SMED30022121

Overview
NameSMED30022121
Smed IDSMED30022121
Length (bp)1192
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30022121 (SMED30022121) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30022121 (SMED30022121) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30022121 (SMED30022121) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30022121 (SMED30022121) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022121

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30022121SMESG000054581.1 Contig3080GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30022121SMESG000042798.1 PL05012B2F11ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30022121SMESG000042798.1 Contig3080GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30022121SMESG000042798.1 dd_Smed_v4_2204_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30022121SMESG000042798.1 dd_Smed_v4_2204_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30022121SMESG000042798.1 dd_Smed_v4_2204_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022121SMESG000042798.1 dd_Smed_v4_2204_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30022121SMESG000042798.1 dd_Smed_v4_2204_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30022121SMESG000042798.1 dd_Smed_v4_2204_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30022121SMESG000042798.1 dd_Smed_v4_2204_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022121SMESG000042798.1 Contig50141newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30022121SMESG000042798.1 dd_Smed_v6_2204_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30022121SMESG000042798.1 dd_Smed_v4_2204_1_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022121SMESG000042798.1 dd_Smed_v4_2204_1_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30022121 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000531:12975..20147 -5830
Homology
BLAST of SMED30022121 vs. Ensembl Fly
Match: kune (gene:FBgn0033032 transcript:FBtr0086037)

HSP 1 Score: 82.4185 bits (202), Expect = 1.368e-17
Identity = 67/272 (24.63%), Postives = 121/272 (44.49%), Query Frame = 2
Query:   68 LYLACAAFIFNLVAFV----SPYWIV--ARPEYPSQFVRLGLWVACFDNYIHPEDYVSKMYKGCWYVYWPEYDYIRDWLNPPWFYGVQMMSSISLLCNGGAMILVLLKFVNVINIVDKNTNILALVLQFLAFCCYI------IVIVAMGVMSKDREWMPRPDHNQVSWSFAFAVLGGFFTIFCFFNLIIHYLVYTWAPSVKPKDKADYSELPLREDCNSGLYKSQQGSGLGVYPSASNIY-SHVGTKPNSKVGTTSGATASAKVREAMSQKI 844
            L +A  A +F+L+ FV    +PYW+V   R + P +F  LGLW  CF+N+     +    + GC +V+  EY  I D+L P ++  VQ+ +++  +     M LV++          ++ +   ++L  +  C  +      I +V  G     R+WMP   +N + WSFA  V+G    +       + YLV       + +     +E+  RE    G    Q      V P+A + Y S+  ++P+        + +++ V+  +   I
Sbjct:    8 LQVALCASVFSLICFVIAFSTPYWLVTDGRLQNP-RFTNLGLWEVCFNNFQDIHRFFDNSFNGCLWVFEEEYYIIHDFLLPGFYISVQLFATLCFV-----MCLVVIPLTVAFLRTSRDDDRYMVLLLAIGSCQVVGSVFGFIAVVIFGAKGDSRDWMPGWQNNDMGWSFALGVVGAVLLL----PSGVLYLV-----EARRERYKRLNEISNREISEYGDEYYQNQGPSAVLPTAPSPYQSYFASEPSRPRRPQQSSASNSAVQGGIQTDI 264          
BLAST of SMED30022121 vs. Ensembl Fly
Match: pck (gene:FBgn0013720 transcript:FBtr0070256)

HSP 1 Score: 79.337 bits (194), Expect = 1.440e-16
Identity = 50/177 (28.25%), Postives = 85/177 (48.02%), Query Frame = 2
Query:   62 FALYLACAAFIFNLVAFVSPYWIVARPEYPSQFVRLGLWVACFDNYIHPEDYVSKMYKGCWYVYWPEYDYIRDWLNPPWFYGVQMMSSISLLCNGGAMILVLLKFVN------------VINIVDKNTNILALVLQFLAFCCYIIVIVAMGVMSKDREWMPRPDHNQVSWSFAFAVL 556
            F   +  A+F   +++F SPYWI +  E  + F  +GLW  CF ++++P+    K + GC  ++  EY  IR++L P W   VQ   ++S +     + L+ L  +             ++ +    T I +L + FLA C +       G  +  R+WM  P  N + WS+A AV+
Sbjct:   31 FGAIVTFASFFVLMMSFCSPYWIESYEETRASFKNMGLWQYCFKDFVYPKYAFLKQFTGCHNIFSHEYYVIREYLLPGWLMAVQGFVTMSFIIVFLVLALLSLTIIRLPLKAVLQYEWLLVRLSYMGTAISSLFM-FLAVCIF-------GGCAYRRDWMMYPKFNVLGWSYALAVV 199          
BLAST of SMED30022121 vs. Ensembl Fly
Match: pck (gene:FBgn0013720 transcript:FBtr0070255)

