GCR032

Overview
NameGCR032
Smed IDSMED30022111
Length (bp)1436
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GCR032 (SMED30022111) t-SNE clustered cells

Violin plots show distribution of expression levels for GCR032 (SMED30022111) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GCR032 (SMED30022111) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GCR032 (SMED30022111) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022111

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30022111SMESG000009917.1 dd_Smed_v4_14650_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30022111SMESG000009917.1 dd_Smed_v4_14650_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30022111SMESG000009917.1 dd_Smed_v4_14650_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30022111SMESG000009917.1 dd_Smed_v4_14650_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30022111SMESG000009917.1 dd_Smed_v4_14650_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
enteric muscle cellSMED30022111SMESG000009917.1 dd_Smed_v4_14650_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GCR032 vs. Ensembl Human
Match: GALR2 (galanin receptor 2 [Source:HGNC Symbol;Acc:HGNC:4133])

HSP 1 Score: 140.584 bits (353), Expect = 1.320e-36
Identity = 89/285 (31.23%), Postives = 143/285 (50.18%), Query Frame = 2
Query:  227 LRNG-----TNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLL--------FNSGVAYPPTSVNDTKDF-YCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSV 1039
            LR G     TN+ I +L +AD+ FI  CVP  ATI+   GW  GS+ CK   F  +LT + S +TL  +S+DRYLA+ +P+ S  +RT +N L  +   W + +L + P L         N  V +P  S    +    CT+                            +F+YLLP+  + L Y   + + L+ +   ++    A ++K++VTRM++IV  +F LCWMP   + +  + G  P   A  A  + +  ++Y+NS +NPI+YA  S +FR  F+++
Sbjct:   51 LRGGQAVSTTNLFILNLGVADLCFILCCVPFQATIYTLDGWVFGSLLCKAVHFLIFLTMHASSFTLAAVSLDRYLAIRYPLHSRELRTPRNALAAIGLIWGLSLLFSGPYLSYYRQSQLANLTVCHPAWSAPRRRAMDICTF----------------------------VFSYLLPVLVLGLTYARTL-RYLWRAVDPVAAGSGARRAKRKVTRMILIVAALFCLCWMPHHALILCVWFGQFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFRKGFRTI 306          
BLAST of GCR032 vs. Ensembl Human
Match: OPRM1 (opioid receptor mu 1 [Source:HGNC Symbol;Acc:HGNC:8156])

HSP 1 Score: 134.035 bits (336), Expect = 5.793e-34
Identity = 102/323 (31.58%), Postives = 161/323 (49.85%), Query Frame = 2
Query:  224 QLRNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVLFCQKQSFSGRDFEKTNLNINRNLSEQRASRKALTKKDCEVNIYSDNKNNK 1192
            +++  TNI I +LA+AD    T  +P  +  ++   W  G+I CKI     Y   + S++TL  MSVDRY+AV HP+ ++  RT +N   I +  W++      P++F +   Y   S++ T  F     PT         Y EN     + I +F IFA+++P+  I + Y  +I +L   S   +S S +  ++ +R+TRMV++VV +F +CW PI I  II+ L + P+         F  AL Y+NS +NP+LYAF   NF+  F+   FC   S +      T +  N       A+    T    E+N+    +N K
Sbjct:  100 KMKTATNIYIFNLALAD-ALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIINVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTF---SHPT--------WYWEN----LLKICVF-IFAFIMPVLIITVCYGLMILRL--KSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALVTIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFRE--FCIPTSSNIEQQNSTRIRQNTRDHPSTANTVDRTNHQVELNLDCHCENAK 401          
BLAST of GCR032 vs. Ensembl Human
Match: OPRM1 (opioid receptor mu 1 [Source:HGNC Symbol;Acc:HGNC:8156])

HSP 1 Score: 130.954 bits (328), Expect = 1.149e-33
Identity = 93/275 (33.82%), Postives = 146/275 (53.09%), Query Frame = 2
Query:  224 QLRNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVLFC 1048
            +++  TNI I +LA+AD    T  +P  +  ++   W  G+I CKI     Y   + S++TL  MSVDRY+AV HP+ ++  RT +N   I +  W++      P++F +   Y   S++ T  F     PT         Y EN     + I +F IFA+++P+  I + Y  +I +L   S   +S S +  ++ +R+TRMV++VV +F +CW PI I  II+ L + P+         F  AL Y+NS +NP+LYAF   NF+  F+   FC
Sbjct:   19 KMKTATNIYIFNLALAD-ALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIINVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTF---SHPT--------WYWEN----LLKICVF-IFAFIMPVLIITVCYGLMILRL--KSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALVTIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFRE--FC 272          
BLAST of GCR032 vs. Ensembl Human
Match: OPRM1 (opioid receptor mu 1 [Source:HGNC Symbol;Acc:HGNC:8156])

HSP 1 Score: 130.183 bits (326), Expect = 1.379e-33
Identity = 100/326 (30.67%), Postives = 161/326 (49.39%), Query Frame = 2
Query:  227 LRNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVLFCQKQSFSGRDFEKTNLNINRNLSEQRASRKALTKKDCEVNIYSDNKNNKILSS 1204
            ++  TNI I +LA+AD    T  +P  +  ++   W  G+I CKI     Y   + S++TL  MSVDRY+AV HP+ ++  RT +N   I +  W++      P++F +   Y   S++ T  F     PT         Y EN     + I +F IFA+++P+  I + Y  +I +L   S   +S S +  ++ +R+TRMV++VV +F +CW PI I  II+ L + P+         F  AL Y+NS +NP+LYAF   NF+  F+   FC   S               N+ +Q ++R     +D      + ++ N  L +
Sbjct:    1 MKTATNIYIFNLALAD-ALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIINVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTF---SHPT--------WYWEN----LLKICVF-IFAFIMPVLIITVCYGLMILRL--KSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALVTIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFRE--FCIPTS--------------SNIEQQNSTRIRQNTRDHPSTANTVDRTNHQLEN 291          
BLAST of GCR032 vs. Ensembl Human
Match: OPRM1 (opioid receptor mu 1 [Source:HGNC Symbol;Acc:HGNC:8156])

HSP 1 Score: 130.183 bits (326), Expect = 1.379e-33
Identity = 100/326 (30.67%), Postives = 161/326 (49.39%), Query Frame = 2
Query:  227 LRNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVLFCQKQSFSGRDFEKTNLNINRNLSEQRASRKALTKKDCEVNIYSDNKNNKILSS 1204
            ++  TNI I +LA+AD    T  +P  +  ++   W  G+I CKI     Y   + S++TL  MSVDRY+AV HP+ ++  RT +N   I +  W++      P++F +   Y   S++ T  F     PT         Y EN     + I +F IFA+++P+  I + Y  +I +L   S   +S S +  ++ +R+TRMV++VV +F +CW PI I  II+ L + P+         F  AL Y+NS +NP+LYAF   NF+  F+   FC   S               N+ +Q ++R     +D      + ++ N  L +
Sbjct:    1 MKTATNIYIFNLALAD-ALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIINVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTF---SHPT--------WYWEN----LLKICVF-IFAFIMPVLIITVCYGLMILRL--KSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALVTIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFRE--FCIPTS--------------SNIEQQNSTRIRQNTRDHPSTANTVDRTNHQLEN 291          
BLAST of GCR032 vs. Ensembl Celegans
Match: npr-9 (Galanin-like G-protein coupled receptor npr-9 [Source:UniProtKB/Swiss-Prot;Acc:Q23497])

HSP 1 Score: 143.665 bits (361), Expect = 9.956e-38
Identity = 96/301 (31.89%), Postives = 151/301 (50.17%), Query Frame = 2
Query:  218 NKQLRNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVND---TKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLL------------------FNSESRISQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLG-SEP----DNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVL 1042
             +Q+RN TN LI  LAI+D+ F+  CVP TA  +    W      C +  FF + +AY SV+TL LM++DRYLAVV+P+ S+ +RT +N +  +   ++I +    P+    G+      V D    K   C  +       T+          R Y + F++F Y+LPL   ++LY  ++ KL                    +S S I +  +A  +K++VTR+V+ V++ +ALCW+P+ + F +  L   EP             + +  LAY+NS +NPILYA  S +FR  F  V+
Sbjct:   70 GRQMRNSTNTLIIGLAISDLMFLLLCVPFTAVDYAAPTWIFPEWTCSMINFFQHTSAYCSVWTLTLMALDRYLAVVYPVESMTLRTPRNTVIALCFIYIIIIASQIPVGRMHGIY-----VYDFIMEKRSTCAIL-------TIATAEATPTMARTYFMTFNVFGYVLPLGISVVLYGLMLRKLWDMPRPGNSQSVGGRNLTNRDSGSSIRRRPEATAAKRKVTRLVLCVLITWALCWLPLNVCFFMSGLAYPEPLVISHGVIMVIVQIASQVLAYTNSCLNPILYALMSQSFREGFIRVM 358          
BLAST of GCR032 vs. Ensembl Celegans
Match: npr-22 (Neuropeptide receptor 22 [Source:UniProtKB/Swiss-Prot;Acc:Q59E83])

HSP 1 Score: 112.079 bits (279), Expect = 1.374e-26
Identity = 85/283 (30.04%), Postives = 144/283 (50.88%), Query Frame = 2
Query:  221 KQLRNGTNILIASLAIADITFITFCVPLT---ATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENG-QFGRVYILLFSIFAYLLPLSAIILLYTFLIWKL-------LFNSESRISQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVF--IIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAF 1030
            K+LR  TNILI +LA+AD+    FC+P +     I+  + W  GS+ C +  F   +  ++S +TLV++S DR++A++  +      T +  L +V +TW+  +L   PLLF        T   + +D     +P    N T  G  ++G Q  +VY  +  I  Y++P + +I+ YT +  K+       + N  ++    D+  +S K++  MV+++  +FALCW+P+ I+   I +F               FA  LA S+SM+NPI+Y   +  FR  F
Sbjct:   79 KRLRTATNILILNLAVADLLISVFCIPFSYWQVLIYDDQRWLFGSMMCSLLAFLQAMAVFLSAWTLVVISFDRWMAIMFLLTPNIRITRRRALYLVAATWIFSILMALPLLFT-------TRFFEDQD----GLPNCGENWTYFG--DSGEQVRKVYSSMVLILQYVVPQAVLIITYTHIGIKMWNSRVPGMQNGATKKMIVDRH-ESVKKLVPMVILISALFALCWLPLLILINVIPEFYPDINSWGYILYLWWFAHGLAMSHSMVNPIIYFIRNARFREGF 347          
BLAST of GCR032 vs. Ensembl Celegans
Match: npr-22 (Neuropeptide receptor 22 [Source:UniProtKB/Swiss-Prot;Acc:Q59E83])

HSP 1 Score: 111.694 bits (278), Expect = 1.600e-26
Identity = 85/283 (30.04%), Postives = 144/283 (50.88%), Query Frame = 2
Query:  221 KQLRNGTNILIASLAIADITFITFCVPLT---ATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENG-QFGRVYILLFSIFAYLLPLSAIILLYTFLIWKL-------LFNSESRISQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVF--IIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAF 1030
            K+LR  TNILI +LA+AD+    FC+P +     I+  + W  GS+ C +  F   +  ++S +TLV++S DR++A++  +      T +  L +V +TW+  +L   PLLF        T   + +D     +P    N T  G  ++G Q  +VY  +  I  Y++P + +I+ YT +  K+       + N  ++    D+  +S K++  MV+++  +FALCW+P+ I+   I +F               FA  LA S+SM+NPI+Y   +  FR  F
Sbjct:   79 KRLRTATNILILNLAVADLLISVFCIPFSYWQVLIYDDQRWLFGSMMCSLLAFLQAMAVFLSAWTLVVISFDRWMAIMFLLTPNIRITRRRALYLVAATWIFSILMALPLLFT-------TRFFEDQD----GLPNCGENWTYFG--DSGEQVRKVYSSMVLILQYVVPQAVLIITYTHIGIKMWNSRVPGMQNGATKKMIVDRH-ESVKKLVPMVILISALFALCWLPLLILINVIPEFYPDINSWGYILYLWWFAHGLAMSHSMVNPIIYFIRNARFREGF 347          
BLAST of GCR032 vs. Ensembl Celegans
Match: npr-6 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:Q20275])

