Kunitz-like protease inhibitor

Overview
NameKunitz-like protease inhibitor
Smed IDSMED30022118
Length (bp)479
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Kunitz-like protease inhibitor (SMED30022118) t-SNE clustered cells

Violin plots show distribution of expression levels for Kunitz-like protease inhibitor (SMED30022118) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Kunitz-like protease inhibitor (SMED30022118) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Kunitz-like protease inhibitor (SMED30022118) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022118

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
tail regionSMED30022118 SmedASXL_004062SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30022118 dd_Smed_v4_2814_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30022118 dd_Smed_v4_2814_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30022118 dd_Smed_v4_2814_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Kunitz-like protease inhibitor vs. Ensembl Human
Match: COL6A3 (collagen type VI alpha 3 chain [Source:HGNC Symbol;Acc:HGNC:2213])

HSP 1 Score: 66.6254 bits (161), Expect = 7.037e-13
Identity = 26/69 (37.68%), Postives = 43/69 (62.32%), Query Frame = 1
Query:   73 TIMLVLLVLEMGQSRDPICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            TI L++    +  +   IC+LPK  G CR +I +++++  T++C +F YGGCG NEN F ++ +C   C
Sbjct: 2486 TINLMVSTEPLALTETDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVC 2554          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Human
Match: COL6A3 (collagen type VI alpha 3 chain [Source:HGNC Symbol;Acc:HGNC:2213])

HSP 1 Score: 66.6254 bits (161), Expect = 7.037e-13
Identity = 26/69 (37.68%), Postives = 43/69 (62.32%), Query Frame = 1
Query:   73 TIMLVLLVLEMGQSRDPICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            TI L++    +  +   IC+LPK  G CR +I +++++  T++C +F YGGCG NEN F ++ +C   C
Sbjct: 2487 TINLMVSTEPLALTETDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVC 2555          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Human
Match: COL6A3 (collagen type VI alpha 3 chain [Source:HGNC Symbol;Acc:HGNC:2213])

HSP 1 Score: 66.6254 bits (161), Expect = 7.074e-13
Identity = 26/69 (37.68%), Postives = 43/69 (62.32%), Query Frame = 1
Query:   73 TIMLVLLVLEMGQSRDPICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            TI L++    +  +   IC+LPK  G CR +I +++++  T++C +F YGGCG NEN F ++ +C   C
Sbjct: 2888 TINLMVSTEPLALTETDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVC 2956          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Human
Match: COL6A3 (collagen type VI alpha 3 chain [Source:HGNC Symbol;Acc:HGNC:2213])

HSP 1 Score: 66.6254 bits (161), Expect = 7.074e-13
Identity = 26/69 (37.68%), Postives = 43/69 (62.32%), Query Frame = 1
Query:   73 TIMLVLLVLEMGQSRDPICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            TI L++    +  +   IC+LPK  G CR +I +++++  T++C +F YGGCG NEN F ++ +C   C
Sbjct: 2888 TINLMVSTEPLALTETDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVC 2956          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Human
Match: COL6A3 (collagen type VI alpha 3 chain [Source:HGNC Symbol;Acc:HGNC:2213])

HSP 1 Score: 66.6254 bits (161), Expect = 7.089e-13
Identity = 26/69 (37.68%), Postives = 43/69 (62.32%), Query Frame = 1
Query:   73 TIMLVLLVLEMGQSRDPICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            TI L++    +  +   IC+LPK  G CR +I +++++  T++C +F YGGCG NEN F ++ +C   C
Sbjct: 3094 TINLMVSTEPLALTETDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVC 3162          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Celegans
Match: mlt-11 (pep chromosome:WBcel235:V:20667211:20678513:1 gene:WBGene00012186.1 transcript:W01F3.3d.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mlt-11)

HSP 1 Score: 60.8474 bits (146), Expect = 3.108e-11
Identity = 25/52 (48.08%), Postives = 32/52 (61.54%), Query Frame = 1
Query:  124 ICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            +C +P   G+C  Y PR+FFN+ T  CE+F YG CG NENNF   + C   C
Sbjct: 2167 VCAMPPDAGVCTNYTPRWFFNSQTGQCEQFAYGSCGGNENNFFDRNTCERKC 2218          

HSP 2 Score: 55.4546 bits (132), Expect = 2.008e-9
Identity = 26/64 (40.62%), Postives = 37/64 (57.81%), Query Frame = 1
Query:   88 LLVLEMGQSRDPICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            ++ L+   +R   C LPK  G C  Y  RF+FN     C+ F +GGC  N+NNFE  +DC ++C
Sbjct:  526 VVGLQTSGARATRCSLPKERGPCDKYELRFYFNADLNECKYFFWGGCEGNQNNFERVEDCESAC 589          

HSP 3 Score: 54.6842 bits (130), Expect = 4.317e-9
Identity = 27/62 (43.55%), Postives = 32/62 (51.61%), Query Frame = 1
Query:   94 VLEMGQSRDPICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            V+ M +S    CE    VG C     RF F+ +   C  F YGGCG N NNF T  +CTN C
Sbjct:  846 VMAMKKSPVATCEADIEVGECAGVFSRFAFDKSINACRSFTYGGCGGNANNFATLQECTNKC 907          

HSP 4 Score: 48.1358 bits (113), Expect = 7.744e-7
Identity = 18/44 (40.91%), Postives = 27/44 (61.36%), Query Frame = 1
Query:  148 GLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            G C     R+F+N  ++ CE+F Y GCG N NN+E+ + C + C
Sbjct:  430 GPCHGSFQRYFYNEDSQKCEQFTYSGCGGNGNNYESREACEDRC 473          

HSP 5 Score: 45.8246 bits (107), Expect = 4.324e-6
Identity = 20/54 (37.04%), Postives = 31/54 (57.41%), Query Frame = 1
Query:  118 DPICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            +P+C  P V G C+    R++++  T++C  F Y GC  N NNF + +DC   C
Sbjct: 2730 NPLCIQPVVKGSCQEAHLRYYYDRVTDSCRLFEYSGCDGNANNFGSLEDCQRLC 2783          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Celegans
Match: mlt-11 (pep chromosome:WBcel235:V:20667209:20678513:1 gene:WBGene00012186.1 transcript:W01F3.3c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mlt-11)

HSP 1 Score: 60.8474 bits (146), Expect = 3.195e-11
Identity = 25/52 (48.08%), Postives = 32/52 (61.54%), Query Frame = 1
Query:  124 ICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            +C +P   G+C  Y PR+FFN+ T  CE+F YG CG NENNF   + C   C
Sbjct: 2047 VCAMPPDAGVCTNYTPRWFFNSQTGQCEQFAYGSCGGNENNFFDRNTCERKC 2098          

HSP 2 Score: 55.4546 bits (132), Expect = 2.045e-9
Identity = 26/64 (40.62%), Postives = 37/64 (57.81%), Query Frame = 1
Query:   88 LLVLEMGQSRDPICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            ++ L+   +R   C LPK  G C  Y  RF+FN     C+ F +GGC  N+NNFE  +DC ++C
Sbjct:  397 VVGLQTSGARATRCSLPKERGPCDKYELRFYFNADLNECKYFFWGGCEGNQNNFERVEDCESAC 460          

HSP 3 Score: 54.6842 bits (130), Expect = 4.312e-9
Identity = 27/62 (43.55%), Postives = 32/62 (51.61%), Query Frame = 1
Query:   94 VLEMGQSRDPICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            V+ M +S    CE    VG C     RF F+ +   C  F YGGCG N NNF T  +CTN C
Sbjct:  726 VMAMKKSPVATCEADIEVGECAGVFSRFAFDKSINACRSFTYGGCGGNANNFATLQECTNKC 787          

HSP 4 Score: 48.1358 bits (113), Expect = 8.189e-7
Identity = 18/44 (40.91%), Postives = 27/44 (61.36%), Query Frame = 1
Query:  148 GLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            G C     R+F+N  ++ CE+F Y GCG N NN+E+ + C + C
Sbjct:  301 GPCHGSFQRYFYNEDSQKCEQFTYSGCGGNGNNYESREACEDRC 344          