HSP 1 Score: 79.337 bits (194), Expect = 1.440e-16
Identity = 50/177 (28.25%), Postives = 85/177 (48.02%), Query Frame = 2
Query:   62 FALYLACAAFIFNLVAFVSPYWIVARPEYPSQFVRLGLWVACFDNYIHPEDYVSKMYKGCWYVYWPEYDYIRDWLNPPWFYGVQMMSSISLLCNGGAMILVLLKFVN------------VINIVDKNTNILALVLQFLAFCCYIIVIVAMGVMSKDREWMPRPDHNQVSWSFAFAVL 556
            F   +  A+F   +++F SPYWI +  E  + F  +GLW  CF ++++P+    K + GC  ++  EY  IR++L P W   VQ   ++S +     + L+ L  +             ++ +    T I +L + FLA C +       G  +  R+WM  P  N + WS+A AV+
Sbjct:   31 FGAIVTFASFFVLMMSFCSPYWIESYEETRASFKNMGLWQYCFKDFVYPKYAFLKQFTGCHNIFSHEYYVIREYLLPGWLMAVQGFVTMSFIIVFLVLALLSLTIIRLPLKAVLQYEWLLVRLSYMGTAISSLFM-FLAVCIF-------GGCAYRRDWMMYPKFNVLGWSYALAVV 199          
BLAST of SMED30022121 vs. Ensembl Fly
Match: sinu (gene:FBgn0010894 transcript:FBtr0077136)

HSP 1 Score: 61.6178 bits (148), Expect = 1.716e-10
Identity = 57/217 (26.27%), Postives = 93/217 (42.86%), Query Frame = 2
Query:   86 AFIFNLVAFVSPYWIVARPEYP-SQFVRLGLWVACFDNYIHP-EDYVSKMYKGCWYVYWP---EYDYIRDWLNPPWFYGVQMMSSIS----LLCNGGAMILVLL------KFVNVINIVDKNTNILALVLQFLAFCCYIIVIVAMGVMSKDREWMPRPDHNQVSWSFAFAVLGGFFTIFCFFNLIIHYLVYTWAPSVKPKDKADYSELPLREDCNSG 691
            AF F ++AF +P W+V+      ++  RLGLWV CF +     +D   + + GC +VY P    YD IR +L P +    Q   +++    L+   G ++ +L        F+ +I         L  VL        I VIV  G  +++  WMP   +N   WSF  A +G   T       ++   ++     V+ K +  + E   R +   G
Sbjct:   46 AFAFIVIAFATPSWLVSDYRITGAKLDRLGLWVHCFRSLPDVNDDSQRRFFVGCRWVYDPFTTGYDEIRGFLLPAFMIATQFFYTLAFIGMLVSAIGVLVFILCAGPDQKHFITLIKS-------LGYVLLGAGVSAAIAVIVFAGFGNRN-GWMPEHANNWFGWSFILACVGTVLT-------LVASTLFLSEAHVQHKKRIQFKESQTRFELVRG 247          
BLAST of SMED30022121 vs. Ensembl Fly
Match: pck (gene:FBgn0013720 transcript:FBtr0100198)

HSP 1 Score: 47.3654 bits (111), Expect = 2.373e-6
Identity = 20/64 (31.25%), Postives = 36/64 (56.25%), Query Frame = 2
Query:   62 FALYLACAAFIFNLVAFVSPYWIVARPEYPSQFVRLGLWVACFDNYIHPEDYVSKMYKGCWYVY 253
            F   +  A+F   +++F SPYWI +  E  + F  +GLW  CF ++++P+    K + GC  ++
Sbjct:   31 FGAIVTFASFFVLMMSFCSPYWIESYEETRASFKNMGLWQYCFKDFVYPKYAFLKQFTGCHNIF 94          
BLAST of SMED30022121 vs. TrEMBL
Match: A0A430QLE7 (Uncharacterized protein OS=Schistosoma bovis OX=6184 GN=DC041_0005118 PE=4 SV=1)