HSP 1 Score: 93.9745 bits (232), Expect = 1.412e-20
Identity = 78/283 (27.56%), Postives = 139/283 (49.12%), Query Frame = 2
Query:  218 NKQLRNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTE---KNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFY-CTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASA--LAYSNSMMNPILYAFFSNNFRVAFKSVLFC 1048
            NK+++  TNI I +LA++DI      + LT T      W  G   C     F   + ++S +TL  +++DRY+ +VH  ++I I      ++ L  ++  W+  +L   P   N  + Y    +++  DF  C+                N +F  ++ ++  I  ++LP   I + Y   IW L  NS   +++    ++ KKR+ RM++++VVIFA+CW P  ++  ++ L  +     + +F VF S   ++ + +  NPILYAF +  FR  F  V+ C
Sbjct:   65 NKRMQTITNIFITNLAVSDIMVNFTSLWLTPTYTSIGHWIFGGGLCHGLPLFQGTSIFISTWTLTAIAIDRYIVIVHNSSNININDRMSMRSCLSFIVLIWLCSLLLVTPYAINMKLNY----IHEPCDFLICS------------EDWSNAEFRSIFGIVVMILQFILPFVLIAISY-IKIW-LFLNSRQSMTERKSDIKRKKRLLRMLIVMVVIFAICWFPFNLLNCLRDLKLDNFMRGYFSF-VFLSVHLMSMTATAWNPILYAFMNETFREEFAKVVPC 328          
BLAST of GCR032 vs. Ensembl Celegans
Match: npr-24 (NeuroPeptide Receptor family [Source:UniProtKB/TrEMBL;Acc:Q23033])

HSP 1 Score: 93.2041 bits (230), Expect = 1.518e-20
Identity = 84/293 (28.67%), Postives = 136/293 (46.42%), Query Frame = 2
Query:  221 KQLRNGTNILIASLAIADITFITFCVPLTATIFIK---KGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPL-LFNSGVAYPPTSVNDTKDFYCTYM--------PTVRYNETLMGYLENGQFG--RVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVTR---MXXXXXXXFALCWMPIQIV--FIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVL 1042
            + +R  +NI I +LA+AD+ F+     +  ++F +    GW  G I CK+Y     ++ + S   + ++S DRYLAV  PI S   RT +    + ++ W++ +L   PL LF   +    +S  + +   C                NETL+  +E       R +I      +YL+PL A+   Y  +I K+    + +     K   +KKR T+   M + +V+ +  CW+P  IV   I   L  +     F   H FA AL Y NS  NP LY F S++F+   + +L
Sbjct:   47 RDMRTISNIYIFNLAVADLLFL---CGIPVSLFAQSSHDGWIWGPIMCKLYISGNAVSQFASAVFIAILSFDRYLAVCRPIQSKSFRTTQAAFALSVAAWIMVILEMTPLFLFVKLI--KSSSAGEARGGSCMLFVGNVTVLESATEMNETLLNEIEQNMLASRRFFISYTFALSYLIPLVAVWYFYFKIILKM---CQRKRQMQTKRTATKKRTTKVTIMGLAIVISYTHCWLPFWIVQWSIEANLFEKSKYLLFCCTH-FAFALQYINSAANPFLYVFLSDSFQKNIQKLL 330          
BLAST of GCR032 vs. Ensembl Fly
Match: AstA-R1 (gene:FBgn0266429 transcript:FBtr0333798)

HSP 1 Score: 161.77 bits (408), Expect = 1.264e-44
Identity = 100/277 (36.10%), Postives = 163/277 (58.84%), Query Frame = 2
Query:  218 NKQLRNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVLFC 1048
            N+Q+R+ TN+LI +LA++DI F+ FCVP TAT ++   W  G++ CK  Q+   +T + SVYTLVLMS DR+LAVVHP+ S+ +RTE+N    ++  W+  +    P+  +  V       +      C +  T     +L+G+  +          F + +Y+ PL+ I  LY  ++ + L+ S      S ++ + K+RVTRMVV+VV+ FA+CW+PI ++ +++ L     +       + +  +AY+NS +NPILYAF S+NFR AF+ V++C
Sbjct:  102 NQQMRSTTNLLIINLAVSDILFVIFCVPFTATDYVLPEWPFGNVWCKFVQYMIVVTCHCSVYTLVLMSFDRFLAVVHPVTSMSLRTERNATLAIMCAWITIVTTAIPVALSHSVRI--YQYHGNAGTACVF-STEEEIWSLVGFQVS----------FFLSSYVAPLTLICFLYMGMLAR-LWKSAPGCKPSAESRKGKRRVTRMVVVVVLAFAICWLPIHVILVLKALNLYGGSHLSVIIQIISHVVAYTNSCINPILYAFLSDNFRKAFRKVVWC 364          
BLAST of GCR032 vs. Ensembl Fly
Match: AstA-R1 (gene:FBgn0266429 transcript:FBtr0070575)

HSP 1 Score: 161.77 bits (408), Expect = 1.264e-44
Identity = 100/277 (36.10%), Postives = 163/277 (58.84%), Query Frame = 2
Query:  218 NKQLRNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVLFC 1048
            N+Q+R+ TN+LI +LA++DI F+ FCVP TAT ++   W  G++ CK  Q+   +T + SVYTLVLMS DR+LAVVHP+ S+ +RTE+N    ++  W+  +    P+  +  V       +      C +  T     +L+G+  +          F + +Y+ PL+ I  LY  ++ + L+ S      S ++ + K+RVTRMVV+VV+ FA+CW+PI ++ +++ L     +       + +  +AY+NS +NPILYAF S+NFR AF+ V++C
Sbjct:  102 NQQMRSTTNLLIINLAVSDILFVIFCVPFTATDYVLPEWPFGNVWCKFVQYMIVVTCHCSVYTLVLMSFDRFLAVVHPVTSMSLRTERNATLAIMCAWITIVTTAIPVALSHSVRI--YQYHGNAGTACVF-STEEEIWSLVGFQVS----------FFLSSYVAPLTLICFLYMGMLAR-LWKSAPGCKPSAESRKGKRRVTRMVVVVVLAFAICWLPIHVILVLKALNLYGGSHLSVIIQIISHVVAYTNSCINPILYAFLSDNFRKAFRKVVWC 364          
BLAST of GCR032 vs. Ensembl Fly
Match: AstA-R2 (gene:FBgn0039595 transcript:FBtr0085316)

HSP 1 Score: 158.303 bits (399), Expect = 1.036e-43
Identity = 103/282 (36.52%), Postives = 159/282 (56.38%), Query Frame = 2
Query:  218 NKQLRNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFG-RVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFK-AFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVLFCQKQ 1057
            N  +R+ TN++I +LA AD+ F+  C+P TAT ++   W  G   C+  Q+   +TA+ S+YTLVLMS+DR+LAVVHPI S  +RTE   L  +++ W++ ++ + P+ F   V     +  +     CT+               N   G R Y + F I +YLLPL  I  LY  +I + L+   + +  S ++ + +KRVTR+VV+VV+ FA  W+P+Q++ +++ L     N   K    V A  LAYS+S +NP+LYAF S NFR AF   + C  +
Sbjct:   66 NNNMRSTTNLMIVNLAAADLMFVILCIPFTATDYMVYYWPYGRFWCRSVQYLIVVTAFASIYTLVLMSIDRFLAVVHPIRSRMMRTENITLIAIVTLWIVVLVVSVPVAFTHDVVVDYDAKKNITYGMCTFT-------------TNDFLGPRTYQVTFFISSYLLPLMIISGLYMRMIMR-LWRQGTGVRMSKESQRGRKRVTRLVVVVVIAFASLWLPVQLILLLKSLDVIETNTLTKLVIQVTAQTLAYSSSCINPLLYAFLSENFRKAFYKAVNCSSR 333          
BLAST of GCR032 vs. Ensembl Fly
Match: AstA-R2 (gene:FBgn0039595 transcript:FBtr0336790)

HSP 1 Score: 158.303 bits (399), Expect = 1.036e-43
Identity = 103/282 (36.52%), Postives = 159/282 (56.38%), Query Frame = 2
Query:  218 NKQLRNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFG-RVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFK-AFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVLFCQKQ 1057
            N  +R+ TN++I +LA AD+ F+  C+P TAT ++   W  G   C+  Q+   +TA+ S+YTLVLMS+DR+LAVVHPI S  +RTE   L  +++ W++ ++ + P+ F   V     +  +     CT+               N   G R Y + F I +YLLPL  I  LY  +I + L+   + +  S ++ + +KRVTR+VV+VV+ FA  W+P+Q++ +++ L     N   K    V A  LAYS+S +NP+LYAF S NFR AF   + C  +
Sbjct:   66 NNNMRSTTNLMIVNLAAADLMFVILCIPFTATDYMVYYWPYGRFWCRSVQYLIVVTAFASIYTLVLMSIDRFLAVVHPIRSRMMRTENITLIAIVTLWIVVLVVSVPVAFTHDVVVDYDAKKNITYGMCTFT-------------TNDFLGPRTYQVTFFISSYLLPLMIISGLYMRMIMR-LWRQGTGVRMSKESQRGRKRVTRLVVVVVIAFASLWLPVQLILLLKSLDVIETNTLTKLVIQVTAQTLAYSSSCINPLLYAFLSENFRKAFYKAVNCSSR 333          
BLAST of GCR032 vs. Ensembl Fly
Match: AstA-R2 (gene:FBgn0039595 transcript:FBtr0308641)

HSP 1 Score: 156.377 bits (394), Expect = 4.738e-43
Identity = 102/273 (37.36%), Postives = 156/273 (57.14%), Query Frame = 2
Query:  218 NKQLRNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFG-RVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFK-AFHVFASALAYSNSMMNPILYAFFSNNFRVAF 1030
            N  +R+ TN++I +LA AD+ F+  C+P TAT ++   W  G   C+  Q+   +TA+ S+YTLVLMS+DR+LAVVHPI S  +RTE   L  +++ W++ ++ + P+ F   V     +  +     CT+               N   G R Y + F I +YLLPL  I  LY  +I + L+   + +  S ++ + +KRVTR+VV+VV+ FA  W+P+Q++ +++ L     N   K    V A  LAYS+S +NP+LYAF S NFR AF
Sbjct:   66 NNNMRSTTNLMIVNLAAADLMFVILCIPFTATDYMVYYWPYGRFWCRSVQYLIVVTAFASIYTLVLMSIDRFLAVVHPIRSRMMRTENITLIAIVTLWIVVLVVSVPVAFTHDVVVDYDAKKNITYGMCTFT-------------TNDFLGPRTYQVTFFISSYLLPLMIISGLYMRMIMR-LWRQGTGVRMSKESQRGRKRVTRLVVVVVIAFASLWLPVQLILLLKSLDVIETNTLTKLVIQVTAQTLAYSSSCINPLLYAFLSENFRKAF 324          
BLAST of GCR032 vs. Ensembl Zebrafish
Match: galr2b (galanin receptor 2b [Source:ZFIN;Acc:ZDB-GENE-131121-48])

HSP 1 Score: 151.754 bits (382), Expect = 5.706e-41
Identity = 94/272 (34.56%), Postives = 146/272 (53.68%), Query Frame = 2
Query:  233 NGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVLFC 1048
            N TN+ I +L++AD  FI FCVP  ATI+  +GW  GS  CK+  FF  LT Y S +TL  +SVDRYLA+ +P+ S  +RT  N +  ++  W + ++   P L          S  D  DF  + +    + E     L+   F         +F Y++P+  + L YT  I K L+ +   +    ++ ++K++VT+M++IV V+F +CW+P  +V +    G  P N    AF + +  +AY+NS +NPI+YA  S +FR  FK V  C
Sbjct:   60 NTTNLFILNLSVADFFFIIFCVPFQATIYSLEGWVFGSFMCKVVHFFINLTMYASSFTLAAVSVDRYLAIRYPLRSRELRTPCNAVVAMVVIWGLSLVFAGPYL----------SYYDLIDFENSNVCVPGWEEHNRKVLDTCTF---------VFGYVIPVLIVSLSYTRTI-KYLWTAVDPLDGMSESKRAKRKVTKMIIIVTVLFCICWLPYHVVILCYLYGDFPFNQTTYAFRLLSHCMAYANSCLNPIVYALVSKHFRKGFKKVFSC 311          
BLAST of GCR032 vs. Ensembl Zebrafish
Match: galr2b (galanin receptor 2b [Source:ZFIN;Acc:ZDB-GENE-131121-48])

