAGTTACATTTAAT
AGCGTTGATCACTCCAACTATGGGTGATTTGAAACCCATGCTTCGACAAC
CTGGAGGGTATAGTGGGGCAGCATTCCAATGCCAACAAGCAGGTGAAATG
TATGGATATGGACGATTTATGCACCCCTTTATCAATACGGATCCGTTCCA
TTTGAAGTTTAGCATTAATCAGAAACACATGAATCTACCTATTTATAACA
GTAGGGGAGAAACTTTAGCCAGTAATTTCAACGCATTGTTGTCAGGAAAT
GACGATTTGCAAAACGAAATTCTTGATTTTAAGAAAGAACCGATTTCAAG
AGATATTTTATCTCAATGTGTTTGGCTTGGTAAAGAGCCTTCTGGGAATG
ATATTGAATATAACGTAAAAACCGAATCGAGATGCGTGAACTGGATGAGC
CGAGAGCCCCATATCCACGGACTTGCTGCATTCATTAATTCGACGAAATC
TCTATTCGATGAATACAACAGAGGGCTACTCTCTTGTAGTCGACAATGCT
ATGTTTTATGTATACAAACTGAACCATATGACCTTTAATTTTTTTTATAG
ATTGTATGTATATATATATATATATATA
back to top

protein sequence of SMED30022127-orf-1

>SMED30022127-orf-1 ID=SMED30022127-orf-1|Name=SMED30022127-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1099bp
KVYFILGLFVNFTNICQSVQDKEWDLLYLLKKENNIHLSDDITLSLSGST
NYSQFILAAKQIFSQNNLPSTFVVYIKVQLKTLTISPMTIFSLRDPNNKA
RFQMKLRMIPGFIKKTELNVVLNPVSSNGIEVNVNFTLPFIHTDIWTFGM
LFKSSKITLYAVCDDINRTFGYQTMQIPSGLGKMLFSEGAVMHLFSDDHQ
TDLLEGEIYEITFANFFRKLNQICNQGGIEGSGGHEKQKIERKSPGNHLL
VTEKMDEDDTTTLSTTTETLSTTNFRSVTSSRKSEREQTLIKQIEREKNV
TGEKDQVLEFSMNDMDSSKSDGKIFNQSLQSLTTKTDNKKNITFNIPINH
RKEFSEVSNMSLIKKTSMNLETSSSVKKTTIKQNALNTTTLYTSTSTIGK
DEDDLGEIDLNMFDIESTSGTLTTEKLTDEIKTDSEIRYGKSTRRNKIYD
KKLSNESLQNDTVINNNVNKKFKMENSSIKDDNTVEKAINILTQNPNIRS
TTIPVLDTSSMPPRSNTNSGTSTYVSSQTQDKLNYEPMVENKEMSSTEKS
TKYSKSDKISSGLIETSKESSQILTEVTEISYDSNSQISVEISKKHVSEG
TEGKKSNTSPPQETDETIKVKTTENSTILQSTTFPIYSHSKQPVSNASGN
ITHKYFEQKTSDNLKLITESNKETKTTSIGSTKRLMNTTYISKSKSSIGK
VKSKYDVTQQSQTVTPTSAPQNSTIFSPLVPNVRDSAHNLSKATTESIQT
GIYNHTKERIILRISGNLTEFDQNEYTSTPIKVLEFNETKPNGTFSKITT
APILFNKSITSLTRQSESQTSTHAITSSTRKVKTEKSTTLSSMKLDTRLP
MESNKTLGIIANGRKNETNKYQFYTTTNLSLANKTDISQKSEISTNSSEF
LIRSTSPSNISSTEILIENQTLMKSNETVTQSPSQSSSKEYSTFSSSSNT
MKMTEPSNISTPTTESSSINNTQSPIIDSKTDDMTKTAINTKQTTTGIPT
SRFPGNATSARSGTIFENICKRVIFSKKVQSPTYSPSLTILQTSTIEKEK
TQPSESSQDECSVLSKLRLSVWFTIIFPHGISFYGFRYHRKVLKEKWD*
back to top

protein sequence of SMED30022127-orf-2

>SMED30022127-orf-2 ID=SMED30022127-orf-2|Name=SMED30022127-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=425bp
MVYNYISTWDIILWFQIPQKGAKGEMGLKGDIGEKGDRGPSGINGVCDAS
ICSVNLPSKGDKGDPGQCNKSQCLVIKGERGPIGLKGDMGQKGERGESND
INIELIRYLTHSIIKAQIESMTLFQNGKGEKGEPGACKCAQKVPDKSFNA
NDIYEENVNIGYGSLVFETRELLEQTSNRLPAGSMVYISQSDIFLIKIDQ
SNNVWRTISMEPKSRTWILPIPMNIPKHETTYPPYQNGFSKKLHLIALIT
PTMGDLKPMLRQPGGYSGAAFQCQQAGEMYGYGRFMHPFINTDPFHLKFS
INQKHMNLPIYNSRGETLASNFNALLSGNDDLQNEILDFKKEPISRDILS
QCVWLGKEPSGNDIEYNVKTESRCVNWMSREPHIHGLAAFINSTKSLFDE
YNRGLLSCSRQCYVLCIQTEPYDL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000061enteric musculature
PLANA:0000101muscle cell
PLANA:0000106ciliated epithelial cell
PLANA:0000478pharynx musculature
PLANA:0002028dorsal-ventral muscle cell
PLANA:0003104enteric muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR010515Collagenase_NC10/endostatin
IPR016186C-type_lectin-like/link_sf
IPR016187CTDL_fold
Vocabulary: biological process
TermDefinition
GO:0007155cell adhesion
Vocabulary: molecular function
TermDefinition
GO:0005198structural molecule activity
Vocabulary: cellular component
TermDefinition
GO:0031012extracellular matrix
GO:0005581collagen trimer
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 507..529
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 594..617
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 603..617
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 815..840
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 925..971