HSP 1 Score: 253.062 bits (645), Expect = 4.617e-77
Identity = 147/375 (39.20%), Postives = 204/375 (54.40%), Query Frame = 2
Query:   23 KMEKEKKISVNFKFALYLACAAFIFNLVAFVSPYWIVARPEYPSQFVRLGLWVACFDNYIHPEDYVSKMYKGCWYVYWPEYDYIRDWLNPPWFYGVQMMSSISLLCNGGAMILVLLKFVNVINIVDKNTNILALVLQFLAFCCYIIVIVAMGVMSKDREWMPRPDHNQVSWSFAFAVLGGFFTIFCFFNLIIHYLV-----YTWAPSVKPK------------------DKADYSE--------LP-LREDCNSGLYKSQQGSGLG-----VYPSASNIYSHVGTKPNSKVGT---TSGATASAKVREAM-SQKIRQNANDKNQHGGSMSSLNSAGIPKNKIGSTHSLASIGRLPDPNPRG-SMSSLHMNRQPKR 1021
            K+   ++  ++F  A+  +  A IFN++ FVSP+WIV++ E    F RLGLW  CFD +I PEDYVSK Y+GCWY+Y+PEY YIR WLNPPWFY VQ++S ISL+CN   +++++L    V    ++  + + + LQ +A  C+++VI+ MGVMSKDREW+PRPD N +SWSFAFAVL GFFTIFC F L+ HYL      +   P ++ K                   KA  +E        +P L     S     Q GS +G     + P  S+I S     P +  GT   TSGAT SAK+RE++ +Q+I     +    G  +            + + H   S   L +PN R  S     M RQ +R
Sbjct:    2 KLGTIRRKHISFSMAVTFSFLAAIFNIIGFVSPFWIVSKSESNLGFQRLGLWEVCFDQFIFPEDYVSKAYQGCWYIYYPEYKYIRFWLNPPWFYLVQILSIISLICNLAGLLMIILVLCEVYGTKERKPHFVVMGLQSVALACFVVVIIFMGVMSKDREWLPRPDLNMLSWSFAFAVLAGFFTIFCLFGLVTHYLSVESKRFMQDPLLRQKFIGSNPYYASQKNISYYDGKAAATESKIGGSTTVPSLFATVPSTFVGYQPGSQIGPTSTLMAPGKSSILSRGTIAPGAVGGTVAGTSGATVSAKLRESLEAQRIAVLEANLRAAGSELF---------QNVENAHGPTSTQSLHNPNIRSESRYDGTMTRQAER 367          
BLAST of SMED30022121 vs. TrEMBL
Match: A0A094ZNA0 (Uncharacterized protein OS=Schistosoma haematobium OX=6185 GN=MS3_04436 PE=4 SV=1)

HSP 1 Score: 251.136 bits (640), Expect = 1.933e-76
Identity = 145/376 (38.56%), Postives = 200/376 (53.19%), Query Frame = 2
Query:   23 KMEKEKKISVNFKFALYLACAAFIFNLVAFVSPYWIVARPEYPSQFVRLGLWVACFDNYIHPEDYVSKMYKGCWYVYWPEYDYIRDWLNPPWFYGVQMMSSISLLCNGGAMILVLLKFVNVINIVDKNTNILALVLQFLAFCCYIIVIVAMGVMSKDREWMPRPDHNQVSWSFAFAVLGGFFTIFCFFNLIIHYLVYTW--------------------------------APSVKPKDKADYSELPLREDCNSGLYKSQQGSGLG-----VYPSASNIYSHVGTKPNSKVGT---TSGATASAKVREAM-SQKIR-QNANDKNQHGGSMSSLNSAGIPKNKIGSTHSLASIGRLPDPNPRG-SMSSLHMNRQPKR 1021
            K+   ++  ++F  A+  +  A IFN++ FVSP+WIV++ E    F RLGLW  CFD +I PEDYVSK Y+GCWY+Y+PEY YIR WLNPPWFY VQ++S ISL+CN   +++++L    V    ++  + + + LQ +A  C+++VI+ MGVMSKDREW+PRPD N +SWSFAFAVL GFFTIFC F L+ HYL                                    A + + K     +   L     S     Q GS +G     + P  S+I S     P +  GT   TSGAT SAK+RE++ +Q+I    AN +        ++ +A          H   S   L +PN R  S     M RQ +R
Sbjct:    2 KLGTIRRKHISFSMAVTFSFLAAIFNIIGFVSPFWIVSKSESNLGFQRLGLWEVCFDQFIFPEDYVSKAYQGCWYIYYPEYKYIRFWLNPPWFYLVQILSIISLICNLAGLLMIILVLCEVYGTKERKPHFVVMGLQSVALACFVVVIIFMGVMSKDREWLPRPDLNMLSWSFAFAVLAGFFTIFCLFGLVTHYLSVESKRFMQDRLLRQKFIGSNPYYASQKNISYYDGKAAATESKIGGSTTVPSLFATVPSTFVSYQPGSQIGPTSTLMAPGKSSILSRGTIAPGAVGGTVAGTSGATVSAKLRESLEAQRIAVLEANLRAAESELFQNVENA----------HGPTSTQSLDNPNIRSESRYDGTMTRQAER 367          
BLAST of SMED30022121 vs. TrEMBL
Match: A0A183PDJ2 (Uncharacterized protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS12428 PE=4 SV=1)