HSP 1 Score: 151.754 bits (382), Expect = 5.706e-41
Identity = 94/272 (34.56%), Postives = 146/272 (53.68%), Query Frame = 2
Query:  233 NGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVLFC 1048
            N TN+ I +L++AD  FI FCVP  ATI+  +GW  GS  CK+  FF  LT Y S +TL  +SVDRYLA+ +P+ S  +RT  N +  ++  W + ++   P L          S  D  DF  + +    + E     L+   F         +F Y++P+  + L YT  I K L+ +   +    ++ ++K++VT+M++IV V+F +CW+P  +V +    G  P N    AF + +  +AY+NS +NPI+YA  S +FR  FK V  C
Sbjct:   60 NTTNLFILNLSVADFFFIIFCVPFQATIYSLEGWVFGSFMCKVVHFFINLTMYASSFTLAAVSVDRYLAIRYPLRSRELRTPCNAVVAMVVIWGLSLVFAGPYL----------SYYDLIDFENSNVCVPGWEEHNRKVLDTCTF---------VFGYVIPVLIVSLSYTRTI-KYLWTAVDPLDGMSESKRAKRKVTKMIIIVTVLFCICWLPYHVVILCYLYGDFPFNQTTYAFRLLSHCMAYANSCLNPIVYALVSKHFRKGFKKVFSC 311          
BLAST of GCR032 vs. Ensembl Zebrafish
Match: galr1b (galanin receptor 1b [Source:ZFIN;Acc:ZDB-GENE-140624-1])

HSP 1 Score: 149.443 bits (376), Expect = 2.247e-40
Identity = 99/279 (35.48%), Postives = 149/279 (53.41%), Query Frame = 2
Query:  218 NKQLRNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRI-SQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVLFCQ 1051
            +++ R+ TNI I +L+IAD++F+ FCVP  ATI+    W  G+  CK   +F  ++  +S++TLV MSVDRY+AVV    S  IR  +N L  V   W++  +   P+  +  +   P + N T   +C  + T R  +              Y +   +  YLLPL  I   Y     K+L++   +I + S K+ +SK++  + V++VV  F +CWMP  I+ +    G  P N A  AF + +  LAY NS +NPILYAF S NFR A K V  C+
Sbjct:   63 SRRSRSTTNIFILNLSIADLSFLLFCVPFQATIYSLPEWIFGAFLCKFVHYFVMVSMLVSIFTLVAMSVDRYIAVVLSKKSPCIRNRRNALIGVCVIWMLSFIFAVPVAQHQILTDHPKAPNST---FCWEIWTERVAK------------HTYKVTILVIGYLLPLLLITCCYA----KVLYHLHKKIKNMSKKSERSKRKTAQTVLLVVAAFLICWMPHHIIAMWVEFGQFPLNDASFAFRIISHCLAYGNSCVNPILYAFLSENFRKACKQVFTCR 322          
BLAST of GCR032 vs. Ensembl Zebrafish
Match: galr2a (galanin receptor 2a [Source:ZFIN;Acc:ZDB-GENE-130603-37])

HSP 1 Score: 146.747 bits (369), Expect = 2.910e-39
Identity = 93/289 (32.18%), Postives = 144/289 (49.83%), Query Frame = 2
Query:  227 LRNG------TNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLF--------NSGVAYPPTSVNDTKDF-YCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVLFC 1048
            +RNG      TN+ I +L +AD+ FI FCVPL ATI+    W  G+  CK   F  YLT Y S++TL  +S+DRYLA+ +P+ S   RT +N L  +   W + +  + P L          + V  P  SV+  +    CT+                            IF YL+P+  + + Y   I + L+ S   +    ++ ++K++VT+M++IV V+F LCW+P  +V +  + G  P N       + +  +AY+NS +NPI+YA  S +FR  FK V  C
Sbjct:   44 IRNGQMNTKSTNLFILNLGLADLCFIVFCVPLQATIYTMDEWVFGAFVCKAVHFIIYLTMYASIFTLAAVSLDRYLAIRYPLRSRETRTPRNALTSISLVWALSLFFSSPYLSYYQQMDLDGTTVCIPAWSVHHRQAMDICTF----------------------------IFGYLIPVLILGITYARTI-RYLWTSVDPMQDMSESRKAKRKVTKMIIIVAVLFCLCWLPHHLVILCMWFGHFPLNHTTYVLRILSHLVAYANSCLNPIVYALVSKHFRKGFKKVFGC 303          
BLAST of GCR032 vs. Ensembl Zebrafish
Match: galr2a (galanin receptor 2a [Source:ZFIN;Acc:ZDB-GENE-130603-37])

HSP 1 Score: 146.747 bits (369), Expect = 2.910e-39
Identity = 93/289 (32.18%), Postives = 144/289 (49.83%), Query Frame = 2
Query:  227 LRNG------TNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLF--------NSGVAYPPTSVNDTKDF-YCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVLFC 1048
            +RNG      TN+ I +L +AD+ FI FCVPL ATI+    W  G+  CK   F  YLT Y S++TL  +S+DRYLA+ +P+ S   RT +N L  +   W + +  + P L          + V  P  SV+  +    CT+                            IF YL+P+  + + Y   I + L+ S   +    ++ ++K++VT+M++IV V+F LCW+P  +V +  + G  P N       + +  +AY+NS +NPI+YA  S +FR  FK V  C
Sbjct:   44 IRNGQMNTKSTNLFILNLGLADLCFIVFCVPLQATIYTMDEWVFGAFVCKAVHFIIYLTMYASIFTLAAVSLDRYLAIRYPLRSRETRTPRNALTSISLVWALSLFFSSPYLSYYQQMDLDGTTVCIPAWSVHHRQAMDICTF----------------------------IFGYLIPVLILGITYARTI-RYLWTSVDPMQDMSESRKAKRKVTKMIIIVAVLFCLCWLPHHLVILCMWFGHFPLNHTTYVLRILSHLVAYANSCLNPIVYALVSKHFRKGFKKVFGC 303          
BLAST of GCR032 vs. Ensembl Xenopus
Match: sp3 (Sp3 transcription factor [Source:Xenbase;Acc:XB-GENE-977158])

HSP 1 Score: 157.532 bits (397), Expect = 3.842e-43
Identity = 93/277 (33.57%), Postives = 150/277 (54.15%), Query Frame = 2
Query:  218 NKQLRNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVLFC 1048
             ++  N TN+ I +L++AD++FI FCVP  ATI+  + W  G+  CK   FF YLT Y S +TL  +SVDRYLA+ +P+ S  +RT  N +  +   W + ++   P L          S  D  D+  +++    + E     ++ G F         I  Y++P+  + L YT  I K L+ +   +    ++ ++K++VT+M++IV V+F LCW+P  +V +    G  P N A  AF + +  +AY+NS +NPI+YA  S +FR  F+ V  C
Sbjct:   55 GQRTHNTTNLFILNLSVADVSFIIFCVPFQATIYSLEDWVFGAFMCKAVHFFIYLTMYASSFTLAAVSVDRYLAIRYPLRSRELRTPCNAIATMAIIWGLSVVFAGPYL----------SYYDLMDYESSHICMPGWKERTRKIMDTGTF---------IVGYVIPVLIVSLSYTRTI-KYLWTAVDPLEDMSESKKAKRKVTKMIIIVTVLFCLCWLPHHVVVMCYLYGDFPFNQATYAFRLLSHCMAYANSCLNPIVYALVSKHFRKGFQKVFSC 311          
BLAST of GCR032 vs. Ensembl Xenopus
Match: sp3 (Sp3 transcription factor [Source:Xenbase;Acc:XB-GENE-977158])

HSP 1 Score: 157.532 bits (397), Expect = 6.658e-43
Identity = 93/277 (33.57%), Postives = 150/277 (54.15%), Query Frame = 2
Query:  218 NKQLRNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVLFC 1048
             ++  N TN+ I +L++AD++FI FCVP  ATI+  + W  G+  CK   FF YLT Y S +TL  +SVDRYLA+ +P+ S  +RT  N +  +   W + ++   P L          S  D  D+  +++    + E     ++ G F         I  Y++P+  + L YT  I K L+ +   +    ++ ++K++VT+M++IV V+F LCW+P  +V +    G  P N A  AF + +  +AY+NS +NPI+YA  S +FR  F+ V  C
Sbjct:   78 GQRTHNTTNLFILNLSVADVSFIIFCVPFQATIYSLEDWVFGAFMCKAVHFFIYLTMYASSFTLAAVSVDRYLAIRYPLRSRELRTPCNAIATMAIIWGLSVVFAGPYL----------SYYDLMDYESSHICMPGWKERTRKIMDTGTF---------IVGYVIPVLIVSLSYTRTI-KYLWTAVDPLEDMSESKKAKRKVTKMIIIVTVLFCLCWLPHHVVVMCYLYGDFPFNQATYAFRLLSHCMAYANSCLNPIVYALVSKHFRKGFQKVFSC 334          
BLAST of GCR032 vs. Ensembl Xenopus
Match: ENSXETT00000041298.1 (galanin receptor 3 [Source:NCBI gene;Acc:100488248])

HSP 1 Score: 150.984 bits (380), Expect = 7.792e-41
Identity = 102/315 (32.38%), Postives = 159/315 (50.48%), Query Frame = 2
Query:  227 LRNG------TNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFS--IFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVLFCQKQSFSGRDFEKTNLNINRNLSEQRASRKALTK 1147
            LRNG      TN+ I +L +AD+ FI  CVP  ATI+   GW  G+  CK   F  YL+ Y S +TL  +SVDRYLA+ +P+ S  +RT +N L  +   W + +L   P                    Y +Y   + YN+  +  + N +  R  I+  S  +F YLLP+  + L Y   I   L+ S   +  + ++ ++K +VT+M++IV V+F +CW+P  +V +  + G  P N A  AF + +  ++Y+NS +NPI+YA  S +FR  FK V  C                    L+++RA R+ L +
Sbjct:   43 LRNGQTKYNTTNLFILNLGVADLCFILLCVPFQATIYTLDGWLFGAFLCKAVHFSIYLSMYASSFTLAAVSVDRYLAIRYPLKSRDLRTSRNALAAIGVIWALSILFAGP--------------------YLSYYHIILYNQVPIC-IPNWEDRRRKIMDVSTFVFGYLLPVLILGLSYARTI-CFLWTSVDPVKTASESRKAKHKVTKMIIIVAVLFCICWLPHHLVILCFWFGHFPFNKATYAFRLVSHCMSYANSCLNPIVYALISKHFRKRFKQVFTCL-------------------LTQKRAHRRCLGR 316          
BLAST of GCR032 vs. Ensembl Xenopus
Match: lmod3 (leiomodin 3 [Source:Xenbase;Acc:XB-GENE-5737414])

HSP 1 Score: 148.673 bits (374), Expect = 6.178e-40
Identity = 96/275 (34.91%), Postives = 151/275 (54.91%), Query Frame = 2
Query:  230 RNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVT-RMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVLFCQ 1051
            R+ TNI I +L+IAD+ ++ FC+P  +T+++   W LG+  CK   +F  ++  +S++TL  MSVDRY+A+VH   S  IR  +N L  V+  W++ +    P+ +N G+ Y      + + F     P             N Q  R+Y++   +F YLLPL    LL +F   K+L +   ++    K  ++ K+ T + V++VVV+F + W+P  ++ +    GS P   A   F + A  LAYSNS +NPI+YAF S NFR A+K V  CQ
Sbjct:   71 RSTTNIFILNLSIADLAYLLFCIPFQSTVYVLPTWVLGAFICKFIHYFFTVSMLVSIFTLSAMSVDRYVAIVHSRRSSAIRVSRNALVGVIVIWILSIAMASPVAYNQGLVY-----KNNQTFCWESWP-------------NAQQKRIYVVCTFVFGYLLPL----LLISFCYAKVLNHLHKKLRNMSKKSEASKKKTAQTVLVVVVVFGISWLPHHVIHLWVEYGSFPLTQASFVFRIVAHCLAYSNSSVNPIIYAFLSENFRKAYKQVFKCQ 323          
BLAST of GCR032 vs. Ensembl Xenopus
Match: lmod3 (leiomodin 3 [Source:Xenbase;Acc:XB-GENE-5737414])

HSP 1 Score: 148.673 bits (374), Expect = 6.222e-40
Identity = 96/275 (34.91%), Postives = 151/275 (54.91%), Query Frame = 2
Query:  230 RNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVT-RMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVLFCQ 1051
            R+ TNI I +L+IAD+ ++ FC+P  +T+++   W LG+  CK   +F  ++  +S++TL  MSVDRY+A+VH   S  IR  +N L  V+  W++ +    P+ +N G+ Y      + + F     P             N Q  R+Y++   +F YLLPL    LL +F   K+L +   ++    K  ++ K+ T + V++VVV+F + W+P  ++ +    GS P   A   F + A  LAYSNS +NPI+YAF S NFR A+K V  CQ
Sbjct:   69 RSTTNIFILNLSIADLAYLLFCIPFQSTVYVLPTWVLGAFICKFIHYFFTVSMLVSIFTLSAMSVDRYVAIVHSRRSSAIRVSRNALVGVIVIWILSIAMASPVAYNQGLVY-----KNNQTFCWESWP-------------NAQQKRIYVVCTFVFGYLLPL----LLISFCYAKVLNHLHKKLRNMSKKSEASKKKTAQTVLVVVVVFGISWLPHHVIHLWVEYGSFPLTQASFVFRIVAHCLAYSNSSVNPIIYAFLSENFRKAYKQVFKCQ 321          
BLAST of GCR032 vs. Ensembl Mouse
Match: Galr2 (galanin receptor 2 [Source:MGI Symbol;Acc:MGI:1337018])