HSP 5 Score: 45.8246 bits (107), Expect = 4.444e-6
Identity = 20/54 (37.04%), Postives = 31/54 (57.41%), Query Frame = 1
Query:  118 DPICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            +P+C  P V G C+    R++++  T++C  F Y GC  N NNF + +DC   C
Sbjct: 2610 NPLCIQPVVKGSCQEAHLRYYYDRVTDSCRLFEYSGCDGNANNFGSLEDCQRLC 2663          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Celegans
Match: mlt-11 (pep chromosome:WBcel235:V:20667211:20678513:1 gene:WBGene00012186.1 transcript:W01F3.3b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mlt-11)

HSP 1 Score: 60.8474 bits (146), Expect = 3.199e-11
Identity = 25/52 (48.08%), Postives = 32/52 (61.54%), Query Frame = 1
Query:  124 ICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            +C +P   G+C  Y PR+FFN+ T  CE+F YG CG NENNF   + C   C
Sbjct: 2176 VCAMPPDAGVCTNYTPRWFFNSQTGQCEQFAYGSCGGNENNFFDRNTCERKC 2227          

HSP 2 Score: 55.4546 bits (132), Expect = 2.087e-9
Identity = 26/64 (40.62%), Postives = 37/64 (57.81%), Query Frame = 1
Query:   88 LLVLEMGQSRDPICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            ++ L+   +R   C LPK  G C  Y  RF+FN     C+ F +GGC  N+NNFE  +DC ++C
Sbjct:  526 VVGLQTSGARATRCSLPKERGPCDKYELRFYFNADLNECKYFFWGGCEGNQNNFERVEDCESAC 589          

HSP 3 Score: 54.6842 bits (130), Expect = 4.616e-9
Identity = 27/62 (43.55%), Postives = 32/62 (51.61%), Query Frame = 1
Query:   94 VLEMGQSRDPICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            V+ M +S    CE    VG C     RF F+ +   C  F YGGCG N NNF T  +CTN C
Sbjct:  855 VMAMKKSPVATCEADIEVGECAGVFSRFAFDKSINACRSFTYGGCGGNANNFATLQECTNKC 916          

HSP 4 Score: 48.1358 bits (113), Expect = 8.278e-7
Identity = 18/44 (40.91%), Postives = 27/44 (61.36%), Query Frame = 1
Query:  148 GLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            G C     R+F+N  ++ CE+F Y GCG N NN+E+ + C + C
Sbjct:  430 GPCHGSFQRYFYNEDSQKCEQFTYSGCGGNGNNYESREACEDRC 473          

HSP 5 Score: 45.8246 bits (107), Expect = 4.578e-6
Identity = 20/54 (37.04%), Postives = 31/54 (57.41%), Query Frame = 1
Query:  118 DPICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            +P+C  P V G C+    R++++  T++C  F Y GC  N NNF + +DC   C
Sbjct: 2739 NPLCIQPVVKGSCQEAHLRYYYDRVTDSCRLFEYSGCDGNANNFGSLEDCQRLC 2792          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Celegans
Match: mlt-11 (pep chromosome:WBcel235:V:20667209:20678513:1 gene:WBGene00012186.1 transcript:W01F3.3h.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mlt-11)

HSP 1 Score: 60.8474 bits (146), Expect = 3.364e-11
Identity = 25/52 (48.08%), Postives = 32/52 (61.54%), Query Frame = 1
Query:  124 ICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            +C +P   G+C  Y PR+FFN+ T  CE+F YG CG NENNF   + C   C
Sbjct: 1574 VCAMPPDAGVCTNYTPRWFFNSQTGQCEQFAYGSCGGNENNFFDRNTCERKC 1625          

HSP 2 Score: 55.8398 bits (133), Expect = 1.795e-9
Identity = 26/64 (40.62%), Postives = 37/64 (57.81%), Query Frame = 1
Query:   88 LLVLEMGQSRDPICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            ++ L+   +R   C LPK  G C  Y  RF+FN     C+ F +GGC  N+NNFE  +DC ++C
Sbjct:  305 VVGLQTSGARATRCSLPKERGPCDKYELRFYFNADLNECKYFFWGGCEGNQNNFERVEDCESAC 368          

HSP 3 Score: 54.6842 bits (130), Expect = 3.749e-9
Identity = 27/62 (43.55%), Postives = 32/62 (51.61%), Query Frame = 1
Query:   94 VLEMGQSRDPICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            V+ M +S    CE    VG C     RF F+ +   C  F YGGCG N NNF T  +CTN C
Sbjct:  634 VMAMKKSPVATCEADIEVGECAGVFSRFAFDKSINACRSFTYGGCGGNANNFATLQECTNKC 695          

HSP 4 Score: 47.7506 bits (112), Expect = 8.620e-7
Identity = 18/46 (39.13%), Postives = 28/46 (60.87%), Query Frame = 1
Query:  142 VVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            + G C     R+F+N  ++ CE+F Y GCG N NN+E+ + C + C
Sbjct:  207 LPGPCHGSFQRYFYNEDSQKCEQFTYSGCGGNGNNYESREACEDRC 252          

HSP 5 Score: 45.8246 bits (107), Expect = 4.135e-6
Identity = 20/54 (37.04%), Postives = 31/54 (57.41%), Query Frame = 1
Query:  118 DPICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            +P+C  P V G C+    R++++  T++C  F Y GC  N NNF + +DC   C
Sbjct: 2137 NPLCIQPVVKGSCQEAHLRYYYDRVTDSCRLFEYSGCDGNANNFGSLEDCQRLC 2190          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Celegans
Match: mlt-11 (pep chromosome:WBcel235:V:20667209:20678513:1 gene:WBGene00012186.1 transcript:W01F3.3g.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mlt-11)

HSP 1 Score: 60.4622 bits (145), Expect = 3.693e-11
Identity = 25/52 (48.08%), Postives = 32/52 (61.54%), Query Frame = 1
Query:  124 ICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            +C +P   G+C  Y PR+FFN+ T  CE+F YG CG NENNF   + C   C
Sbjct: 1420 VCAMPPDAGVCTNYTPRWFFNSQTGQCEQFAYGSCGGNENNFFDRNTCERKC 1471          

HSP 2 Score: 55.4546 bits (132), Expect = 1.933e-9
Identity = 26/64 (40.62%), Postives = 37/64 (57.81%), Query Frame = 1
Query:   88 LLVLEMGQSRDPICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            ++ L+   +R   C LPK  G C  Y  RF+FN     C+ F +GGC  N+NNFE  +DC ++C
Sbjct:  305 VVGLQTSGARATRCSLPKERGPCDKYELRFYFNADLNECKYFFWGGCEGNQNNFERVEDCESAC 368          

HSP 3 Score: 55.0694 bits (131), Expect = 3.366e-9
Identity = 27/62 (43.55%), Postives = 32/62 (51.61%), Query Frame = 1
Query:   94 VLEMGQSRDPICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            V+ M +S    CE    VG C     RF F+ +   C  F YGGCG N NNF T  +CTN C
Sbjct:  625 VMAMKKSPVATCEADIEVGECAGVFSRFAFDKSINACRSFTYGGCGGNANNFATLQECTNKC 686          

HSP 4 Score: 47.7506 bits (112), Expect = 9.019e-7
Identity = 18/44 (40.91%), Postives = 27/44 (61.36%), Query Frame = 1
Query:  148 GLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            G C     R+F+N  ++ CE+F Y GCG N NN+E+ + C + C
Sbjct:  209 GPCHGSFQRYFYNEDSQKCEQFTYSGCGGNGNNYESREACEDRC 252          

HSP 5 Score: 45.8246 bits (107), Expect = 3.971e-6
Identity = 20/54 (37.04%), Postives = 31/54 (57.41%), Query Frame = 1
Query:  118 DPICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            +P+C  P V G C+    R++++  T++C  F Y GC  N NNF + +DC   C
Sbjct: 1983 NPLCIQPVVKGSCQEAHLRYYYDRVTDSCRLFEYSGCDGNANNFGSLEDCQRLC 2036          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Fly
Match: IM33 (gene:FBgn0031561 transcript:FBtr0077546)