HSP 1 Score: 250.366 bits (638), Expect = 4.018e-76
Identity = 146/375 (38.93%), Postives = 203/375 (54.13%), Query Frame = 2
Query:   23 KMEKEKKISVNFKFALYLACAAFIFNLVAFVSPYWIVARPEYPSQFVRLGLWVACFDNYIHPEDYVSKMYKGCWYVYWPEYDYIRDWLNPPWFYGVQMMSSISLLCNGGAMILVLLKFVNVINIVDKNTNILALVLQFLAFCCYIIVIVAMGVMSKDREWMPRPDHNQVSWSFAFAVLGGFFTIFCFFNLIIHYLV-----YTWAPSVKPK------------------DKADYSE--------LP-LREDCNSGLYKSQQGSGLG-----VYPSASNIYSHVGTKPNSKVGT---TSGATASAKVREAM-SQKIRQNANDKNQHGGSMSSLNSAGIPKNKIGSTHSLASIGRLPDPNPRG-SMSSLHMNRQPKR 1021
            K+   ++  ++F  A+  +  A IFN++ FVSP+WIV++      F RLGLW  CFD +I PEDYVSK Y+GCWY+Y+PEY YIR WLNPPWFY VQ++S ISL+CN   +++++L    V    ++  + + + LQ +A  C+++VI+ MGVMSKDREW+PRPD N +SWSFAFAVL GFFTIFC F L+ HYL      +   P ++ K                   KA  +E        +P L     S     Q GS +G     + P  S+I S     P +  GT   TSGAT SAK+RE++ +Q+I     +    G  +            + + H   S   L +PN R  S     M RQ +R
Sbjct:    2 KLGTIRRKHISFSLAVTFSFLAAIFNIIGFVSPFWIVSKSGSNLGFQRLGLWEVCFDQFIFPEDYVSKAYQGCWYIYYPEYKYIRFWLNPPWFYLVQILSIISLICNLAGLLMIILVLCEVYGTKERKPHFVVMGLQSVALACFVVVIIFMGVMSKDREWLPRPDLNMLSWSFAFAVLAGFFTIFCLFGLVTHYLSVESKRFMQDPLLRQKFIGTNPYYASQKNISYYDGKAAATESKIGGSTTVPSLFATVPSTFVNYQPGSQIGPTSTLMAPGKSSILSRGTIAPGAVGGTVAGTSGATVSAKLRESLEAQRIAVLEANLRAAGSELF---------QNVENAHGPTSTQSLHNPNIRSESRYDGTMTRQAER 367          
BLAST of SMED30022121 vs. TrEMBL
Match: A0A183LE47 (Uncharacterized protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS2072 PE=4 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 9.917e-76
Identity = 146/361 (40.44%), Postives = 197/361 (54.57%), Query Frame = 2
Query:   65 ALYLACAAFIFNLVAFVSPYWIVARPEYPSQFVRLGLWVACFDNYIHPEDYVSKMYKGCWYVYWPEYDYIRDWLNPPWFYGVQMMSSISLLCNGGAMILVLLKFVNVINIVDKNTNILALVLQFLAFCCYIIVIVAMGVMSKDREWMPRPDHNQVSWSFAFAVLGGFFTIFCFFNLIIHYLV-----YTWAPSVKPK------------------DKADYSE--------LP-LREDCNSGLYKSQQGSGLG-----VYPSASNIYSHVGTKPNSKVGT---TSGATASAKVREAM-SQKIRQNANDKNQHGGSMSSLNSAGIPKNKIGSTHSLASIGRLPDPNPRG-SMSSLHMNRQPKR 1021
            A+  +  A IFN+V FVSP+WIV++ E    F RLGLW  CFD +I PEDYVSK Y+GCWY+Y+PEY YIR WLNPPWFY VQ++S ISL+CN   +++++L    V    ++  + + + LQ +A  C+++VI+ MGVMSKDREW+PRPD N +SWSFAFAVL GFFTIFC F L+ HYL      +   P ++ K                   KA  +E        +P L     S     Q GS +G     + P  S+I S     P +  GT   TSGAT SAK+RE++ +Q+I     +    G  +            + + H   S   L +PN R  S     M RQ +R
Sbjct:    2 AVTFSFLAAIFNIVGFVSPFWIVSKSESNLGFQRLGLWEVCFDQFIFPEDYVSKAYQGCWYIYYPEYKYIRFWLNPPWFYLVQILSIISLICNLAGLLMIILVLCEVYGTKERKPHFVVMGLQSVALACFVVVIIFMGVMSKDREWLPRPDLNMLSWSFAFAVLAGFFTIFCLFGLVTHYLSVESKRFMQDPLLRQKFIGTNPYYASQKNISYYDGKAAATESKIGGSTTVPSLFATVPSNFVSYQPGSQIGPTSTLMAPGKSSILSRGTIAPGAVGGTVAGTSGATVSAKLRESLEAQRIAVLEANLRAAGSELF---------QNVENVHGPTSTQSLHNPNLRSESRYEGTMTRQAER 353          
BLAST of SMED30022121 vs. TrEMBL
Match: A0A5K4ELU5 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 247.669 bits (631), Expect = 4.426e-75
Identity = 145/374 (38.77%), Postives = 201/374 (53.74%), Query Frame = 2
Query:   23 KMEKEKKISVNFKFALYLACAAFIFNLVAFVSPYWIVARPEYPSQFVRLGLWVACFDNYIHPEDYVSKMYKGCWYVYWPEYDYIRDWLNPPWFYGVQMMSSISLLCNGGAMILVLLKFVNVINIVDKNTNILALVLQFLAFCCYIIVIVAMGVMSKDREWMPRPDHNQVSWSFAFAVLGGFFTIFCFFNLIIHYLV-----YTWAPSVKPK------------------DKADYSE--------LP-LREDCNSGLYKSQQGSGLG-----VYPSASNIYSHVGTKPNSKVGT---TSGATASAKVREAMSQKIRQNANDKNQHGGSMSSLNSAGIPKNKIGSTHSLASIGRLPDPNPRG-SMSSLHMNRQPKR 1021
            K+   ++  ++F  A+  +  A I N++ FVSP+WIV++ E    F RLGLW  CF+ +I PEDYVSK Y+GCWY+Y+PEY YIR WLNPPWFY VQ++S ISL+CN   +++++L    V    ++  + + + LQ +A  C+++VI+ MGVMSKDREW+PRPD N +SWSFAFAVL GFFTIFC F L+ HYL      +   P ++ K                   KA  +E        +P L     S     Q GS +G     + P  S+I S     P +  GT   TSGAT SAK+RE++  + R    + N          +A        + H   S   L +PN R  S     M RQ +R
Sbjct:    2 KLGTIRRKHISFSMAVTFSFLAAISNIIGFVSPFWIVSKSESNLGFQRLGLWEVCFEQFIFPEDYVSKAYQGCWYIYYPEYKYIRFWLNPPWFYLVQILSIISLICNLAGLLMIILVLCEVYGTKERKPHFVVMGLQSVALACFVVVIILMGVMSKDREWLPRPDLNMLSWSFAFAVLAGFFTIFCIFGLVTHYLSVESKRFMQDPLLRQKFLGTNPYYTSQRNISYYDGKAAATESKIGGAGTVPSLFTTIPSTFVSYQPGSQIGPTSTLMAPGKSSILSRGTIAPGAVGGTVAGTSGATVSAKLRESLEAQ-RIAVLEANLRAAESELFQNA-------ENAHGPTSTQSLYNPNIRSESRYEGTMTRQAER 367          
BLAST of SMED30022121 vs. Planmine SMEST
Match: SMESG000042798.1 (SMESG000042798.1)