HSP 1 Score: 134.42 bits (337), Expect = 1.183e-34
Identity = 89/285 (31.23%), Postives = 141/285 (49.47%), Query Frame = 2
Query:  227 LRNG-----TNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLL--------FNSGVAYPPTSVNDTKDF-YCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSV 1039
            LR G     TN+ I +L +AD+ FI  CVP  ATI+    W  GS+ CK   F  +LT + S +TL  +S+DRYLA+ +P+ S  +RT +N L  +   W + +L + P L         N  V +P  S    +    CT+                            +F+YLLP+  + L Y   +   L+ +   ++    + ++K++VTRM+VIV V+F LCWMP   + +  + G  P   A  A  + +  ++Y+NS +NPI+YA  S +FR  F+ +
Sbjct:   50 LRGGQAVSTTNLFILNLGVADLCFILCCVPFQATIYTLDDWVFGSLLCKAVHFLIFLTMHASSFTLAAVSLDRYLAIRYPLHSRELRTPRNALAAIGLIWGLALLFSGPYLSYYSQSQLANLTVCHPAWSAPRRRAMDLCTF----------------------------VFSYLLPVLVLSLTYARTL-HYLWRTVDPVAAGSGSQRAKRKVTRMIVIVAVLFCLCWMPHHALILCVWFGRFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFRKGFRKI 305          
BLAST of GCR032 vs. Ensembl Mouse
Match: Oprm1 (opioid receptor, mu 1 [Source:MGI Symbol;Acc:MGI:97441])

HSP 1 Score: 132.109 bits (331), Expect = 5.932e-34
Identity = 100/339 (29.50%), Postives = 166/339 (48.97%), Query Frame = 2
Query:  224 QLRNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVLFC--------QKQSFSGRDFEKTNLNINRNLSEQRASRKALTKKDCEVNIYSDNKNNKILSSSGYT 1216
            +++  TNI I +LA+AD    T  +P  +  ++   W  G+I CKI     Y   + S++TL  MSVDRY+AV HP+ ++  RT +N   + +  W++      P++F +   Y   S++ T  F     PT         Y EN     + I +F IFA+++P+  I + Y  +I +L   S   +S S +  ++ +R+TRMV++VV +F +CW PI I  II+ L + P+         F  AL Y+NS +NP+LYAF   NF+  F+   FC        Q+ S   R   + + +    +      ++  TK      I+   ++  +L  +  T
Sbjct:   34 KMKTATNIYIFNLALAD-ALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTF---SHPT--------WYWEN----LLKICVF-IFAFIMPVLIITVCYGLMILRL--KSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFRE--FCIPTSSTIEQQNSARIRQNTREHPSTANTVDRTNHQKQEKTKTKSAWEIWEQKEHTLLLGETHLT 351          
BLAST of GCR032 vs. Ensembl Mouse
Match: Oprm1 (opioid receptor, mu 1 [Source:MGI Symbol;Acc:MGI:97441])

HSP 1 Score: 131.339 bits (329), Expect = 6.230e-34
Identity = 97/314 (30.89%), Postives = 162/314 (51.59%), Query Frame = 2
Query:  224 QLRNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVLFCQKQSFSGRDFEKTNLNINRNLSEQRASRKALTKKDCEVN 1165
            +++  TNI I +LA+AD    T  +P  +  ++   W  G+I CKI     Y   + S++TL  MSVDRY+AV HP+ ++  RT +N   + +  W++      P++F +   Y   S++ T  F     PT         Y EN     + I +F IFA+++P+  I + Y  +I +L   S   +S S +  ++ +R+TRMV++VV +F +CW PI I  II+ L + P+         F  AL Y+NS +NP+LYAF   NF+  F+   FC   S +    ++ +  I +N  E  ++   + + + + N
Sbjct:   30 KMKTATNIYIFNLALAD-ALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTF---SHPT--------WYWEN----LLKICVF-IFAFIMPVLIITVCYGLMILRL--KSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFRE--FCIPTSSTIE--QQNSARIRQNTREHPSTANTVDRTNHQRN 320          
BLAST of GCR032 vs. Ensembl Mouse
Match: Oprm1 (opioid receptor, mu 1 [Source:MGI Symbol;Acc:MGI:97441])

HSP 1 Score: 130.568 bits (327), Expect = 1.520e-33
Identity = 96/310 (30.97%), Postives = 160/310 (51.61%), Query Frame = 2
Query:  224 QLRNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVLFCQKQSFSGRDFEKTNLNINRNLSEQRASRKALTKKD 1153
            +++  TNI I +LA+AD    T  +P  +  ++   W  G+I CKI     Y   + S++TL  MSVDRY+AV HP+ ++  RT +N   + +  W++      P++F +   Y   S++ T  F     PT         Y EN     + I +F IFA+++P+  I + Y  +I +L   S   +S S +  ++ +R+TRMV++VV +F +CW PI I  II+ L + P+         F  AL Y+NS +NP+LYAF   NF+  F+   FC   S +    ++ +  I +N  E  ++   + + +
Sbjct:   34 KMKTATNIYIFNLALAD-ALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTF---SHPT--------WYWEN----LLKICVF-IFAFIMPVLIITVCYGLMILRL--KSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFRE--FCIPTSSTIE--QQNSARIRQNTREHPSTANTVDRTN 320          
BLAST of GCR032 vs. Ensembl Mouse
Match: Oprm1 (opioid receptor, mu 1 [Source:MGI Symbol;Acc:MGI:97441])

HSP 1 Score: 130.183 bits (326), Expect = 1.549e-33
Identity = 96/313 (30.67%), Postives = 162/313 (51.76%), Query Frame = 2
Query:  224 QLRNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVLFCQKQSFSGRDFEKTNLNINRNLSEQRASRKALTKKDCEV 1162
            +++  TNI I +LA+AD    T  +P  +  ++   W  G+I CKI     Y   + S++TL  MSVDRY+AV HP+ ++  RT +N   + +  W++      P++F +   Y   S++ T  F     PT         Y EN     + I +F IFA+++P+  I + Y  +I +L   S   +S S +  ++ +R+TRMV++VV +F +CW PI I  II+ L + P+         F  AL Y+NS +NP+LYAF   NF+  F+   FC   S +    ++ +  I +N  E  ++   + + + ++
Sbjct:   30 KMKTATNIYIFNLALAD-ALATSTLPFQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPRNAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTF---SHPT--------WYWEN----LLKICVF-IFAFIMPVLIITVCYGLMILRL--KSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFRE--FCIPTSSTIE--QQNSARIRQNTREHPSTANTVDRTNHQL 319          
BLAST of GCR032 vs. UniProt/SwissProt
Match: sp|Q8WPA2|AR_BOMMO (Allatostatin-A receptor OS=Bombyx mori OX=7091 GN=AR PE=2 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 1.876e-53
Identity = 117/302 (38.74%), Postives = 178/302 (58.94%), Query Frame = 2
Query:  218 NKQLRNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFGRV-YILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVLFCQ---KQSFSGR-DFEKTNLNINRN 1108
            N  +R+ TN+LI +LA+AD+ F+ FCVP TAT ++   W  G   CK+ Q+F  +TA+ SVYTLVLMS+DR++AVVHPIAS+ IRTEKN L  +   WV+ +    P+    G           +++  +Y      N +   +LE   + ++ + + F + +Y++PL+ I +LY  ++ + L+ S      S ++ + +K+VTRMVV+VVV+FA+CW PIQI+ +++ L             + +  LAY NS +NP+LYAF S NFRVAF+ V++C       FSGR    KT    N N
Sbjct:   70 NPGMRSTTNLLIINLAVADLLFVIFCVPFTATDYVMPRWPFGDWWCKVVQYFIVVTAHASVYTLVLMSLDRFMAVVHPIASMSIRTEKNALLAIACIWVVILTTAIPVGICHG----------EREY--SYF---NRNHSSCVFLEERGYSKLGFQMSFFLSSYVIPLALISVLYMCMLTR-LWKSAPGGRVSAESRRGRKKVTRMVVVVVVVFAVCWCPIQIILLVKALNKYHITYFTVTAQIVSHVLAYMNSCVNPVLYAFLSENFRVAFRKVMYCPPPYNDGFSGRPQATKTTRTGNGN 355          
BLAST of GCR032 vs. UniProt/SwissProt
Match: sp|E7F7V7|GAL2B_DANRE (Galanin receptor 2b OS=Danio rerio OX=7955 GN=galr2b PE=2 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 4.307e-40
Identity = 94/272 (34.56%), Postives = 146/272 (53.68%), Query Frame = 2
Query:  233 NGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVLFC 1048
            N TN+ I +L++AD  FI FCVP  ATI+  +GW  GS  CK+  FF  LT Y S +TL  +SVDRYLA+ +P+ S  +RT  N +  ++  W + ++   P L          S  D  DF  + +    + E     L+   F         +F Y++P+  + L YT  I K L+ +   +    ++ ++K++VT+M++IV V+F +CW+P  +V +    G  P N    AF + +  +AY+NS +NPI+YA  S +FR  FK V  C
Sbjct:   60 NTTNLFILNLSVADFFFIIFCVPFQATIYSLEGWVFGSFMCKVVHFFINLTMYASSFTLAAVSVDRYLAIRYPLRSRELRTPCNAVVAMVVIWGLSLVFAGPYL----------SYYDLIDFENSNVCVPGWEEHNRKVLDTCTF---------VFGYVIPVLIVSLSYTRTI-KYLWTAVDPLDGMSESKRAKRKVTKMIIIVTVLFCICWLPYHVVILCYLYGDFPFNQTTYAFRLLSHCMAYANSCLNPIVYALVSKHFRKGFKKVFSC 311          
BLAST of GCR032 vs. UniProt/SwissProt
Match: sp|F1R332|GAL2A_DANRE (Galanin receptor 2a OS=Danio rerio OX=7955 GN=galr2a PE=2 SV=2)