HSP 1 Score: 70.8626 bits (172), Expect = 1.175e-16
Identity = 37/80 (46.25%), Postives = 48/80 (60.00%), Query Frame = 1
Query:   55 MKYIAFTIMLVLLVLEMGQSRDPICELPKVV---GL--CRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            MK+IA   ++  LV      +DPIC LP  +   GL  C A+IP F ++  T +CEKFIYGGCG NEN F T++ C   C
Sbjct:    1 MKFIAAVCLMFALVAVALGLKDPICGLPAGIDGNGLIKCAAFIPSFSYHPETNSCEKFIYGGCGGNENRFGTQELCEQKC 80          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Fly
Match: IM33 (gene:FBgn0031561 transcript:FBtr0345610)

HSP 1 Score: 70.8626 bits (172), Expect = 1.175e-16
Identity = 37/80 (46.25%), Postives = 48/80 (60.00%), Query Frame = 1
Query:   55 MKYIAFTIMLVLLVLEMGQSRDPICELPKVV---GL--CRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            MK+IA   ++  LV      +DPIC LP  +   GL  C A+IP F ++  T +CEKFIYGGCG NEN F T++ C   C
Sbjct:    1 MKFIAAVCLMFALVAVALGLKDPICGLPAGIDGNGLIKCAAFIPSFSYHPETNSCEKFIYGGCGGNENRFGTQELCEQKC 80          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Fly
Match: CG3513 (gene:FBgn0031559 transcript:FBtr0077549)

HSP 1 Score: 57.7658 bits (138), Expect = 1.563e-11
Identity = 28/86 (32.56%), Postives = 46/86 (53.49%), Query Frame = 1
Query:   55 MKYIAFTIMLVLLVLEMG----QSRDPICELPK-VVGL------CRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            MKYI F  +  LL L        ++  +C+ P  +VG+      C A++P + ++ +   C +FI+GGCG N N F T+ +C  +C
Sbjct:    1 MKYIGFVAIAFLLSLSGSRLWVHAKPEMCQQPSSMVGMAQDGAACMAFMPAWTYDASKNACTEFIFGGCGGNSNQFSTKSECEKAC 86          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Fly
Match: CG3604 (gene:FBgn0031562 transcript:FBtr0077545)

HSP 1 Score: 57.7658 bits (138), Expect = 3.741e-11
Identity = 23/51 (45.10%), Postives = 34/51 (66.67%), Query Frame = 1
Query:  127 CELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            C  PK  G C A   R+ +N  T++CE+F+YGGC  N+NNFE+++ C  +C
Sbjct:   55 CHQPKETGRCFALFYRYAYNVDTQSCEEFVYGGCAGNKNNFESKEQCEQAC 105          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Fly
Match: CG3604 (gene:FBgn0031562 transcript:FBtr0346581)

HSP 1 Score: 57.7658 bits (138), Expect = 3.741e-11
Identity = 23/51 (45.10%), Postives = 34/51 (66.67%), Query Frame = 1
Query:  127 CELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            C  PK  G C A   R+ +N  T++CE+F+YGGC  N+NNFE+++ C  +C
Sbjct:   55 CHQPKETGRCFALFYRYAYNVDTQSCEEFVYGGCAGNKNNFESKEQCEQAC 105          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Zebrafish
Match: spint2 (serine peptidase inhibitor, Kunitz type, 2 [Source:ZFIN;Acc:ZDB-GENE-061013-323])

HSP 1 Score: 68.5514 bits (166), Expect = 7.847e-14
Identity = 29/51 (56.86%), Postives = 36/51 (70.59%), Query Frame = 1
Query:  127 CELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            C  P  VG CRA  PRFF++ T +TC+ FIYGGCG NENNF ++ +C  SC
Sbjct:  133 CRFPSAVGNCRAAFPRFFYDITDQTCKSFIYGGCGGNENNFYSQAECEASC 183          

HSP 2 Score: 62.3882 bits (150), Expect = 1.063e-11
Identity = 27/51 (52.94%), Postives = 36/51 (70.59%), Query Frame = 1
Query:  127 CELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            C+ P V G CRA I RF++N     C++FIYGGCG N+NN+E+ED C  +C
Sbjct:  228 CQSPAVTGNCRASIKRFYYNNGV--CQQFIYGGCGGNKNNYESEDSCMTAC 276          

HSP 3 Score: 51.6026 bits (122), Expect = 6.075e-8
Identity = 22/66 (33.33%), Postives = 38/66 (57.58%), Query Frame = 1
Query:   82 LVLLVLEMGQSRDPICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            ++  + +   S +  C +P   G CRA    FFF  ++++C+ FIYGGC  N N + +E++C + C
Sbjct:  289 VIPAIPKSAHSFEEKCVVPSDSGPCRASFRMFFFEASSQSCQPFIYGGCRGNLNRYGSEEECMSVC 354          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Zebrafish
Match: spint2 (serine peptidase inhibitor, Kunitz type, 2 [Source:ZFIN;Acc:ZDB-GENE-061013-323])

HSP 1 Score: 68.5514 bits (166), Expect = 8.478e-14
Identity = 29/51 (56.86%), Postives = 36/51 (70.59%), Query Frame = 1
Query:  127 CELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            C  P  VG CRA  PRFF++ T +TC+ FIYGGCG NENNF ++ +C  SC
Sbjct:  133 CRFPSAVGNCRAAFPRFFYDITDQTCKSFIYGGCGGNENNFYSQAECEASC 183          

HSP 2 Score: 62.3882 bits (150), Expect = 1.127e-11
Identity = 27/51 (52.94%), Postives = 36/51 (70.59%), Query Frame = 1
Query:  127 CELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            C+ P V G CRA I RF++N     C++FIYGGCG N+NN+E+ED C  +C
Sbjct:  228 CQSPAVTGNCRASIKRFYYNNGV--CQQFIYGGCGGNKNNYESEDSCMTAC 276          

HSP 3 Score: 51.6026 bits (122), Expect = 6.620e-8
Identity = 22/66 (33.33%), Postives = 38/66 (57.58%), Query Frame = 1
Query:   82 LVLLVLEMGQSRDPICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            ++  + +   S +  C +P   G CRA    FFF  ++++C+ FIYGGC  N N + +E++C + C
Sbjct:  289 VIPAIPKSAHSFEEKCVVPSDSGPCRASFRMFFFEASSQSCQPFIYGGCRGNLNRYGSEEECMSVC 354          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Zebrafish
Match: wfikkn2a (info WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 2a [Source:ZFIN;Acc:ZDB-GENE-120914-1])

HSP 1 Score: 64.3142 bits (155), Expect = 2.751e-12
Identity = 27/62 (43.55%), Postives = 38/62 (61.29%), Query Frame = 1
Query:   94 VLEMGQSRDPICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            +L  G      C LP V G C+AY PR+ ++   + C+ F+YGGCG NENNFE+++ C   C
Sbjct:  372 MLSCGAELAAPCSLPSVQGPCKAYKPRWAYSHALKKCQSFVYGGCGGNENNFESKEACEEMC 433          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Zebrafish
Match: col28a2a (collagen, type XXVIII, alpha 2a [Source:ZFIN;Acc:ZDB-GENE-030131-4444])

HSP 1 Score: 63.929 bits (154), Expect = 4.220e-12
Identity = 24/63 (38.10%), Postives = 39/63 (61.90%), Query Frame = 1
Query:   91 LVLEMGQSRDPICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            +V++     DP C+L  V G CR Y+ R+++   + +C +F YGGC  N+N F TE++C  +C
Sbjct: 1140 VVIKESAPLDPRCQLSFVQGSCRNYVIRWYYEKQSNSCAQFWYGGCDGNDNRFHTEEECKTTC 1202          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Zebrafish
Match: col28a2a (collagen, type XXVIII, alpha 2a [Source:ZFIN;Acc:ZDB-GENE-030131-4444])

HSP 1 Score: 63.929 bits (154), Expect = 4.256e-12
Identity = 24/63 (38.10%), Postives = 39/63 (61.90%), Query Frame = 1
Query:   91 LVLEMGQSRDPICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            +V++     DP C+L  V G CR Y+ R+++   + +C +F YGGC  N+N F TE++C  +C
Sbjct: 1124 VVIKESAPLDPRCQLSFVQGSCRNYVIRWYYEKQSNSCAQFWYGGCDGNDNRFHTEEECKTTC 1186          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Xenopus
Match: APLP2 (amyloid beta (A4) precursor-like protein 2 [Source:NCBI gene;Acc:100380132])