HSP 1 Score: 708.753 bits (1828), Expect = 0.000e+0
Identity = 340/342 (99.42%), Postives = 341/342 (99.71%), Query Frame = 2
Query:   26 MEKEKKISVNFKFALYLACAAFIFNLVAFVSPYWIVARPEYPSQFVRLGLWVACFDNYIHPEDYVSKMYKGCWYVYWPEYDYIRDWLNPPWFYGVQMMSSISLLCNGGAMILVLLKFVNVINIVDKNTNILALVLQFLAFCCYIIVIVAMGVMSKDREWMPRPDHNQVSWSFAFAVLGGFFTIFCFFNLIIHYLVYTWAPSVKPKDKADYSELPLREDCNSGLYKSQQGSGLGVYPSASNIYSHVGTKPNSKVGTTSGATASAKVREAMSQKIRQNANDKNQHGGSMSSLNSAGIPKNKIGSTHSLASIGRLPDPNPRGSMSSLHMNRQPKRENYDDNSSVV 1051
            MEKEKKISVNFKFALYLACAAFIFNLVAFVSPYWIVARPEYPSQFVRLGLWVACFDNYIHPEDYVSKMYKGCWYVYWPEYDYIRDWLNPPWFYGVQMMSSISLLCNGGAMILVLLKFVN INIVDKNTNILALVLQFLAFCCYIIVIVAMGVMSKDREWMPRPDHNQVSWSFAFAVLGGFFTIFCFFNLIIHYLVYTWAPSVKPKDKADYSELPLREDCNSGLYKSQQGSGLGVYPSASNIYSHVGTKPNSKVGTTSGATASAKVREAMSQKIRQNANDKNQ+GGSMSSLNSAGIPKNKIGSTHSLASIGRLPDPNPRGSMSSLHMNRQPKRENYDDNSSVV
Sbjct:    1 MEKEKKISVNFKFALYLACAAFIFNLVAFVSPYWIVARPEYPSQFVRLGLWVACFDNYIHPEDYVSKMYKGCWYVYWPEYDYIRDWLNPPWFYGVQMMSSISLLCNGGAMILVLLKFVNAINIVDKNTNILALVLQFLAFCCYIIVIVAMGVMSKDREWMPRPDHNQVSWSFAFAVLGGFFTIFCFFNLIIHYLVYTWAPSVKPKDKADYSELPLREDCNSGLYKSQQGSGLGVYPSASNIYSHVGTKPNSKVGTTSGATASAKVREAMSQKIRQNANDKNQYGGSMSSLNSAGIPKNKIGSTHSLASIGRLPDPNPRGSMSSLHMNRQPKRENYDDNSSVV 342          
BLAST of SMED30022121 vs. Planmine SMEST
Match: SMESG000042798.1 (SMESG000042798.1)