HSP 1 Score: 146.747 bits (369), Expect = 2.197e-38
Identity = 93/289 (32.18%), Postives = 144/289 (49.83%), Query Frame = 2
Query:  227 LRNG------TNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLF--------NSGVAYPPTSVNDTKDF-YCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVLFC 1048
            +RNG      TN+ I +L +AD+ FI FCVPL ATI+    W  G+  CK   F  YLT Y S++TL  +S+DRYLA+ +P+ S   RT +N L  +   W + +  + P L          + V  P  SV+  +    CT+                            IF YL+P+  + + Y   I + L+ S   +    ++ ++K++VT+M++IV V+F LCW+P  +V +  + G  P N       + +  +AY+NS +NPI+YA  S +FR  FK V  C
Sbjct:   44 IRNGQMNTKSTNLFILNLGLADLCFIVFCVPLQATIYTMDEWVFGAFVCKAVHFIIYLTMYASIFTLAAVSLDRYLAIRYPLRSRETRTPRNALTSISLVWALSLFFSSPYLSYYQQMDLDGTTVCIPAWSVHHRQAMDICTF----------------------------IFGYLIPVLILGITYARTI-RYLWTSVDPMQDMSESRKAKRKVTKMIIIVAVLFCLCWLPHHLVILCMWFGHFPLNHTTYVLRILSHLVAYANSCLNPIVYALVSKHFRKGFKKVFGC 303          
BLAST of GCR032 vs. UniProt/SwissProt
Match: sp|Q23497|NPR9_CAEEL (Galanin-like G-protein coupled receptor npr-9 OS=Caenorhabditis elegans OX=6239 GN=npr-9 PE=2 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 1.266e-36
Identity = 96/301 (31.89%), Postives = 151/301 (50.17%), Query Frame = 2
Query:  218 NKQLRNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVND---TKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLL------------------FNSESRISQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLG-SEP----DNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVL 1042
             +Q+RN TN LI  LAI+D+ F+  CVP TA  +    W      C +  FF + +AY SV+TL LM++DRYLAVV+P+ S+ +RT +N +  +   ++I +    P+    G+      V D    K   C  +       T+          R Y + F++F Y+LPL   ++LY  ++ KL                    +S S I +  +A  +K++VTR+V+ V++ +ALCW+P+ + F +  L   EP             + +  LAY+NS +NPILYA  S +FR  F  V+
Sbjct:   70 GRQMRNSTNTLIIGLAISDLMFLLLCVPFTAVDYAAPTWIFPEWTCSMINFFQHTSAYCSVWTLTLMALDRYLAVVYPVESMTLRTPRNTVIALCFIYIIIIASQIPVGRMHGIY-----VYDFIMEKRSTCAIL-------TIATAEATPTMARTYFMTFNVFGYVLPLGISVVLYGLMLRKLWDMPRPGNSQSVGGRNLTNRDSGSSIRRRPEATAAKRKVTRLVLCVLITWALCWLPLNVCFFMSGLAYPEPLVISHGVIMVIVQIASQVLAYTNSCLNPILYALMSQSFREGFIRVM 358          
BLAST of GCR032 vs. UniProt/SwissProt
Match: sp|O43603|GALR2_HUMAN (Galanin receptor type 2 OS=Homo sapiens OX=9606 GN=GALR2 PE=1 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 6.338e-36
Identity = 89/285 (31.23%), Postives = 143/285 (50.18%), Query Frame = 2
Query:  227 LRNG-----TNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLL--------FNSGVAYPPTSVNDTKDF-YCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSV 1039
            LR G     TN+ I +L +AD+ FI  CVP  ATI+   GW  GS+ CK   F  +LT + S +TL  +S+DRYLA+ +P+ S  +RT +N L  +   W + +L + P L         N  V +P  S    +    CT+                            +F+YLLP+  + L Y   + + L+ +   ++    A ++K++VTRM++IV  +F LCWMP   + +  + G  P   A  A  + +  ++Y+NS +NPI+YA  S +FR  F+++
Sbjct:   51 LRGGQAVSTTNLFILNLGVADLCFILCCVPFQATIYTLDGWVFGSLLCKAVHFLIFLTMHASSFTLAAVSLDRYLAIRYPLHSRELRTPRNALAAIGLIWGLSLLFSGPYLSYYRQSQLANLTVCHPAWSAPRRRAMDICTF----------------------------VFSYLLPVLVLGLTYARTL-RYLWRAVDPVAAGSGARRAKRKVTRMILIVAALFCLCWMPHHALILCVWFGQFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFRKGFRTI 306          
BLAST of GCR032 vs. TrEMBL
Match: A0A193KUH5 (GCR032 OS=Schmidtea mediterranea OX=79327 GN=gcr032 PE=2 SV=1)

HSP 1 Score: 700.279 bits (1806), Expect = 0.000e+0
Identity = 375/377 (99.47%), Postives = 376/377 (99.73%), Query Frame = 2
Query:  101 MPNFTTESIITEMVAPSXXXXXXXXXXXXXXXXXXXXSINKQLRNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVLFCQKQSFSGRDFEKTNLNINRNLSEQRASRKALTKKDCEVNIYSDNKNNKILSSSGYTNLSKL 1231
            MPNFTTESIITEMVAPSIFGVIVVFGFFGNLLVILVVSINKQLRNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTS+NDTKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYT LIWKLLFNSESRISQSDKALQSKKRVTRMVVIVVVIFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVLFCQKQSFSGRDFEKTNLNINRNLSEQRASRKALTKKDCEVNIYSDNKNNKILSSSGYTNLSKL
Sbjct:    1 MPNFTTESIITEMVAPSIFGVIVVFGFFGNLLVILVVSINKQLRNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSINDTKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTCLIWKLLFNSESRISQSDKALQSKKRVTRMVVIVVVIFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVLFCQKQSFSGRDFEKTNLNINRNLSEQRASRKALTKKDCEVNIYSDNKNNKILSSSGYTNLSKL 377          
BLAST of GCR032 vs. TrEMBL
Match: A0A193KUR9 (GCR304 OS=Schmidtea mediterranea OX=79327 GN=gcr304 PE=2 SV=1)

HSP 1 Score: 289.271 bits (739), Expect = 3.128e-89
Identity = 146/285 (51.23%), Postives = 199/285 (69.82%), Query Frame = 2
Query:  218 NKQLRNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPP-TSVNDTKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVLFCQK-QSFS 1066
            N Q+RN TNILI SLA+AD+ FI FCVP TA +++  GW LG + C+IYQ+ TY+TAY SVYTLVLMS+DRYLAVVHPI S+ +R  +N +  V + W +F++ N PLL NS +   P   + D    YCTY P +++N T   Y ++  FG++Y  LF +  YL P+  I +LY FLI++LL    S+IS S+ A+ +KKRVT+MV++V+VIF LCW PIQ +FIIQ  G +P    F+  HV ++ LAYSNSM+NP LYAF S NFR AF ++L C++ +SF+
Sbjct:   65 NIQMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCCRRLKSFA 349          
BLAST of GCR032 vs. TrEMBL
Match: A0A193KUP0 (GCR064 OS=Schmidtea mediterranea OX=79327 GN=gcr064 PE=2 SV=1)

HSP 1 Score: 287.73 bits (735), Expect = 3.737e-89
Identity = 163/332 (49.10%), Postives = 222/332 (66.87%), Query Frame = 2
Query:  218 NKQLRNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGV--AYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVLFCQKQSFSGRDFEKTNLNINRNLSEQRASRKALTKKDCEVNIYSDNKNNKILSSS 1207
            NK++RN TNILIASLAIAD+TFI FC+P T  I++K+GW LG   C+IYQF  Y+TAY SVYTLVLM  DR+LAVVHPI+S  +R+++N    V+  W++F   N PLL NSGV      + VN    +YC+Y+P VR+N+T   Y+ + +FG+ +   F IFAY LPL  I LLY  L+ +LL    S+++QS++AL+SKKRVT MVVIV+V FA CW+PIQ VF++Q    +     F+  H+F++ LAY+NSM+NPILYAF S NFR +F+ +L CQ    S  ++EKT+ + NR  S    S K  T++       S N  N + +SS
Sbjct:   55 NKKMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVV-YYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRVTIMVVIVIVAFAACWLPIQSVFLLQIYEFDVGGPLFRTIHIFSNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQATQ-SRVEYEKTHFSHNRGGSN---SFKGRTRRQ------SKNDGNDMKTSS 375          
BLAST of GCR032 vs. TrEMBL
Match: A0A193KUG3 (GCR317 OS=Schmidtea mediterranea OX=79327 GN=gcr317 PE=2 SV=1)

HSP 1 Score: 236.884 bits (603), Expect = 1.313e-69
Identity = 133/284 (46.83%), Postives = 186/284 (65.49%), Query Frame = 2
Query:  218 NKQLRNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAY--PPTSVNDT--KDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRIS--QSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVLFCQ 1051
            N  +RN TNILI+SLA AD+TFI FC+PLT +I+I +GW   +  C IYQ+ T+LT Y SVYTLVLMS DRYLA+VHPI S+  RT    L  V  +W+  ++ N P L +S V Y  P    N+   K++YC     V YNE + GY+++ +    +   F +F +LLPLS I++LY  L++++      R++  QS    +S K+VTR+VV V++ F + W+P+ IVF+IQ    +P N AF+AFH+ A+++AY NSM+NPILYAF S NFR AFK  L C+
Sbjct:   79 NGHMRNSTNILISSLAFADLTFIVFCIPLTISIYIYQGWIWNNFLCMIYQYLTWLTVYCSVYTLVLMSADRYLAIVHPITSVNWRTRNRSLTAVYISWIALIIINLPFLIHSRVLYTIPVKLANNQTRKNYYCGNKKLVNYNEAMDGYIDDYKALFNHYFTFFLFGFLLPLSMIVILYGLLLYRI----SQRLNNQQSANITRSNKKVTRLVVSVIIAFGVSWLPLHIVFLIQSTYGDPSNVAFRAFHMVANSMAYGNSMINPILYAFLSENFRTAFKKFLTCK 358          
BLAST of GCR032 vs. TrEMBL
Match: A0A2T7PZS6 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_01525 PE=3 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 3.083e-68
Identity = 132/308 (42.86%), Postives = 186/308 (60.39%), Query Frame = 2
Query:  218 NKQLRNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVLFCQKQSFSGRDFEKTNLNINRNLSEQ-RASRKA 1138
            +K +RN TNILI SLA+AD+ FI  CVP TA +F    W  GSI CK+ Q+  Y+ AY SVYTLVLMS+DRYLAVVH I S+ IR E N    +  TW +  L + PLL    + +      D    +CT +           +L+N    +++   F  F Y++PLSA+ L+Y  ++ +LL+      +QS +++++KKRVTRMV+IVV++FALCW+PIQI+F+IQ  G+ P +  F    V ++ LAY NS +NP LYAF S NFR +F+  L C   S    D+E+TN+  +   S+    SR A
Sbjct:   80 DKHMRNTTNILILSLAVADLLFILLCVPFTAAMFSMPVWPFGSIMCKVVQYMIYVCAYASVYTLVLMSLDRYLAVVHAIRSMSIRNEFNTWLAIAVTWTVIFLGHIPLLVEYDIHHYQHL--DQNRTFCTNV----------AHLDNITLAKIFYGSFFAFGYVIPLSAVCLMYGLMLKRLLYGVVPGGNQSQESIRAKKRVTRMVIIVVIMFALCWLPIQIIFVIQRFGNYPTSMEFFGLQVASNCLAYMNSCVNPFLYAFLSENFRRSFQKFLCCITPSSRRMDYERTNIRYSEKESKSTHLSRTA 375          
BLAST of GCR032 vs. Ensembl Cavefish
Match: GALR1 (galanin receptor type 1 [Source:NCBI gene;Acc:103047815])

HSP 1 Score: 152.14 bits (383), Expect = 1.134e-41
Identity = 95/280 (33.93%), Postives = 155/280 (55.36%), Query Frame = 2
Query:  230 RNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRI-SQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVLFCQKQSFS 1066
            R+ TNI I +L++AD++++ FCVP  AT+++   W LG+ ACK   +F  ++  +S++TL  MSVDRY+A+V   +S  +R  +N L  V++ W++ +    P+ ++  +        D   +     P   +              ++Y++   +F Y+LPL    LL +F   ++L +   ++ + S K+  SK++  + V++VVV+F L W+P  +V +    GS P N A   F V A  LAYSNS +NPI+YAF S NFR A+K V  CQ  S S
Sbjct:   56 RSTTNIFILNLSVADLSYLLFCVPFQATVYVLPTWVLGAFACKFVHYFFTVSMLVSIFTLSAMSVDRYVAIVRARSSSSVRVARNALLAVVAIWLLSLAMAAPVAYHQRI----IEREDNATYCWELWPQAHHR-------------KIYVVCTFVFGYVLPL----LLISFCYARVLNHLRKKLKNMSKKSEASKRKTAQTVLVVVVVFCLSWLPHHVVHLWVEFGSFPLNQASFIFRVAAHCLAYSNSSVNPIIYAFLSENFRKAYKQVFKCQITSES 314          
BLAST of GCR032 vs. Ensembl Cavefish
Match: galr2b (galanin receptor type 2-like [Source:NCBI gene;Acc:103040671])