HSP 1 Score: 66.2402 bits (160), Expect = 8.076e-13
Identity = 25/52 (48.08%), Postives = 34/52 (65.38%), Query Frame = 1
Query:  124 ICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            +C    + G CRA +PR++F+   + C +FIYGGCG N NNFE+ED C   C
Sbjct:  291 VCSQEAMTGPCRAMMPRWYFDLGQKKCVRFIYGGCGGNRNNFESEDYCMAVC 342          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Xenopus
Match: APLP2 (amyloid beta (A4) precursor-like protein 2 [Source:NCBI gene;Acc:100380132])

HSP 1 Score: 66.2402 bits (160), Expect = 8.086e-13
Identity = 25/52 (48.08%), Postives = 34/52 (65.38%), Query Frame = 1
Query:  124 ICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            +C    + G CRA +PR++F+   + C +FIYGGCG N NNFE+ED C   C
Sbjct:  299 VCSQEAMTGPCRAMMPRWYFDLGQKKCVRFIYGGCGGNRNNFESEDYCMAVC 350          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Xenopus
Match: APLP2 (amyloid beta (A4) precursor-like protein 2 [Source:NCBI gene;Acc:100380132])

HSP 1 Score: 66.2402 bits (160), Expect = 8.086e-13
Identity = 25/52 (48.08%), Postives = 34/52 (65.38%), Query Frame = 1
Query:  124 ICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            +C    + G CRA +PR++F+   + C +FIYGGCG N NNFE+ED C   C
Sbjct:  296 VCSQEAMTGPCRAMMPRWYFDLGQKKCVRFIYGGCGGNRNNFESEDYCMAVC 347          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Xenopus
Match: APLP2 (amyloid beta (A4) precursor-like protein 2 [Source:NCBI gene;Acc:100380132])

HSP 1 Score: 66.2402 bits (160), Expect = 8.105e-13
Identity = 25/52 (48.08%), Postives = 34/52 (65.38%), Query Frame = 1
Query:  124 ICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            +C    + G CRA +PR++F+   + C +FIYGGCG N NNFE+ED C   C
Sbjct:  296 VCSQEAMTGPCRAMMPRWYFDLGQKKCVRFIYGGCGGNRNNFESEDYCMAVC 347          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Xenopus
Match: APLP2 (amyloid beta (A4) precursor-like protein 2 [Source:NCBI gene;Acc:100380132])

HSP 1 Score: 66.2402 bits (160), Expect = 8.226e-13
Identity = 25/52 (48.08%), Postives = 34/52 (65.38%), Query Frame = 1
Query:  124 ICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            +C    + G CRA +PR++F+   + C +FIYGGCG N NNFE+ED C   C
Sbjct:  296 VCSQEAMTGPCRAMMPRWYFDLGQKKCVRFIYGGCGGNRNNFESEDYCMAVC 347          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Mouse
Match: Eppin (epididymal peptidase inhibitor [Source:MGI Symbol;Acc:MGI:1922776])

HSP 1 Score: 62.7734 bits (151), Expect = 6.883e-13
Identity = 27/52 (51.92%), Postives = 34/52 (65.38%), Query Frame = 1
Query:  124 ICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            IC LPK  G C AY  R++FN    TC+ FIYGGC  N NNF+++  C N+C
Sbjct:   76 ICSLPKDSGYCMAYFRRWWFNKENSTCQVFIYGGCQGNNNNFQSQSICQNAC 127          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Mouse
Match: Wfdc6b (WAP four-disulfide core domain 6B [Source:MGI Symbol;Acc:MGI:3575430])

HSP 1 Score: 63.1586 bits (152), Expect = 7.318e-13
Identity = 27/52 (51.92%), Postives = 37/52 (71.15%), Query Frame = 1
Query:  124 ICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            IC LP+  G C AY+PR+++N  T+ C +FIYGGC  N NNFE++  CT+ C
Sbjct:   87 ICSLPQDAGPCLAYLPRWWYNQDTKLCIEFIYGGCQGNPNNFESKAVCTSIC 138          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Mouse
Match: Aplp2 (amyloid beta (A4) precursor-like protein 2 [Source:MGI Symbol;Acc:MGI:88047])

HSP 1 Score: 65.4698 bits (158), Expect = 1.362e-12
Identity = 25/52 (48.08%), Postives = 34/52 (65.38%), Query Frame = 1
Query:  124 ICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            +C    + G CRA +PR++F+ +   C +FIYGGCG N NNFE+ED C   C
Sbjct:  309 VCSQEAMTGPCRAVMPRWYFDLSKGKCVRFIYGGCGGNRNNFESEDYCMAVC 360          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Mouse
Match: Wfikkn2 (WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 2 [Source:MGI Symbol;Acc:MGI:2669209])

HSP 1 Score: 65.0846 bits (157), Expect = 1.545e-12
Identity = 26/52 (50.00%), Postives = 36/52 (69.23%), Query Frame = 1
Query:  124 ICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            IC LP + G C+AY+PR+ +N+ T  C+ F+YGGC  N NNFE+ + C  SC
Sbjct:  380 ICSLPALQGPCKAYVPRWAYNSQTGLCQSFVYGGCEGNGNNFESREACEESC 431          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Mouse
Match: Wfdc6a (WAP four-disulfide core domain 6A [Source:MGI Symbol;Acc:MGI:2684968])

HSP 1 Score: 62.003 bits (149), Expect = 1.656e-12
Identity = 27/55 (49.09%), Postives = 36/55 (65.45%), Query Frame = 1
Query:  115 RDPICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            R  +C LP+  G C AY+PR+++N  T+ C +FIYGGC  N NNF +E  CT  C
Sbjct:   73 RQDVCSLPQDPGPCLAYLPRWWYNQETDLCTEFIYGGCQGNPNNFPSEGICTVVC 127          
BLAST of Kunitz-like protease inhibitor vs. UniProt/SwissProt
Match: sp|P0DN08|VKT53_ANEVI (KappaPI-actitoxin-Avd3e OS=Anemonia viridis OX=51769 PE=3 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 3.597e-18
Identity = 33/68 (48.53%), Postives = 47/68 (69.12%), Query Frame = 1
Query:   76 IMLVLLVLEMGQSRDPICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            ++   LV ++    +  CELPKVVG CRA  PR+++N++++ CEKFIYGGCG N NNF T ++C   C
Sbjct:    4 LLCFFLVADVSYGINGDCELPKVVGPCRARFPRYYYNSSSKRCEKFIYGGCGGNANNFHTLEECEKVC 71          
BLAST of Kunitz-like protease inhibitor vs. UniProt/SwissProt
Match: sp|Q2ES47|VKT4_DABRR (Kunitz-type serine protease inhibitor 4 OS=Daboia russelii OX=8707 PE=2 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 5.023e-18
Identity = 32/58 (55.17%), Postives = 40/58 (68.97%), Query Frame = 1
Query:  106 GQSRDPICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            GQ R   C LP   G+CRA+IPRF++N  +  C+ FIYGGCG N NNFET D C ++C
Sbjct:   24 GQDRPKFCHLPVDSGICRAHIPRFYYNPASNQCQGFIYGGCGGNANNFETRDQCRHTC 81          
BLAST of Kunitz-like protease inhibitor vs. UniProt/SwissProt
Match: sp|P0DN18|VKTE_ANEVI (U-actitoxin-Avd3q OS=Anemonia viridis OX=51769 PE=3 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.082e-17
Identity = 32/68 (47.06%), Postives = 46/68 (67.65%), Query Frame = 1
Query:   76 IMLVLLVLEMGQSRDPICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            ++   LV ++    +  CELPKVVG CRA +PR+++N+++  CEKF YGGCG N NNF T ++C   C
Sbjct:    4 LLCFFLVADVSYGINGDCELPKVVGFCRARLPRYYYNSSSRRCEKFNYGGCGGNANNFHTLEECEKVC 71          
BLAST of Kunitz-like protease inhibitor vs. UniProt/SwissProt
Match: sp|Q8WPI3|BOOG2_RHIMP (Boophilin-G2 OS=Rhipicephalus microplus OX=6941 GN=G2 PE=1 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 1.720e-17
Identity = 39/75 (52.00%), Postives = 48/75 (64.00%), Query Frame = 1
Query:   55 MKYIAFTIMLVLLVLEMGQSRDPICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            MKY+   I+L +L     Q R+  C LP   G+C+A IPRF+FNT T  C  F YGGCG NENNFET +DC  +C
Sbjct:    1 MKYL---ILLAVLGTAFAQ-RNGFCRLPADEGICKALIPRFYFNTETGKCTMFSYGGCGGNENNFETIEDCQKAC 71          