HSP 1 Score: 686.797 bits (1771), Expect = 0.000e+0
Identity = 333/342 (97.37%), Postives = 334/342 (97.66%), Query Frame = 2
Query:   26 MEKEKKISVNFKFALYLACAAFIFNLVAFVSPYWIVARPEYPSQFVRLGLWVACFDNYIHPEDYVSKMYKGCWYVYWPEYDYIRDWLNPPWFYGVQMMSSISLLCNGGAMILVLLKFVNVINIVDKNTNILALVLQFLAFCCYIIVIVAMGVMSKDREWMPRPDHNQVSWSFAFAVLGGFFTIFCFFNLIIHYLVYTWAPSVKPKDKADYSELPLREDCNSGLYKSQQGSGLGVYPSASNIYSHVGTKPNSKVGTTSGATASAKVREAMSQKIRQNANDKNQHGGSMSSLNSAGIPKNKIGSTHSLASIGRLPDPNPRGSMSSLHMNRQPKRENYDDNSSVV 1051
            MEKEKKISVNFKFALYLACAAFIFNLVAFVSPYWIVARPEYPSQFVRLGLWVACFDNYIHPEDYVSKMYKGCWYVYWPEYDYIRDWLNPPWFYGVQMMSSISLLCNGGAMILVLLKFVN INIVDKNTNILALVLQFLAFCCYIIVIVAMGVMSKDREWMPRPDHNQVSWSFAFAVLGGFFTIFCFFNLIIHYLVYTWAPSVKPKDKADYSELPLREDCNSGLYKSQQGSGLGVYPSASNIYSHVGTKPNSKVGTTSGATASAKVREAMSQK       KNQ+GGSMSSLNSAGIPKNKIGSTHSLASIGRLPDPNPRGSMSSLHMNRQPKRENYDDNSSVV
Sbjct:    1 MEKEKKISVNFKFALYLACAAFIFNLVAFVSPYWIVARPEYPSQFVRLGLWVACFDNYIHPEDYVSKMYKGCWYVYWPEYDYIRDWLNPPWFYGVQMMSSISLLCNGGAMILVLLKFVNAINIVDKNTNILALVLQFLAFCCYIIVIVAMGVMSKDREWMPRPDHNQVSWSFAFAVLGGFFTIFCFFNLIIHYLVYTWAPSVKPKDKADYSELPLREDCNSGLYKSQQGSGLGVYPSASNIYSHVGTKPNSKVGTTSGATASAKVREAMSQK-------KNQYGGSMSSLNSAGIPKNKIGSTHSLASIGRLPDPNPRGSMSSLHMNRQPKRENYDDNSSVV 335          
BLAST of SMED30022121 vs. Planmine SMEST
Match: SMESG000058668.1 (SMESG000058668.1)

HSP 1 Score: 158.688 bits (400), Expect = 4.689e-46
Identity = 76/193 (39.38%), Postives = 112/193 (58.03%), Query Frame = 2
Query:   29 EKEKKISVNFKFALYLACAAFIFNLVAFVSPYWIVARPEYPSQFVRLGLWVACFDNYIHPEDYVSKMYKGCWYVYWPEYDYIRDWLNPPWFYGVQMMSSISLLCNGGAMILVLLKFVNVINIVDKNTNILALVLQFLAFCCYIIVIVAMGVMSKDREWMPRPDHNQVSWSFAFAVLGGFFTIFCFFNLIIHYL 607
            EK+K     F+   Y    A  FN +AFVSP+W+  +P    QF+R+GLW  CFD Y+ P  Y  K Y GC+Y+Y+ EYD +RDWLNPPW Y VQ+M SI L+ +  +  +V+ + V V +  +  T    L   F    C ++ ++A GV S+D  W+  P++N +SWS+AFA +    T+  F  L+  +L
Sbjct:    3 EKDKPTKTIFRVITYCTVIAVCFNFIAFVSPFWVATKPSDHRQFLRIGLWTVCFDGYMKPYQY-HKAYFGCYYIYYVEYDGVRDWLNPPWLYAVQVMMSIGLITHAISTFIVICQSVMVFSHANVKTLATMLFTNFSTGLCILLALIAFGVESQDSRWIQFPEYNSLSWSYAFAAIAFIITVAVFCMLVHVFL 194          
BLAST of SMED30022121 vs. Planmine SMEST
Match: SMESG000028931.1 (SMESG000028931.1)