HSP 1 Score: 151.369 bits (381), Expect = 6.845e-41
Identity = 94/272 (34.56%), Postives = 146/272 (53.68%), Query Frame = 2
Query:  233 NGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVLFC 1048
            N TN+ I +L++AD  FI FCVP  ATI+  +GW  GS  CK+  FF  LT Y S +TL  +SVDRYLA+ +P+ S  +RT  N +  ++  W + ++   P L          S  D  DF  + +    + E     L+   F         +F Y++P+  + L YT  I K L+ +   +    ++ ++K++VT+M++IV V+F +CW+P  +V +    G  P N    AF + +  +AY+NS +NPI+YA  S +FR  FK V  C
Sbjct:   60 NTTNLFILNLSVADFFFIIFCVPFQATIYSLEGWVFGSFMCKVVHFFINLTMYASSFTLAAVSVDRYLAIRYPLRSRELRTPCNAVVAMVIIWGLSLIFAGPYL----------SYYDLIDFENSNVCVPGWEEHNRKVLDTCTF---------VFGYVIPVLIVSLSYTRTI-KYLWTAVDPLDVMSESKRAKRKVTKMIIIVTVLFCICWLPYHVVILCYLYGDFPFNQTTYAFRLLSHCMAYANSCLNPIVYALVSKHFRKGFKKVFSC 311          
BLAST of GCR032 vs. Ensembl Cavefish
Match: ENSAMXT00000006013.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000032.1:4195125:4261560:1 gene:ENSAMXG00000005876.2 transcript:ENSAMXT00000006013.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 146.362 bits (368), Expect = 1.956e-39
Identity = 103/275 (37.45%), Postives = 143/275 (52.00%), Query Frame = 2
Query:  230 RNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRI-SQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVLFCQ 1051
            R+ TNI I +L+IAD++F+ FCVP  ATI+    W  G+  CK   +F  +T  +S++TLV MSVDRY+AVV    S  IR  +N L   L  W+I++L    L+F   VA     V D  D                    N  F     +   +  YLLPL  I   Y     K+L++   +I + S K+ +SK++  + V++VV  F LCWMP  I+ +    G  P N A  AF + +  LAY NS +NPILYAF S NFR A + V  C+
Sbjct:   68 RSTTNIFILNLSIADLSFLLFCVPFQATIYSLPEWIFGAFLCKSVHYFVTVTMLVSIFTLVAMSVDRYVAVVLSKKSPCIRNRRNAL---LGVWIIWLL---SLVFAVPVAQHQV-VTDHPD------------------APNSSFCWEIWVTILVIGYLLPLVLITCCYA----KVLYHLHKKIKNMSKKSERSKRKTAQTVLLVVAAFLLCWMPHHIIAMWVEFGDFPLNDASFAFRIVSHCLAYGNSCVNPILYAFLSENFRKACRQVFTCR 313          
BLAST of GCR032 vs. Ensembl Cavefish
Match: galr1a (galanin receptor type 1 [Source:NCBI gene;Acc:103037936])

HSP 1 Score: 138.272 bits (347), Expect = 1.679e-36
Identity = 98/282 (34.75%), Postives = 153/282 (54.26%), Query Frame = 2
Query:  218 NKQLRNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVT-RMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVLFCQKQS 1060
            + Q R+ TN+ I +L+IAD++++ FC+P  +T+++   W  G   CK   +F  ++  +S++TL  MSVDRY+A+VH   S  IR  ++ L  V   W + +    P+  +        S+ ++KD   T+   V  N T           ++Y++   IF YLLPL    +L +F   K+L +   ++    K  ++ K+ T + V++VVV+F L W+P  +V +    GS P N A   F V A  LAYSNS +NPI+YAF S NFR A+K V  CQ  S
Sbjct:   55 SGQQRSTTNVFILNLSIADLSYLLFCIPFQSTVYMMPSWIFGEFICKFVHYFFTVSMLVSIFTLSAMSVDRYVAIVHCRKSSSIRVVRHALAGVAVIWALSLAMAAPVAHHQ-------SIVESKD-NSTFCWEVWPNHTRR---------KIYVVFTFIFGYLLPL----ILISFCYAKVLNHLHKKLRNVSKKSEASKKKTAQTVLVVVVVFCLSWLPHHVVHLWVEFGSFPLNQASFLFRVAAHCLAYSNSSVNPIIYAFLSENFRQAYKQVFRCQVAS 315          
BLAST of GCR032 vs. Ensembl Cavefish
Match: galr2a (galanin receptor type 2 [Source:NCBI gene;Acc:103028491])

HSP 1 Score: 136.346 bits (342), Expect = 1.455e-35
Identity = 85/277 (30.69%), Postives = 141/277 (50.90%), Query Frame = 2
Query:  227 LRNG------TNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSV 1039
            LR G      T++ I +L  AD+ FI  CVP+ A ++    W  GS+AC+   F  YLT + S  TL  +S+DRYLA+ +P+ +  +RT +N L  +   W + ++ + P L      Y    ++ T       +P   Y +            R   +   +F YL+P+  + L Y   I + L+ S   +  + +  ++K+RVT+M++IV V+F LCW+P  +V +  + G  P N       + +  +AY+NS +NPI+YA  S +FR  F+ V
Sbjct:   43 LRGGRASAKITSVFIVNLCAADLGFIVLCVPVQAAVYTLPEWRFGSLACRTAHFAVYLTMHASALTLTAVSLDRYLAIRYPLRAREMRTPRNALICIGVVWAVSLVLSSPYLSY----YQQMDLDGTT----VCIPAWDYQQR-----------RAMDVCTFVFGYLIPVLVLSLTYARTI-RYLWTSVDPVQDASECRRAKRRVTKMIIIVAVLFCLCWLPHHLVILCMWFGHFPLNHTTYVLRILSHLVAYTNSCLNPIVYALVSKHFRKGFRKV 299          
BLAST of GCR032 vs. Ensembl Sea Lamprey
Match: galr2a (galanin receptor 2a [Source:ZFIN;Acc:ZDB-GENE-130603-37])

HSP 1 Score: 135.191 bits (339), Expect = 4.177e-36
Identity = 81/266 (30.45%), Postives = 140/266 (52.63%), Query Frame = 2
Query:  239 TNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFS-IFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFK 1033
            TNI I +L++AD+ FI FCVP  ATI+   GW  GS  CK   F  +LT + S +TL  +SVDRYLA+ +P+ S  +RT +    ++ + W + ++   P                    Y +Y   V +    M      +  R  + + + +  YL+P+S + L Y F + K L+ +   + +  ++ ++K++VT M++IV  +F  CW+P  ++ +  + G  P   A  AF + +  ++Y+NS +NP++YA  S +FR  F+
Sbjct:   63 TNIFILNLSVADLCFILFCVPFQATIYTLDGWIFGSFLCKAVHFIIFLTMFASSFTLAAVSVDRYLAIRYPLRSRELRTPRKAAAVIAAIWGLALVFAGP--------------------YLSYYQAVTFQNMSMCMPVWAKEPRKLMDMVTFVCGYLVPVSVLGLAYAFTL-KYLWTAVDPLEEMSESKRAKRKVTTMILIVAGLFCACWLPHHVLILYFWFGHFPLTHATYAFRLLSHCMSYANSCLNPLVYALVSKHFRKGFR 307          
BLAST of GCR032 vs. Ensembl Sea Lamprey
Match: oprk1 (opioid receptor, kappa 1 [Source:ZFIN;Acc:ZDB-GENE-030729-1])

HSP 1 Score: 130.568 bits (327), Expect = 9.574e-35
Identity = 92/309 (29.77%), Postives = 154/309 (49.84%), Query Frame = 2
Query:  224 QLRNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVLFCQKQSFSGRDFEKTNLNINRNLSEQRASRKALTKK 1150
            +++  TN  I +LA+AD T +T  +P  +  ++   W  G + CK+     Y   + S++TL +MSVDRY+AV HP+ ++  RT      I +  W++      P++           +    DF     P V++   L             I +F IFA++LP+  I++ Y+ ++ +L   +   +S S +  ++ +R+TRMV+IVV IF +CW PI +  II+   S  D     A      AL Y+NS +NP+LYAF   NF+  FK   FC   +F  RD + ++    R    Q ++  + T++
Sbjct:    5 KMKTATNTYIFNLALAD-TLVTTTLPFQSADYLMGSWPFGEVICKVVMSIDYYNMFTSIFTLTIMSVDRYIAVCHPVKALDFRTPSKAKLINICIWILSSAIGIPVIVMGTAKKEEGIIECILDFP---HPAVKWENLLK------------ICVF-IFAFILPVLIIVVCYSLMVLRL--RTVRLLSGSKEKDRNLRRITRMVLIVVAIFVICWTPIHLFVIIKSRVSISDTPTVSAAWYICVALGYTNSCLNPVLYAFLDENFKRCFKE--FCFPAAFR-RDLQGSSRVGGRPNRGQTSAAFSHTER 291          
BLAST of GCR032 vs. Ensembl Sea Lamprey
Match: galr1b (galanin receptor 1b [Source:ZFIN;Acc:ZDB-GENE-140624-1])

HSP 1 Score: 130.568 bits (327), Expect = 2.811e-34
Identity = 95/296 (32.09%), Postives = 144/296 (48.65%), Query Frame = 2
Query:  230 RNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFN----SGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVT-RMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVLFCQKQSFSGRDFEKTNLNIN 1102
            RN TN  I +L++AD+TF+  CVP  +TI++   W  G+  CK   +F  +   +S++TL  MSV+RY+AVVH   S  +RT +N L  V   W + ++   P   N     GV Y     +    F+C              +       R YI    IF YLLPL  I   Y      +L + + ++    K  Q  K+ T + V++VV +F + W+P  ++ +    GS P  +A  AF + +  L+Y NS  NPI+YAF S NFR A++ V  CQ    S    + T + + 
Sbjct:   64 RNTTNTFILNLSVADLTFLMVCVPFQSTIYVLPTWVFGAFLCKAVHYFVTVFMLVSIFTLAAMSVERYIAVVHSHRSPVLRTTRNALAGVAVIWALSVVAAIPCAQNRMLVDGVNY-----SHPGQFFC--------------WEAEASKRRAYITGIFIFGYLLPLLLISCCYI----SVLTHLQRKVRNISKKSQRSKKKTAQTVLVVVAVFCISWLPHHVIHMWVLYGSFPLTSASFAFRIVSHCLSYGNSCANPIIYAFLSENFRKAYRQVFSCQLPVSSSLKAKSTRIRLE 336          
BLAST of GCR032 vs. Ensembl Sea Lamprey
Match: oprm1 (opioid receptor, mu 1 [Source:ZFIN;Acc:ZDB-GENE-010125-1])

HSP 1 Score: 117.857 bits (294), Expect = 4.422e-30
Identity = 81/275 (29.45%), Postives = 138/275 (50.18%), Query Frame = 2
Query:  224 QLRNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFGRVYI-LLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVLF 1045
            +++  TNI I +LA+AD    T  +P  +  ++   W  G I CK+     Y   + S++TL +MSVDRY+AV HP+ ++  RT      I ++ W++  +   P++    +   P  +               Y E L+ + +   F    + +   IFA+++P+  I + Y  +I +L   +    S S +  ++ +R+TRMV++VV +F +CW PI +  I + L + P+     A      AL Y+NS +NP+LYAF   NF+  FK   F
Sbjct:    6 KMKTATNIYIFNLALAD-ALATSTLPFQSADYMLGTWPFGPILCKVVMSIDYYNMFTSIFTLTMMSVDRYVAVCHPVKALDFRTPTKAKLINVAIWLLSSIIGVPIMIMGTIK--PDQIG--------------YMECLVVFPQPPWFWETLLKICVFIFAFIMPVMIITICYGLMILRL--RTVRLFSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHLFVIARALMTIPETPFMAAAWYSCVALGYTNSCLNPVLYAFLDENFKRCFKEFCF 261          
BLAST of GCR032 vs. Ensembl Sea Lamprey
Match: galr1a (galanin receptor 1a [Source:ZFIN;Acc:ZDB-GENE-060503-290])

HSP 1 Score: 114.005 bits (284), Expect = 1.462e-28
Identity = 82/281 (29.18%), Postives = 137/281 (48.75%), Query Frame = 2
Query:  239 TNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQF-----------GRVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVLFC 1048
            TN+ + +L++AD+TF+ FCVP  AT +    W  G+  CK   +    +  +S++TLV MSVDRY+A+VH   +  +R+ +  L  V + W++ ++                            +P   Y+ T++ Y E+G F                ++FS+  YLLPL  I   Y   +   +F         D+  QS ++  + V+++VV+F + W+P  ++ +    GS P   A  AF + A  L+Y NS +NP +Y F S NFR A++ +L C
Sbjct:   76 TNVFVLTLSVADLTFLFFCVPSEATYYFLPDWVFGAFLCKGVPYVFTASMLVSIFTLVAMSVDRYIAIVHARRAAAVRSVRRALGAVSALWLLSLVLA--------------------------VPRAHYH-TIVVYKEHGNFCWEVWSHKNLKSTYRAVIFSL-GYLLPLVLISACYA-RVGSTVFTCRDSAELVDETKQSVRQTAKTVLVLVVVFLVSWLPHHVILLWVEFGSFPLTNASFAFRIVAHCLSYGNSCVNPFIYGFLSQNFREAYRQLLRC 327          
BLAST of GCR032 vs. Ensembl Nematostella
Match: EDO37023 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SH02])