HSP 2 Score: 53.9138 bits (128), Expect = 1.622e-8
Identity = 21/47 (44.68%), Postives = 31/47 (65.96%), Query Frame = 1
Query:  127 CELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDC 267
            CE     G C   + R+F+N  +  CE F+YGGCG N+NN+E+E++C
Sbjct:   89 CEPAADSGSCAGQLERWFYNVRSGECETFVYGGCGGNDNNYESEEEC 135          
BLAST of Kunitz-like protease inhibitor vs. UniProt/SwissProt
Match: sp|P0DMW7|VKT3B_ACTEQ (PI-actitoxin-Aeq3b OS=Actinia equina OX=6106 PE=1 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 2.008e-17
Identity = 31/52 (59.62%), Postives = 38/52 (73.08%), Query Frame = 1
Query:  124 ICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
             C+LP VVG CR Y PRF++NT    C++FIYGGCG N NNFET +DC  +C
Sbjct:    5 FCQLPAVVGKCRGYFPRFYYNTEAGKCQQFIYGGCGGNRNNFETVEDCRATC 56          
BLAST of Kunitz-like protease inhibitor vs. TrEMBL
Match: C1IBY4 (Tabserpin OS=Tabanus yao OX=485572 PE=2 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 8.129e-18
Identity = 33/75 (44.00%), Postives = 50/75 (66.67%), Query Frame = 1
Query:   55 MKYIAFTIMLVLLVLEMGQSRDPICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            MK ++   +L  +++    ++DP+C+ PK VG C A  P+F+FN+++  CE FIYGGCG NENNF T ++C   C
Sbjct:    1 MKVLSLIFVLFSVLVLFASAKDPVCDQPKAVGRCFAAFPKFYFNSSSGQCEAFIYGGCGGNENNFNTLEECNAKC 75          
BLAST of Kunitz-like protease inhibitor vs. TrEMBL
Match: C8YJ95 (Serine protease inhibitor 3 OS=Tabanus yao OX=485572 PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 1.491e-17
Identity = 32/75 (42.67%), Postives = 50/75 (66.67%), Query Frame = 1
Query:   55 MKYIAFTIMLVLLVLEMGQSRDPICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            MK ++   ++  +++    ++DP+C+ PK VG C A  P+F+FN+++  CE FIYGGCG NENNF T ++C   C
Sbjct:    1 MKVLSLIFVIFSVLVLFASAKDPVCDQPKAVGRCFAAFPKFYFNSSSGQCEAFIYGGCGGNENNFSTLEECNAKC 75          
BLAST of Kunitz-like protease inhibitor vs. TrEMBL
Match: C8YJ94 (Serine protease inhibitor 2 OS=Tabanus yao OX=485572 PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.179e-16
Identity = 30/75 (40.00%), Postives = 50/75 (66.67%), Query Frame = 1
Query:   55 MKYIAFTIMLVLLVLEMGQSRDPICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            MK ++   ++  +++    ++DP+C+ PK VG C A  P+F++N+++  C+ FIYGGCG NENNF T ++C   C
Sbjct:    1 MKVLSLIFVIFSVLVLFASAKDPVCDQPKAVGRCFAAFPKFYYNSSSGQCQAFIYGGCGGNENNFNTLEECNAKC 75          
BLAST of Kunitz-like protease inhibitor vs. TrEMBL
Match: R4GDF2 (BPTI/Kunitz inhibitor domain-containing protein OS=Anolis carolinensis OX=28377 GN=LOC100562249 PE=4 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.528e-16
Identity = 38/74 (51.35%), Postives = 48/74 (64.86%), Query Frame = 1
Query:   76 IMLVLLVLEMGQS------RDPICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            +++ LL    G S      +   C LP   G+C+ YIPRFFFN TT+ CEKFIYGGCG N+NNFETE +C  +C
Sbjct:   14 VLVCLLFFWAGLSYANKNEKRDFCILPSETGVCKMYIPRFFFNPTTKKCEKFIYGGCGGNKNNFETEKECLRAC 87          
BLAST of Kunitz-like protease inhibitor vs. TrEMBL
Match: I1ZII0 (Serine protease inhibitor-1 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 3.897e-16
Identity = 33/68 (48.53%), Postives = 45/68 (66.18%), Query Frame = 1
Query:   76 IMLVLLVLEMGQSRDPICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            I+L + V E     + IC LPK  G C+AY PR+++N+ T  CEKFIYGGC  N+NNF++  DC  +C
Sbjct:    6 ILLCICVFENISCLNSICSLPKNAGPCKAYFPRYYYNSKTGKCEKFIYGGCKGNQNNFQSSKDCEQNC 73          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Cavefish
Match: tfpi2 (tissue factor pathway inhibitor 2 [Source:NCBI gene;Acc:103023332])

HSP 1 Score: 65.0846 bits (157), Expect = 4.104e-13
Identity = 28/52 (53.85%), Postives = 33/52 (63.46%), Query Frame = 1
Query:  124 ICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            IC  P  VG CRA + R+FFN TT  CE+F YGGC  NENNF++   C   C
Sbjct:   86 ICRFPSEVGPCRALLSRYFFNMTTMQCEQFYYGGCQGNENNFQSHQSCMEYC 137          

HSP 2 Score: 62.3882 bits (150), Expect = 3.575e-12
Identity = 27/52 (51.92%), Postives = 34/52 (65.38%), Query Frame = 1
Query:  124 ICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            +C LP V G CR  + R+F+NT T+ CE+F YGGCG N NNF T  +C   C
Sbjct:   26 VCLLPAVEGPCRGLVSRYFYNTLTQRCEEFSYGGCGGNANNFVTFQECHKMC 77          

HSP 3 Score: 51.9878 bits (123), Expect = 2.565e-8
Identity = 22/52 (42.31%), Postives = 33/52 (63.46%), Query Frame = 1
Query:  124 ICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            IC+     G C A IPR+++N+  +TCE+F Y GCG + NNF ++  C + C
Sbjct:  146 ICQGVLDKGKCSASIPRYYYNSAKKTCEEFTYTGCGGSSNNFVSKQSCMDVC 197          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Cavefish
Match: wfikkn2a (WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 2-like [Source:NCBI gene;Acc:103032076])

HSP 1 Score: 63.929 bits (154), Expect = 2.823e-12
Identity = 27/62 (43.55%), Postives = 38/62 (61.29%), Query Frame = 1
Query:   94 VLEMGQSRDPICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            +L  G      C LP + G C+AY PR+ +N   + C+ F+YGGCG NENNFE+++ C   C
Sbjct:  366 MLSCGAELAAPCSLPSLQGPCKAYEPRWAYNHLLKQCQSFVYGGCGGNENNFESKEACEEMC 427          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Cavefish
Match: wfikkn2b (WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 2 [Source:NCBI gene;Acc:103024700])

HSP 1 Score: 63.1586 bits (152), Expect = 6.440e-12
Identity = 27/51 (52.94%), Postives = 35/51 (68.63%), Query Frame = 1
Query:  127 CELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            C LP + G C+AY PR+ ++ T   C+ FIYGGC  NENNFET + C +SC
Sbjct:  374 CSLPSLQGPCKAYEPRWAYSITLGQCQPFIYGGCEGNENNFETRETCEDSC 424          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Cavefish
Match: ENSAMXT00000039940.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000999.1:23065:40314:1 gene:ENSAMXG00000037874.1 transcript:ENSAMXT00000039940.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.003 bits (149), Expect = 1.302e-11
Identity = 21/52 (40.38%), Postives = 35/52 (67.31%), Query Frame = 1
Query:  124 ICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            IC+LPK  G C  ++ ++F+++ + +C +F YGGCG N N F T+++C   C
Sbjct:  437 ICKLPKEEGTCIKFVLKWFYDSVSNSCTRFWYGGCGGNLNRFNTQEECEKEC 488          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Cavefish
Match: col28a2a (collagen alpha-1(XXVIII) chain-like [Source:NCBI gene;Acc:103029985])