HSP 1 Score: 100.523 bits (249), Expect = 3.022e-24
Identity = 56/175 (32.00%), Postives = 89/175 (50.86%), Query Frame = 2
Query:   59 KFALYLACAAFIFNLVAFVSPYWIVARPEYPSQFVRLGLWVACFDNYIHPEDYVSKMYKGCWYVYWPEYDYIRDWLNPPWFYGVQMMSSISLLCNGGAMILVLLKFVNVINIVDKN--TNILALVLQFLAFCCYIIVIVAMGVMSKDREWMPRPDHNQVSWSFAFAVLGGFFTIF 577
            +F ++++    I  ++AF + YW+ + P   S+F RLGLW  C + Y    D   + + GCW+++ P Y  I+D L P WF  VQ   +++ L      IL++     +I   ++   T+ +    Q ++     I IV  G    D  WMPRP+ N  SWS+ FA+L  F  IF
Sbjct:   19 QFYVFMSVFTLICVIIAFCTSYWLQSWPRIHSEFKRLGLWEFCLNGYTARRDIKMQSFFGCWWLFAPYYYPIQDLLTPAWFQTVQAFFTLAFLLQLAINILLIFYGFKIIKHPERRALTSRILFFSQIVSIILTFIAIVIFGCRCFDLYWMPRPELNWPSWSYGFAILSCFGMIF 193          
BLAST of SMED30022121 vs. Planmine SMEST
Match: SMESG000028931.1 (SMESG000028931.1)