HSP 1 Score: 108.612 bits (270), Expect = 1.254e-26
Identity = 85/283 (30.04%), Postives = 151/283 (53.36%), Query Frame = 2
Query:  218 NKQLRNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGS---IACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLY---TFLIWKLLFNSES-RISQS-DKALQSKKRVTRMXXXXXXXFALCWMPIQI-VFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSV 1039
             K+ R   N  I  LAI+D+   + C PL    FIK  +F  S   + CKI +F  YL   +S+  L+ + ++R+ A+VHP   + I T K   K++ S W+  +    P +F + V +  T++++T         TVRY  T+     + Q GR Y+L  S+F Y++PL  ++ LY   + ++WK   +    R S+S +  L+++K+V +M + V+++F + W+P+ + V +I+ +  +          +   A+  SNS+ NP +Y+FF+N FR   K++
Sbjct:   26 TKKFRTVMNRFIVHLAISDLLVSSICTPL----FIKINFFFDSDYDVKCKISRFLQYLAPEVSMVLLITIGINRHRAIVHP---LNIMTYKTANKLIASAWLYALAVVTPSIFLTQVLH-HTNLDNT---------TVRYCATIQ---TSTQAGRAYVLFLSVFGYVIPLVVLVALYARISCVVWKRDTSKNPLRTSRSFESVLKTRKKVVKMFLTVILLFFVTWIPLLLYVGVIEGILYKTAR-RLDEVRMVLYAIGLSNSVCNPFIYSFFNNRFRDGCKAI 287          
BLAST of GCR032 vs. Ensembl Nematostella
Match: EDO36377 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIX0])

HSP 1 Score: 106.686 bits (265), Expect = 2.861e-25
Identity = 92/278 (33.09%), Postives = 138/278 (49.64%), Query Frame = 2
Query:  224 QLRNGTNILIASLAIADITFITFCVPLTATIF-IKKGWFLGSIA---CKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSE--SRISQSDKALQSK-KRVTRMXXXXXXXFALCWMPIQIVFIIQ-FLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFK 1033
             +RN TNILIA++A+AD+ +ITF +P     F I   WF G      CK        +   SV+TLV +S+DR  A++ P+  I   T K V  ++L  W   +    P+          T V+     Y         NE    + E+GQ  R YI +++I  Y++PL+ I+++Y F   KL        R  Q+ K +QS  +R T M++ VVV+FA+CW P QI  ++  F     +N       +F     ++NS +NPILY  FS N+R  F+
Sbjct:   54 HMRNTTNILIANMAVADL-WITFDIPYVIKWFYITDTWFGGGFGDFLCKFCHSAQAGSVACSVFTLVCISLDRSFAIIFPMKVI--LTRKIVKFMILGIWAATIAFTTPIFL-------ITKVHLKNGVYVC-------NEL---WEESGQSERHYIAVYTITTYIIPLALILIMYIFTGLKLWSRKPPGQRSLQAHKKIQSSTRRATIMLITVVVVFAVCWFPFQIRELLSVFYEDNINNMIPFRVMLFLPWFGFANSAINPILYVLFSENYRREFR 311          
BLAST of GCR032 vs. Ensembl Nematostella
Match: EDO49619 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFL1])

HSP 1 Score: 101.293 bits (251), Expect = 4.398e-24
Identity = 81/283 (28.62%), Postives = 131/283 (46.29%), Query Frame = 2
Query:  224 QLRNGTNILIASLAIADITFITFCVPLTATIFI-KKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNS----ESRISQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVLFCQKQ 1057
             +RN  N LI +LAIADIT    C+P    I +    W LG+  CK+        A  S  TL  +S DRY AVVHP    P  + +  L +++STW++  L   P +   G+     +    KD +                       ++Y +   +FAY LPL  I   Y+ +  KL   S    +++++    +      +T+M+V VV+I+ALC +P Q++++    G+  +         F   L Y NS++NP LYA  ++ F+  F  +L C+ +
Sbjct:   25 NMRNTRNYLIVNLAIADITVALVCIPFDVVIRVYGDTWVLGAAMCKMVWPSMTFVATCSAATLAAISFDRYRAVVHPWK--PRLSMRQTLAVIVSTWLVSFLVVLPYILVLGMDGHSCTEFWLKDIH----------------------RQLYTVFLFVFAYALPLVIIAFAYSRVALKLREQSNRIEKNKLASGIPSSSKYNWITKMLVTVVLIYALCLLPNQVLWLWMEFGTGNEFEHMNTLLTFTGMLVYINSIVNPFLYAGLNDEFKKGFARLLCCKGK 283          
BLAST of GCR032 vs. Ensembl Nematostella
Match: EDO39968 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8M6])

HSP 1 Score: 100.138 bits (248), Expect = 9.433e-24
Identity = 84/285 (29.47%), Postives = 137/285 (48.07%), Query Frame = 2
Query:  224 QLRNGTNILIASLAIADITFITFCVP-LTATIFIKKGWF---LGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFGR-VYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRI-------SQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVL 1042
             +RN TNILIA+++ AD+       P L    +I   WF    GS+ C +      ++ + SVYTL+++SVDR LAV+ P+     +T      IVL  W++ ++ + PL+    V      +ND   ++C                + G+  + +YI++F +  Y++PL  I  +YT    KL     ++        S  +    S+++ T+M+V VVV+FALCW P+Q+  +I     +          +      + NS  NPI+Y  FS+ FR  FK VL
Sbjct:   23 HMRNVTNILIANMSAADLLMTILVFPYLIKFYYIGSKWFGGIAGSVTCTVVHSSQMVSIFGSVYTLLVISVDRCLAVMQPMKKYFTKTVTK-WSIVL-VWLVSVIFSIPLMIALKV------INDDTGYHCVE--------------DWGKMDQSLYIIMFLLLTYIVPLGLIGSVYTVTGRKLWGCGTAKSQENPLNRSNHESVRASRRKATKMLVTVVVLFALCWFPLQVRELIHVTWPDTLRRIPIKLDMLLPWFGFFNSCTNPIIYVIFSDRFRREFKRVL 285          
BLAST of GCR032 vs. Ensembl Nematostella
Match: EDO49570 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGN9])

HSP 1 Score: 99.7525 bits (247), Expect = 1.476e-23
Identity = 79/279 (28.32%), Postives = 143/279 (51.25%), Query Frame = 2
Query:  215 INKQLRNGTNILIASLAIADITFITFC-VPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPI-ASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFL---IWKLLFNSESRISQSDKALQ-SKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFK 1033
            +N + R+ T+  +A+LA +DI  ITF  +P   T    + W  G I CK+  +   ++   SV TL+ +++DR++++V P+   I +   K ++ +   TW+I +    PL+        P  +     +YC         E         +  + + +L  +  Y+ PL  + +LY  +   +WK   +  +RI++++  LQ S+KRV +M++ V ++FA+CW+P+ I   I F   +      K F+  +  L +SNS +NP LY+FF+ NFR  F+
Sbjct:   22 LNHRARSMTDTFVANLAASDI-LITFTGMPNMITEQYIRHWVFGPIVCKLVVYLQSVSVASSVLTLLAVTIDRFISIVFPLRGRIALSKAKYIVAV---TWIISLSIMAPLIDAQKAKQFPDGM-----YYCI--------EEWQPPFNPLEAPKSFTVLLFVVMYVAPLLTMAVLYCAICRTLWKRT-SPGARITRTETHLQRSRKRVLKMLLAVTLLFAVCWLPLWIFQFIMFFSPQTFPCFSKPFYFVSLFLGHSNSAINPFLYSFFNANFREGFR 282          
BLAST of GCR032 vs. Ensembl Medaka
Match: galr2a (galanin receptor type 2 [Source:NCBI gene;Acc:101155603])

HSP 1 Score: 149.443 bits (376), Expect = 3.022e-40
Identity = 93/272 (34.19%), Postives = 146/272 (53.68%), Query Frame = 2
Query:  233 NGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVLFC 1048
            N TN+ I +L++AD  FI FCVP  ATI+  +GW  GS  CK+  FF  LT Y S +TL  +SVDRYLA+ +P+ S  +RT  N +  ++  W + ++   P L          S  D  D+  + +    + E     L+   F         +F Y++P+  + L YT  I K L+ +   +    ++ ++K++VT+M++IV V+F +CW+P  +V +    G  P N    AF + +  +AY+NS +NPI+YA  S +FR  FK V  C
Sbjct:   60 NTTNLFILNLSVADFFFIIFCVPFQATIYSLEGWVFGSFMCKVVHFFINLTMYASSFTLAAVSVDRYLAIRYPLRSRELRTPCNAVVAMVVIWGLSLVFAGPYL----------SYYDLIDYANSTVCIPGWEEQDRKVLDTCTF---------LFGYVIPVLIVSLSYTRTI-KYLWTAVDPLDGMSESKRAKRKVTKMIIIVTVLFCICWLPYHVVILCYLYGDFPFNQTTYAFRLLSHCMAYANSCVNPIVYALVSKHFRKGFKKVFSC 311          
BLAST of GCR032 vs. Ensembl Medaka
Match: galr1a (galanin receptor 1 [Source:NCBI gene;Acc:101159001])

HSP 1 Score: 136.346 bits (342), Expect = 9.483e-36
Identity = 95/275 (34.55%), Postives = 152/275 (55.27%), Query Frame = 2
Query:  230 RNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVT-RMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVLFCQ 1051
            R  TNI I +L+IAD++++ FC+P  +T++I   W LG+  CK   +F  ++  +S++TL  MSVDRY+A+VH   S  IR  K  L  V+  W+I ++   P++    + +       + D Y T+   V  ++T           ++Y++   +F Y+LPL    LL +F   K+L +   ++    K  ++ K+ T + V++VVV+F L W+P  +V +    G+ P N A     V A  LAYSNS +NP++YAF S NFR A+K V  CQ
Sbjct:   68 RGTTNIFILNLSIADLSYLLFCIPFQSTVYILPSWVLGAFICKFIHYFFTVSMLVSIFTLSAMSVDRYIAIVHSRKSSSIRVAKYALIGVVVIWIISLVMAAPIMHYQNIFH-------SSDNY-TFCWEVWPDQTQ---------KKIYVVCTFVFGYVLPL----LLISFCYAKVLNHLHKKLRNMSKKSEASKKKTAQTVLVVVVVFCLSWLPHHVVHLWAEFGTFPLNQASFVLRVAAHCLAYSNSSVNPVIYAFLSENFRKAYKQVFKCQ 321          
BLAST of GCR032 vs. Ensembl Medaka
Match: ENSORLT00000043882.1 (galanin receptor type 1 [Source:NCBI gene;Acc:101175549])

HSP 1 Score: 135.191 bits (339), Expect = 3.589e-35
Identity = 97/280 (34.64%), Postives = 147/280 (52.50%), Query Frame = 2
Query:  239 TNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSV---LFCQKQSFSG 1069
            TNI I +L++AD++F+ FCVP  ATI+    W  G   CK   +F  +T  +S++TLV MSVDRY+ VV P  S   R+  + L  +   W+  ++C+ P+  +  V   P++ N +   +C         E   G   + QF +V ILL         L  I   YT ++W L    +   + S K+ +SK++  + V++VV  F +CWMP  I+ +    G+ P N A  AF + +  L+Y +S +NPILYAF S NFR AF  V   LF  +   +G
Sbjct:   75 TNIFIVNLSVADLSFLLFCVPFEATIYSLPEWVFGGFLCKFGHYFFTVTKLVSIFTLVAMSVDRYVVVVRPKKSACARSRMSALVGLCVIWMGSLVCSVPVALHQVVTNHPSAPNSS---FCW--------ENWRG--PSRQFYKVSILLLGYLLP---LLLICCCYTRILWHL---HKKMKNMSRKSQRSKQKTAQTVLLVVTAFTICWMPHHIIAMWVEFGTFPLNDASLAFRIVSHCLSYGHSCVNPILYAFLSKNFRRAFCQVFSHLFTHQPPSNG 335          
BLAST of GCR032 vs. Ensembl Medaka
Match: ENSORLT00000000456.2 (galanin receptor type 1 [Source:NCBI gene;Acc:101175549])

HSP 1 Score: 134.42 bits (337), Expect = 3.733e-35
Identity = 94/267 (35.21%), Postives = 142/267 (53.18%), Query Frame = 2
Query:  239 TNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSV 1039
            TNI I +L++AD++F+ FCVP  ATI+    W  G   CK   +F  +T  +S++TLV MSVDRY+ VV P  S   R+  + L  +   W+  ++C+ P+  +  V   P++ N +   +C         E   G   + QF +V ILL         L  I   YT ++W L    +   + S K+ +SK++  + V++VV  F +CWMP  I+ +    G+ P N A  AF + +  L+Y +S +NPILYAF S NFR AF  V
Sbjct:   48 TNIFIVNLSVADLSFLLFCVPFEATIYSLPEWVFGGFLCKFGHYFFTVTKLVSIFTLVAMSVDRYVVVVRPKKSACARSRMSALVGLCVIWMGSLVCSVPVALHQVVTNHPSAPNSS---FCW--------ENWRG--PSRQFYKVSILLLGYLLP---LLLICCCYTRILWHL---HKKMKNMSRKSQRSKQKTAQTVLLVVTAFTICWMPHHIIAMWVEFGTFPLNDASLAFRIVSHCLSYGHSCVNPILYAFLSKNFRRAFCQV 295          
BLAST of GCR032 vs. Ensembl Medaka
Match: ENSORLT00000046303.1 (galanin receptor type 1 [Source:NCBI gene;Acc:101175549])