HSP 1 Score: 62.003 bits (149), Expect = 1.545e-11
Identity = 24/54 (44.44%), Postives = 33/54 (61.11%), Query Frame = 1
Query:  118 DPICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            DP C L    G CR Y+ R++++    +C +F YGGC  NEN FETE +C  +C
Sbjct: 1191 DPRCSLSLNQGPCREYLIRWYYDKAANSCAQFWYGGCEGNENRFETEAECKKTC 1244          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Sea Lamprey
Match: tfpi2 (tissue factor pathway inhibitor 2 [Source:ZFIN;Acc:ZDB-GENE-060503-38])

HSP 1 Score: 65.4698 bits (158), Expect = 7.766e-14
Identity = 30/51 (58.82%), Postives = 35/51 (68.63%), Query Frame = 1
Query:  127 CELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            C LP   G CRA  PR+FFN +T  CE FIYGGC +NENNFET  +C  +C
Sbjct:   27 CTLPAKPGDCRAAFPRYFFNRSTLRCESFIYGGCHSNENNFETMQECRAAC 77          

HSP 2 Score: 54.299 bits (129), Expect = 7.444e-10
Identity = 24/52 (46.15%), Postives = 30/52 (57.69%), Query Frame = 1
Query:  124 ICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            +C      G CRA+I R+F+N T   C  F+YGGCG N N FE  + C  SC
Sbjct:   86 LCRPDAETGRCRAHITRYFYNMTLGMCMPFVYGGCGGNNNRFEDMESCVFSC 137          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005038.1 (pep scaffold:Pmarinus_7.0:GL481015:31246:35903:1 gene:ENSPMAG00000004579.1 transcript:ENSPMAT00000005038.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.7658 bits (138), Expect = 3.921e-11
Identity = 26/52 (50.00%), Postives = 31/52 (59.62%), Query Frame = 1
Query:  124 ICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            IC +    G C A IPRF +N  T  CE F YGGCG N+NNF +E  C + C
Sbjct:  166 ICLMKADPGECTAVIPRFHYNPKTSNCESFTYGGCGGNDNNFSSERSCMSVC 217          

HSP 2 Score: 55.8398 bits (133), Expect = 2.305e-10
Identity = 25/51 (49.02%), Postives = 32/51 (62.75%), Query Frame = 1
Query:  127 CELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            C L   VG+CRA + R+FFN T+ +CE+F YGGC  N NNF+    C   C
Sbjct:   75 CRLDMEVGVCRALLRRYFFNMTSGSCEEFGYGGCQGNLNNFKDAASCYQHC 125          

HSP 3 Score: 54.299 bits (129), Expect = 7.439e-10
Identity = 24/44 (54.55%), Postives = 29/44 (65.91%), Query Frame = 1
Query:  148 GLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            G CRAY+PR F+N  T+ CE F YGGC  N NNFE+  +C   C
Sbjct:   10 GPCRAYLPRVFYNRYTQRCEPFHYGGCFGNGNNFESLAECNAKC 53          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005043.1 (pep scaffold:Pmarinus_7.0:GL481015:31246:35903:1 gene:ENSPMAG00000004579.1 transcript:ENSPMAT00000005043.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.7658 bits (138), Expect = 4.166e-11
Identity = 26/52 (50.00%), Postives = 31/52 (59.62%), Query Frame = 1
Query:  124 ICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            IC +    G C A IPRF +N  T  CE F YGGCG N+NNF +E  C + C
Sbjct:  165 ICLMKADPGECTAVIPRFHYNPKTSNCESFTYGGCGGNDNNFSSERSCMSVC 216          

HSP 2 Score: 55.4546 bits (132), Expect = 2.848e-10
Identity = 25/51 (49.02%), Postives = 32/51 (62.75%), Query Frame = 1
Query:  127 CELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            C L   VG+CRA + R+FFN T+ +CE+F YGGC  N NNF+    C   C
Sbjct:   74 CRLDMEVGVCRALLRRYFFNMTSGSCEEFGYGGCQGNLNNFKDAASCYQHC 124          

HSP 3 Score: 54.299 bits (129), Expect = 7.016e-10
Identity = 24/44 (54.55%), Postives = 29/44 (65.91%), Query Frame = 1
Query:  148 GLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            G CRAY+PR F+N  T+ CE F YGGC  N NNFE+  +C   C
Sbjct:   10 GPCRAYLPRVFYNRYTQRCEPFHYGGCFGNGNNFESLAECNAKC 53          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Sea Lamprey
Match: WFIKKN1 (WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1 [Source:HGNC Symbol;Acc:HGNC:30912])

HSP 1 Score: 53.9138 bits (128), Expect = 2.079e-9
Identity = 22/52 (42.31%), Postives = 32/52 (61.54%), Query Frame = 1
Query:  124 ICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            IC LP V G CR +   + +N   + C+  +YGGC  NENNFE+ + C ++C
Sbjct:  398 ICHLPPVQGPCRDWERHWAYNPLIKQCQLLVYGGCEGNENNFESREACEDNC 449          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Sea Lamprey
Match: WFIKKN1 (WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1 [Source:HGNC Symbol;Acc:HGNC:30912])

HSP 1 Score: 52.373 bits (124), Expect = 5.684e-9
Identity = 21/51 (41.18%), Postives = 33/51 (64.71%), Query Frame = 1
Query:  127 CELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            C LP   G C+ +  R+ +N   + C+ FIYGGC  NENNF++++ C ++C
Sbjct:  374 CSLPVQQGPCKQWALRWAYNPLIKRCQSFIYGGCEGNENNFQSQELCEDNC 424          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Nematostella
Match: EDO29819 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2J6])

HSP 1 Score: 71.2478 bits (173), Expect = 2.219e-17
Identity = 31/56 (55.36%), Postives = 38/56 (67.86%), Query Frame = 1
Query:  112 SRDPICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            S +  C LPK VG CRA +PR FFN+ +  CE FIYGGCG N NNF T ++C  +C
Sbjct:    9 SGNSACTLPKKVGDCRAAMPRVFFNSQSGKCEDFIYGGCGGNANNFHTMEECKKAC 64          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Nematostella
Match: EDO47795 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL41])

HSP 1 Score: 66.6254 bits (161), Expect = 1.005e-15
Identity = 25/52 (48.08%), Postives = 35/52 (67.31%), Query Frame = 1
Query:  124 ICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            IC+LPK+ G C AY+PR+++N     C+KF+YGGC  N N F++   C  SC
Sbjct:    1 ICQLPKLPGPCSAYVPRWYYNAKHRRCQKFVYGGCRGNANRFKSHRSCERSC 52          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Nematostella
Match: EDO41922 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S322])

HSP 1 Score: 64.6994 bits (156), Expect = 6.162e-15
Identity = 27/59 (45.76%), Postives = 37/59 (62.71%), Query Frame = 1
Query:  103 MGQSRDPICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            MG  +   C LP V G C AYIP F+++   E C++FIYGGC  N N F+T++ C  +C
Sbjct:    1 MGGEQPSFCSLPAVTGRCMAYIPSFYYDMKEEKCKEFIYGGCNGNLNRFDTQEKCEEAC 59          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Nematostella
Match: EDO31759 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX08])

HSP 1 Score: 64.3142 bits (155), Expect = 9.558e-15
Identity = 24/52 (46.15%), Postives = 38/52 (73.08%), Query Frame = 1
Query:  124 ICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            IC++P   G CRA +P++++N     C +FIYGGCG N NNF+T+++C ++C
Sbjct:    1 ICKMPAAAGPCRAAMPQWYYNFKRHRCIRFIYGGCGGNPNNFDTKNECKSAC 52          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Nematostella
Match: EDO41696 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3T1])