HSP 1 Score: 97.8265 bits (242), Expect = 1.740e-23
Identity = 54/161 (33.54%), Postives = 82/161 (50.93%), Query Frame = 2
Query:  101 LVAFVSPYWIVARPEYPSQFVRLGLWVACFDNYIHPEDYVSKMYKGCWYVYWPEYDYIRDWLNPPWFYGVQMMSSISLLCNGGAMILVLLKFVNVINIVDKN--TNILALVLQFLAFCCYIIVIVAMGVMSKDREWMPRPDHNQVSWSFAFAVLGGFFTIF 577
            ++AF + YW+ + P   S+F RLGLW  C + Y    D   + + GCW+++ P Y  I+D L P WF  VQ   +++ L      IL++     +I   ++   T+ +    Q ++     I IV  G    D  WMPRP+ N  SWS+ FA+L  F  IF
Sbjct:   10 IIAFCTSYWLQSWPRIHSEFKRLGLWEFCLNGYTARRDIKMQSFFGCWWLFAPYYYPIQDLLTPAWFQTVQAFFTLAFLLQLAINILLIFYGFKIIKHPERRALTSRILFFSQIVSIILTFIAIVIFGCRCFDLYWMPRPELNWPSWSYGFAILSCFGMIF 170          
The following BLAST results are available for this feature:
BLAST of SMED30022121 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022121 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022121 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kune1.368e-1724.63gene:FBgn0033032 transcript:FBtr0086037[more]
pck1.440e-1628.25gene:FBgn0013720 transcript:FBtr0070256[more]
pck1.440e-1628.25gene:FBgn0013720 transcript:FBtr0070255[more]
sinu1.716e-1026.27gene:FBgn0010894 transcript:FBtr0077136[more]
pck2.373e-631.25gene:FBgn0013720 transcript:FBtr0100198[more]
back to top
BLAST of SMED30022121 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022121 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022121 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022121 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022121 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A430QLE74.617e-7739.20Uncharacterized protein OS=Schistosoma bovis OX=61... [more]
A0A094ZNA01.933e-7638.56Uncharacterized protein OS=Schistosoma haematobium... [more]
A0A183PDJ24.018e-7638.93Uncharacterized protein OS=Schistosoma mattheei OX... [more]
A0A183LE479.917e-7640.44Uncharacterized protein OS=Schistosoma margrebowie... [more]
A0A5K4ELU54.426e-7538.77Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
back to top
BLAST of SMED30022121 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022121 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022121 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022121 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022121 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30022121 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000042798.10.000e+099.42SMESG000042798.1[more]
SMESG000042798.10.000e+097.37SMESG000042798.1[more]
SMESG000058668.14.689e-4639.38SMESG000058668.1[more]
SMESG000028931.13.022e-2432.00SMESG000028931.1[more]
SMESG000028931.11.740e-2333.54SMESG000028931.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022121 ID=SMED30022121|Name=SMED30022121|organism=Schmidtea mediterranea sexual|type=transcript|length=1192bp
AAATATATGAATTGATTTACGGAAAATGGAGAAAGAAAAGAAAATTAGTG
TTAATTTTAAATTCGCCTTGTATTTAGCTTGTGCTGCATTCATTTTTAAT
TTAGTCGCGTTTGTTTCACCTTATTGGATAGTTGCTAGGCCAGAATATCC
TAGTCAATTTGTTAGACTAGGTTTATGGGTAGCTTGTTTCGATAATTATA
TACATCCAGAAGATTATGTTTCTAAAATGTATAAAGGATGCTGGTATGTT
TATTGGCCTGAATATGATTATATTCGTGATTGGTTAAATCCACCATGGTT
TTATGGAGTACAAATGATGTCATCTATATCGTTACTTTGTAATGGAGGAG
CAATGATCTTGGTGTTACTAAAATTTGTTAATGTGATAAATATAGTCGAT
AAAAATACTAATATTCTAGCTCTTGTTTTGCAATTTCTTGCTTTTTGTTG
TTATATAATAGTGATAGTTGCAATGGGCGTAATGAGCAAAGATCGAGAAT
GGATGCCGAGGCCAGATCATAACCAAGTTTCATGGAGTTTTGCGTTTGCT
GTTCTCGGAGGATTTTTCACCATATTTTGCTTTTTTAATTTGATTATTCA
TTACCTCGTGTATACATGGGCGCCAAGTGTCAAACCGAAAGACAAAGCTG
ACTACTCAGAATTGCCGTTACGTGAAGATTGCAACTCTGGGCTTTATAAA
TCACAACAAGGAAGCGGATTGGGGGTTTATCCTTCAGCCTCAAATATTTA
TTCCCACGTCGGTACAAAACCCAACTCCAAAGTCGGCACTACGTCAGGAG
CTACGGCTTCTGCTAAAGTCCGGGAGGCGATGTCTCAGAAGATTAGACAA
AATGCAAATGATAAAAATCAACACGGTGGATCAATGTCATCTTTGAATTC
GGCAGGTATTCCGAAAAATAAAATCGGTTCCACTCATTCGTTGGCATCAA
TTGGTCGATTACCGGATCCCAATCCGCGAGGCTCCATGTCGAGTTTACAC
ATGAATAGACAACCGAAACGTGAAAATTATGACGATAACTCATCTGTAGT
TTAATCAAACGTTTTTTTCCATCTCCAATAAGAAAGGCTGTGCGCGTATT
GATTCATATCATTGCAAGTTTTGCACTTTTATCTTTGATACCGTTTATAT
AATATTATATTTTCTGCAAATAAAATTACAGTTAGTTGAAAA
back to top

protein sequence of SMED30022121-orf-1

>SMED30022121-orf-1 ID=SMED30022121-orf-1|Name=SMED30022121-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=343bp
MEKEKKISVNFKFALYLACAAFIFNLVAFVSPYWIVARPEYPSQFVRLGL
WVACFDNYIHPEDYVSKMYKGCWYVYWPEYDYIRDWLNPPWFYGVQMMSS
ISLLCNGGAMILVLLKFVNVINIVDKNTNILALVLQFLAFCCYIIVIVAM
GVMSKDREWMPRPDHNQVSWSFAFAVLGGFFTIFCFFNLIIHYLVYTWAP
SVKPKDKADYSELPLREDCNSGLYKSQQGSGLGVYPSASNIYSHVGTKPN
SKVGTTSGATASAKVREAMSQKIRQNANDKNQHGGSMSSLNSAGIPKNKI
GSTHSLASIGRLPDPNPRGSMSSLHMNRQPKRENYDDNSSVV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR004031PMP22/EMP/MP20/Claudin
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.140.150coord: 2..199
e-value: 3.3E-18
score: 67.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 310..342
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 249..270
NoneNo IPR availablePANTHERPTHR21284FAMILY NOT NAMEDcoord: 6..185
NoneNo IPR availableTMHMMTMhelixcoord: 13..35
NoneNo IPR availableTMHMMTMhelixcoord: 96..118
NoneNo IPR availableTMHMMTMhelixcoord: 173..195
NoneNo IPR availableTMHMMTMhelixcoord: 131..153
IPR004031PMP-22/EMP/MP20/Claudin superfamilyPFAMPF13903Claudin_2coord: 19..184
e-value: 1.2E-12
score: 48.0