HSP 1 Score: 62.7734 bits (151), Expect = 3.736e-14
Identity = 25/51 (49.02%), Postives = 35/51 (68.63%), Query Frame = 1
Query:  127 CELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            C  PK+ G CRAY  R+F+N T+  C++F+YGGC  N NNFE++ +C   C
Sbjct:    2 CLQPKLTGPCRAYFERWFYNQTSRKCKQFVYGGCQGNSNNFESKAECEKKC 52          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Medaka
Match: spint1a (kunitz-type protease inhibitor 1 [Source:NCBI gene;Acc:101175207])

HSP 1 Score: 65.855 bits (159), Expect = 6.185e-13
Identity = 30/69 (43.48%), Postives = 45/69 (65.22%), Query Frame = 1
Query:   73 TIMLVLLVLEMGQSRDPICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            + ++ +LVL   QS D  C +PK VG CR   PR+++N  +E CE F +GGC  N+NN+ TE++C  +C
Sbjct:  217 STVVTVLVLTPEQSMD-HCLVPKKVGPCRGSFPRWYYNAASEKCETFFFGGCRQNKNNYLTEEECAMAC 284          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Medaka
Match: wfikkn2a (WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 2 [Source:NCBI gene;Acc:101168544])

HSP 1 Score: 64.6994 bits (156), Expect = 1.660e-12
Identity = 27/62 (43.55%), Postives = 40/62 (64.52%), Query Frame = 1
Query:   94 VLEMGQSRDPICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            +L  G      C LP + G C+AY PR+ +++T + C+ F+YGGCG NENNFE+++ C   C
Sbjct:  377 MLACGGELAAPCSLPSLQGPCKAYEPRWAYSSTLKKCQSFVYGGCGGNENNFESKEACEQMC 438          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Medaka
Match: COL6A3 (collagen type VI alpha 3 chain [Source:NCBI gene;Acc:101161016])

HSP 1 Score: 64.3142 bits (155), Expect = 3.071e-12
Identity = 21/52 (40.38%), Postives = 38/52 (73.08%), Query Frame = 1
Query:  124 ICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            IC+LPK  G C  +  +++++TT+++C +F YGGC  N+N F+T+++C  +C
Sbjct: 2638 ICQLPKQEGSCAEFALKWYYDTTSKSCTRFWYGGCDGNQNRFDTQEECKEAC 2689          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Medaka
Match: col28a2a (collagen alpha-1(XXVIII) chain [Source:NCBI gene;Acc:101157899])

HSP 1 Score: 63.929 bits (154), Expect = 3.272e-12
Identity = 24/54 (44.44%), Postives = 33/54 (61.11%), Query Frame = 1
Query:  118 DPICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            DP C +    G CR Y+ R++++     C +F YGGCG NEN FETE +C  +C
Sbjct:  967 DPRCSITLDQGTCRDYVIRWYYDQQANACAQFWYGGCGGNENRFETESECKKTC 1020          
BLAST of Kunitz-like protease inhibitor vs. Ensembl Medaka
Match: APP (amyloid-beta A4 protein [Source:NCBI gene;Acc:101162104])

HSP 1 Score: 62.7734 bits (151), Expect = 9.023e-12
Identity = 25/52 (48.08%), Postives = 33/52 (63.46%), Query Frame = 1
Query:  124 ICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            +C      G CRA +PR+FF+     C +FIYGGCG N NNFE+E+ C + C
Sbjct:  329 VCWADAETGPCRALLPRWFFDREEGRCVQFIYGGCGGNRNNFESEEYCMSVC 380          
BLAST of Kunitz-like protease inhibitor vs. Planmine SMEST
Match: SMESG000037997.1 (SMESG000037997.1)

HSP 1 Score: 82.8037 bits (203), Expect = 2.612e-21
Identity = 37/77 (48.05%), Postives = 53/77 (68.83%), Query Frame = 1
Query:   49 IEMKYIAFTIMLVLLVLEMGQSRDPICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            ++ K I +  +++  ++   +S +P CE P V GLC AY PR+F+N T+E CE+FIYGGCGAN NNF+T  DC + C
Sbjct:    1 MKTKLIIWLALVLSFIIFTIESLEPNCEDPLVKGLCEAYFPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC 77          
BLAST of Kunitz-like protease inhibitor vs. Planmine SMEST
Match: SMESG000038002.1 (SMESG000038002.1)

HSP 1 Score: 80.1073 bits (196), Expect = 2.178e-20
Identity = 37/72 (51.39%), Postives = 49/72 (68.06%), Query Frame = 1
Query:   64 IAFTIMLVLLVLEMGQSRDPICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            +A  +  ++  +E   S +P CE P V GLC AY PR+F+N T+E CE+FIYGGCGAN NNF+T  DC + C
Sbjct:    9 LALVLSFIIFTIE---SLEPNCEDPLVKGLCEAYFPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC 77          
BLAST of Kunitz-like protease inhibitor vs. Planmine SMEST
Match: SMESG000013910.1 (SMESG000013910.1)

HSP 1 Score: 78.9518 bits (193), Expect = 5.896e-20
Identity = 34/67 (50.75%), Postives = 44/67 (65.67%), Query Frame = 1
Query:   79 MLVLLVLEMGQSRDPICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            ++  + + +G  ++P C LPK VGLCR Y PR+FFN  T  CEKFIYGGC  N+NNF T  +C   C
Sbjct:    4 VIFAVAIHLGDCKEPECSLPKEVGLCRGYFPRYFFNEETGKCEKFIYGGCQGNKNNFYTPIECRARC 70          
BLAST of Kunitz-like protease inhibitor vs. Planmine SMEST
Match: SMESG000037994.1 (SMESG000037994.1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.941e-19
Identity = 34/75 (45.33%), Postives = 45/75 (60.00%), Query Frame = 1
Query:   55 MKYIAFTIMLVLLVLEMGQSRDPICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            M  I    ++  ++  +G+SR P C  PK  G+C AY PRF+FN  +  CE FIYGGC AN NNF T ++C   C
Sbjct:    1 MNSIVIFTLIFCVIFSLGESRAPECNEPKKTGMCAAYFPRFYFNIQSGNCESFIYGGCQANGNNFNTIEECEARC 75          
BLAST of Kunitz-like protease inhibitor vs. Planmine SMEST
Match: SMESG000037996.1 (SMESG000037996.1)

HSP 1 Score: 77.7962 bits (190), Expect = 8.641e-19
Identity = 36/72 (50.00%), Postives = 50/72 (69.44%), Query Frame = 1
Query:   64 IAFTIMLVLLVLEMGQSRDPICELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            I   ++L  ++  + +S +  CE P   GLC+AYIPR+F+N T+E CE+FIYGGCGAN NNF+T  DC + C
Sbjct:    7 ICLPLVLSFIIFTI-ESLEQNCEDPLAKGLCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKTLKDCQDLC 77          

HSP 2 Score: 72.4034 bits (176), Expect = 1.232e-16
Identity = 31/51 (60.78%), Postives = 38/51 (74.51%), Query Frame = 1
Query:  127 CELPKVVGLCRAYIPRFFFNTTTETCEKFIYGGCGANENNFETEDDCTNSC 279
            CE P   G C+AYIPR+F+N T+E CE+FIYGGCGAN NNF+   DC + C
Sbjct:   85 CEDPLAKGFCKAYIPRYFYNDTSEKCERFIYGGCGANGNNFKILKDCQDFC 135          
The following BLAST results are available for this feature:
BLAST of Kunitz-like protease inhibitor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
COL6A37.037e-1337.68collagen type VI alpha 3 chain [Source:HGNC Symbol... [more]
COL6A37.037e-1337.68collagen type VI alpha 3 chain [Source:HGNC Symbol... [more]
COL6A37.074e-1337.68collagen type VI alpha 3 chain [Source:HGNC Symbol... [more]
COL6A37.074e-1337.68collagen type VI alpha 3 chain [Source:HGNC Symbol... [more]
COL6A37.089e-1337.68collagen type VI alpha 3 chain [Source:HGNC Symbol... [more]
back to top
BLAST of Kunitz-like protease inhibitor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mlt-113.108e-1148.08pep chromosome:WBcel235:V:20667211:20678513:1 gene... [more]
mlt-113.195e-1148.08pep chromosome:WBcel235:V:20667209:20678513:1 gene... [more]
mlt-113.199e-1148.08pep chromosome:WBcel235:V:20667211:20678513:1 gene... [more]
mlt-113.364e-1148.08pep chromosome:WBcel235:V:20667209:20678513:1 gene... [more]
mlt-113.693e-1148.08pep chromosome:WBcel235:V:20667209:20678513:1 gene... [more]
back to top
BLAST of Kunitz-like protease inhibitor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
IM331.175e-1646.25gene:FBgn0031561 transcript:FBtr0077546[more]
IM331.175e-1646.25gene:FBgn0031561 transcript:FBtr0345610[more]
CG35131.563e-1132.56gene:FBgn0031559 transcript:FBtr0077549[more]
CG36043.741e-1145.10gene:FBgn0031562 transcript:FBtr0077545[more]
CG36043.741e-1145.10gene:FBgn0031562 transcript:FBtr0346581[more]
back to top
BLAST of Kunitz-like protease inhibitor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spint27.847e-1456.86serine peptidase inhibitor, Kunitz type, 2 [Source... [more]
spint28.478e-1456.86serine peptidase inhibitor, Kunitz type, 2 [Source... [more]
wfikkn2a2.751e-1243.55info WAP, follistatin/kazal, immunoglobulin, kunit... [more]
col28a2a4.220e-1238.10collagen, type XXVIII, alpha 2a [Source:ZFIN;Acc:Z... [more]
col28a2a4.256e-1238.10collagen, type XXVIII, alpha 2a [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Kunitz-like protease inhibitor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
APLP28.076e-1348.08amyloid beta (A4) precursor-like protein 2 [Source... [more]
APLP28.086e-1348.08amyloid beta (A4) precursor-like protein 2 [Source... [more]
APLP28.086e-1348.08amyloid beta (A4) precursor-like protein 2 [Source... [more]
APLP28.105e-1348.08amyloid beta (A4) precursor-like protein 2 [Source... [more]
APLP28.226e-1348.08amyloid beta (A4) precursor-like protein 2 [Source... [more]
back to top
BLAST of Kunitz-like protease inhibitor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Eppin6.883e-1351.92epididymal peptidase inhibitor [Source:MGI Symbol;... [more]
Wfdc6b7.318e-1351.92WAP four-disulfide core domain 6B [Source:MGI Symb... [more]
Aplp21.362e-1248.08amyloid beta (A4) precursor-like protein 2 [Source... [more]
Wfikkn21.545e-1250.00WAP, follistatin/kazal, immunoglobulin, kunitz and... [more]
Wfdc6a1.656e-1249.09WAP four-disulfide core domain 6A [Source:MGI Symb... [more]
back to top
BLAST of Kunitz-like protease inhibitor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P0DN08|VKT53_ANEVI3.597e-1848.53KappaPI-actitoxin-Avd3e OS=Anemonia viridis OX=517... [more]
sp|Q2ES47|VKT4_DABRR5.023e-1855.17Kunitz-type serine protease inhibitor 4 OS=Daboia ... [more]
sp|P0DN18|VKTE_ANEVI1.082e-1747.06U-actitoxin-Avd3q OS=Anemonia viridis OX=51769 PE=... [more]
sp|Q8WPI3|BOOG2_RHIMP1.720e-1752.00Boophilin-G2 OS=Rhipicephalus microplus OX=6941 GN... [more]
sp|P0DMW7|VKT3B_ACTEQ2.008e-1759.62PI-actitoxin-Aeq3b OS=Actinia equina OX=6106 PE=1 ... [more]
back to top
BLAST of Kunitz-like protease inhibitor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C1IBY48.129e-1844.00Tabserpin OS=Tabanus yao OX=485572 PE=2 SV=1[more]
C8YJ951.491e-1742.67Serine protease inhibitor 3 OS=Tabanus yao OX=4855... [more]
C8YJ941.179e-1640.00Serine protease inhibitor 2 OS=Tabanus yao OX=4855... [more]
R4GDF21.528e-1651.35BPTI/Kunitz inhibitor domain-containing protein OS... [more]
I1ZII03.897e-1648.53Serine protease inhibitor-1 (Fragment) OS=Schmidte... [more]
back to top
BLAST of Kunitz-like protease inhibitor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tfpi24.104e-1353.85tissue factor pathway inhibitor 2 [Source:NCBI gen... [more]
wfikkn2a2.823e-1243.55WAP, Kazal, immunoglobulin, Kunitz and NTR domain-... [more]
wfikkn2b6.440e-1252.94WAP, Kazal, immunoglobulin, Kunitz and NTR domain-... [more]
ENSAMXT00000039940.11.302e-1140.38pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
col28a2a1.545e-1144.44collagen alpha-1(XXVIII) chain-like [Source:NCBI g... [more]
back to top
BLAST of Kunitz-like protease inhibitor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tfpi27.766e-1458.82tissue factor pathway inhibitor 2 [Source:ZFIN;Acc... [more]
ENSPMAT00000005038.13.921e-1150.00pep scaffold:Pmarinus_7.0:GL481015:31246:35903:1 g... [more]
ENSPMAT00000005043.14.166e-1150.00pep scaffold:Pmarinus_7.0:GL481015:31246:35903:1 g... [more]
WFIKKN12.079e-942.31WAP, follistatin/kazal, immunoglobulin, kunitz and... [more]
WFIKKN15.684e-941.18WAP, follistatin/kazal, immunoglobulin, kunitz and... [more]
back to top
BLAST of Kunitz-like protease inhibitor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Kunitz-like protease inhibitor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO298192.219e-1755.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO477951.005e-1548.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO419226.162e-1545.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317599.558e-1546.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO416963.736e-1449.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Kunitz-like protease inhibitor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spint1a6.185e-1343.48kunitz-type protease inhibitor 1 [Source:NCBI gene... [more]
wfikkn2a1.660e-1243.55WAP, follistatin/kazal, immunoglobulin, kunitz and... [more]
COL6A33.071e-1240.38collagen type VI alpha 3 chain [Source:NCBI gene;A... [more]
col28a2a3.272e-1244.44collagen alpha-1(XXVIII) chain [Source:NCBI gene;A... [more]
APP9.023e-1248.08amyloid-beta A4 protein [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Kunitz-like protease inhibitor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000037997.12.612e-2148.05SMESG000037997.1[more]
SMESG000038002.12.178e-2051.39SMESG000038002.1[more]
SMESG000013910.15.896e-2050.75SMESG000013910.1[more]
SMESG000037994.11.941e-1945.33SMESG000037994.1[more]
SMESG000037996.18.641e-1950.00SMESG000037996.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022118 ID=SMED30022118|Name=Kunitz-like protease inhibitor|organism=Schmidtea mediterranea sexual|type=transcript|length=479bp
TTTTTTTTTTTNTTTTTTTTTTTNTTTTTTTTTTTTTTTTTTTCATAAAT
TGAAATGAAATATATAGCTTTTACAATTATGCTAGTTTTACTAGTTCTTG
AAATGGGACAAAGTCGAGATCCAATATGCGAATTACCTAAGGTAGTTGGA
TTATGCAGAGCGTATATTCCAAGATTTTTTTTCAACACAACCACTGAAAC
ATGCGAGAAATTCATTTATGGCGGATGTGGAGCAAATGAAAACAATTTCG
AAACTGAAGACGATTGCACCAATTCGTGTGAAGAGTAGTTTGAAAGACTT
TTGAATTTGTTGGAAAATATTACAAAATTTGATAAACAACTTTTTGTATT
GTGTTGTTAATTATTTGTGCCATACAAATTACAGAGAACAATTTGATATT
CCAAAAGAATATAATTTACCCTTTGTAAATTCAAGTATTTTGCAATGTAT
TTTCAGGTAAAAATAAATTTCAAAAAAAA
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000421tail
Vocabulary: INTERPRO
TermDefinition
IPR002223Kunitz_BPTI
IPR020901Prtase_inh_Kunz-CS
Vocabulary: molecular function
TermDefinition
GO:0004867serine-type endopeptidase inhibitor activity
GO:0030414peptidase inhibitor activity
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
Vocabulary: biological process
TermDefinition
GO:0010466negative regulation of peptidase activity
GO:0010951negative regulation of endopeptidase activity