HSP 1 Score: 134.42 bits (337), Expect = 4.676e-35
Identity = 94/267 (35.21%), Postives = 142/267 (53.18%), Query Frame = 2
Query:  239 TNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSV 1039
            TNI I +L++AD++F+ FCVP  ATI+    W  G   CK   +F  +T  +S++TLV MSVDRY+ VV P  S   R+  + L  +   W+  ++C+ P+  +  V   P++ N +   +C         E   G   + QF +V ILL         L  I   YT ++W L    +   + S K+ +SK++  + V++VV  F +CWMP  I+ +    G+ P N A  AF + +  L+Y +S +NPILYAF S NFR AF  V
Sbjct:   68 TNIFIVNLSVADLSFLLFCVPFEATIYSLPEWVFGGFLCKFGHYFFTVTKLVSIFTLVAMSVDRYVVVVRPKKSACARSRMSALVGLCVIWMGSLVCSVPVALHQVVTNHPSAPNSS---FCW--------ENWRG--PSRQFYKVSILLLGYLLP---LLLICCCYTRILWHL---HKKMKNMSRKSQRSKQKTAQTVLLVVTAFTICWMPHHIIAMWVEFGTFPLNDASLAFRIVSHCLSYGHSCVNPILYAFLSKNFRRAFCQV 315          
BLAST of GCR032 vs. Planmine SMEST
Match: SMESG000009917.1 (SMESG000009917.1)

HSP 1 Score: 347.051 bits (889), Expect = 5.764e-119
Identity = 190/191 (99.48%), Postives = 191/191 (100.00%), Query Frame = 2
Query:  101 MPNFTTESIITEMVAPSXXXXXXXXXXXXXXXXXXXXSINKQLRNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFGR 673
            MPNFTTESIITEMVAPSIFGVIVVFGFFGNLLVILVVSINKQLRNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTS+NDTKDFYCTYMPTVRYNETLMGYLENGQFGR
Sbjct:    1 MPNFTTESIITEMVAPSIFGVIVVFGFFGNLLVILVVSINKQLRNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSINDTKDFYCTYMPTVRYNETLMGYLENGQFGR 191          
BLAST of GCR032 vs. Planmine SMEST
Match: SMESG000009917.1 (SMESG000009917.1)

HSP 1 Score: 323.168 bits (827), Expect = 9.172e-110
Identity = 178/179 (99.44%), Postives = 179/179 (100.00%), Query Frame = 2
Query:  137 MVAPSXXXXXXXXXXXXXXXXXXXXSINKQLRNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFGR 673
            MVAPSIFGVIVVFGFFGNLLVILVVSINKQLRNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTS+NDTKDFYCTYMPTVRYNETLMGYLENGQFGR
Sbjct:    1 MVAPSIFGVIVVFGFFGNLLVILVVSINKQLRNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPPTSINDTKDFYCTYMPTVRYNETLMGYLENGQFGR 179          
BLAST of GCR032 vs. Planmine SMEST
Match: SMESG000014669.1 (SMESG000014669.1)

HSP 1 Score: 289.271 bits (739), Expect = 2.405e-93
Identity = 158/314 (50.32%), Postives = 213/314 (67.83%), Query Frame = 2
Query:  218 NKQLRNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGV--AYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVLFCQKQSFSGRDFEKTNLNINRNLSEQRASRKALTKKD 1153
            NK++RN TNILIASLAIAD+TFI FC+P T  I++K+GW LG   C+IYQF  Y+TAY SVYTLVLM  DR+LAVVHPI+S  +R+++N    V+  W++F   N PLL NSGV      + VN    +YC+Y+P VR+N+T   Y+ + +FG+ +   F IFAY LPL  I LLY  L+ +LL    S+++QS++AL+SKKRVT MVVIV+V FA CW+PIQ VF++Q    +     F+  H+F++ LAY+NSM+NPILYAF S NFR +F+ +L CQ    S  ++EKT+ + NR  S     R     KD
Sbjct:   55 NKKMRNSTNILIASLAIADLTFIAFCIPFTGVIYVKQGWPLGESFCRIYQFLIYVTAYCSVYTLVLMCFDRFLAVVHPISSSLVRSDRNTFLGVVVMWILFTGTNLPLLLNSGVIKGRKESKVNCVV-YYCSYLPLVRWNDTTDQYVVDIKFGKRFFTSFFIFAYFLPLLMISLLYGKLLCRLLHGRTSKMAQSNEALKSKKRVTIMVVIVIVAFAACWLPIQSVFLLQIYEFDVGGPLFRTIHIFSNCLAYANSMVNPILYAFLSENFRRSFRDLLCCQATQ-SRVEYEKTHFSHNRGGSNSFKGRTRRQSKD 366          
BLAST of GCR032 vs. Planmine SMEST
Match: SMESG000016325.1 (SMESG000016325.1)

HSP 1 Score: 288.886 bits (738), Expect = 9.508e-93
Identity = 146/285 (51.23%), Postives = 199/285 (69.82%), Query Frame = 2
Query:  218 NKQLRNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAYPP-TSVNDTKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVLFCQK-QSFS 1066
            N Q+RN TNILI SLA+AD+ FI FCVP TA +++  GW LG + C+IYQ+ TY+TAY SVYTLVLMS+DRYLAVVHPI S+ +R  +N +  V + W +F++ N PLL NS +   P   + D    YCTY P +++N T   Y ++  FG++Y  LF +  YL P+  I +LY FLI++LL    S+IS S+ A+ +KKRVT+MV++V+VIF LCW PIQ +FIIQ  G +P    F+  HV ++ LAYSNSM+NP LYAF S NFR AF ++L C++ +SF+
Sbjct:   64 NIQMRNTTNILIISLAVADLLFIIFCVPFTAVMYVTGGWPLGRVLCQIYQYMTYITAYCSVYTLVLMSIDRYLAVVHPIRSMTLRNSRNTIIAVGTVWSLFLVSNLPLLINSDIIEGPRDEITDCLVDYCTYKPFMKWNSTKKRYEDDKVFGKIYYTLFFVMFYLWPVIIISVLYGFLIYRLLCGRSSKISHSNDAMVTKKRVTKMVIVVIVIFTLCWAPIQTIFIIQLYGKDPGGNLFRTIHVISNCLAYSNSMVNPFLYAFLSENFRRAFANLLCCRRLKSFA 348          
BLAST of GCR032 vs. Planmine SMEST
Match: SMESG000074480.1 (SMESG000074480.1)

HSP 1 Score: 238.424 bits (607), Expect = 8.038e-74
Identity = 134/284 (47.18%), Postives = 186/284 (65.49%), Query Frame = 2
Query:  218 NKQLRNGTNILIASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSVYTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFNSGVAY--PPTSVNDT--KDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIFAYLLPLSAIILLYTFLIWKLLFNSESRIS--QSDKALQSKKRVTRMXXXXXXXFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYAFFSNNFRVAFKSVLFCQ 1051
            N  +RN TNILI+SLA AD+TFI FC+PLT +I+I +GW   +  C IYQ+ T+LT Y SVYTLVLMS DRYLA+VHPI S+  RT    L  V  +W+  ++ N P L NS V Y  P    N+   K++YC     V YNE + GY+++ +    +   F +F +LLPLS I++LY  L++++      R++  QS    +S K+VTR+VV V++ F + W+P+ IVF+IQ    +P N AF+AFH+ A+++AY NSM+NPILYAF S NFR AFK  L C+
Sbjct:   79 NGHMRNSTNILISSLAFADLTFIVFCIPLTISIYIYQGWIWNNFLCMIYQYLTWLTVYCSVYTLVLMSADRYLAIVHPITSVNWRTRNRSLTAVYISWIALIIINLPFLINSRVLYTIPVKLANNQTRKNYYCGNKKLVNYNEAMDGYIDDYKALFNHYFTFFLFGFLLPLSMIVILYGLLLYRI----SQRLNNQQSANITRSNKKVTRLVVSVIIAFGVSWLPLHIVFLIQSTYGDPSNVAFRAFHMVANSMAYGNSMINPILYAFLSENFRTAFKKFLTCK 358          
The following BLAST results are available for this feature:
BLAST of GCR032 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GALR21.320e-3631.23galanin receptor 2 [Source:HGNC Symbol;Acc:HGNC:41... [more]
OPRM15.793e-3431.58opioid receptor mu 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
OPRM11.149e-3333.82opioid receptor mu 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
OPRM11.379e-3330.67opioid receptor mu 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
OPRM11.379e-3330.67opioid receptor mu 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of GCR032 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
npr-99.956e-3831.89Galanin-like G-protein coupled receptor npr-9 [So... [more]
npr-221.374e-2630.04Neuropeptide receptor 22 [Source:UniProtKB/Swiss-... [more]
npr-221.600e-2630.04Neuropeptide receptor 22 [Source:UniProtKB/Swiss-... [more]
npr-61.412e-2027.56NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
npr-241.518e-2028.67NeuroPeptide Receptor family [Source:UniProtKB/Tr... [more]
back to top
BLAST of GCR032 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AstA-R11.264e-4436.10gene:FBgn0266429 transcript:FBtr0333798[more]
AstA-R11.264e-4436.10gene:FBgn0266429 transcript:FBtr0070575[more]
AstA-R21.036e-4336.52gene:FBgn0039595 transcript:FBtr0085316[more]
AstA-R21.036e-4336.52gene:FBgn0039595 transcript:FBtr0336790[more]
AstA-R24.738e-4337.36gene:FBgn0039595 transcript:FBtr0308641[more]
back to top
BLAST of GCR032 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
galr2b5.706e-4134.56galanin receptor 2b [Source:ZFIN;Acc:ZDB-GENE-1311... [more]
galr2b5.706e-4134.56galanin receptor 2b [Source:ZFIN;Acc:ZDB-GENE-1311... [more]
galr1b2.247e-4035.48galanin receptor 1b [Source:ZFIN;Acc:ZDB-GENE-1406... [more]
galr2a2.910e-3932.18galanin receptor 2a [Source:ZFIN;Acc:ZDB-GENE-1306... [more]
galr2a2.910e-3932.18galanin receptor 2a [Source:ZFIN;Acc:ZDB-GENE-1306... [more]
back to top
BLAST of GCR032 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sp33.842e-4333.57Sp3 transcription factor [Source:Xenbase;Acc:XB-GE... [more]
sp36.658e-4333.57Sp3 transcription factor [Source:Xenbase;Acc:XB-GE... [more]
ENSXETT00000041298.17.792e-4132.38galanin receptor 3 [Source:NCBI gene;Acc:100488248... [more]
lmod36.178e-4034.91leiomodin 3 [Source:Xenbase;Acc:XB-GENE-5737414][more]
lmod36.222e-4034.91leiomodin 3 [Source:Xenbase;Acc:XB-GENE-5737414][more]
back to top
BLAST of GCR032 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Galr21.183e-3431.23galanin receptor 2 [Source:MGI Symbol;Acc:MGI:1337... [more]
Oprm15.932e-3429.50opioid receptor, mu 1 [Source:MGI Symbol;Acc:MGI:9... [more]
Oprm16.230e-3430.89opioid receptor, mu 1 [Source:MGI Symbol;Acc:MGI:9... [more]
Oprm11.520e-3330.97opioid receptor, mu 1 [Source:MGI Symbol;Acc:MGI:9... [more]
Oprm11.549e-3330.67opioid receptor, mu 1 [Source:MGI Symbol;Acc:MGI:9... [more]
back to top
BLAST of GCR032 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8WPA2|AR_BOMMO1.876e-5338.74Allatostatin-A receptor OS=Bombyx mori OX=7091 GN=... [more]
sp|E7F7V7|GAL2B_DANRE4.307e-4034.56Galanin receptor 2b OS=Danio rerio OX=7955 GN=galr... [more]
sp|F1R332|GAL2A_DANRE2.197e-3832.18Galanin receptor 2a OS=Danio rerio OX=7955 GN=galr... [more]
sp|Q23497|NPR9_CAEEL1.266e-3631.89Galanin-like G-protein coupled receptor npr-9 OS=C... [more]
sp|O43603|GALR2_HUMAN6.338e-3631.23Galanin receptor type 2 OS=Homo sapiens OX=9606 GN... [more]
back to top
BLAST of GCR032 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KUH50.000e+099.47GCR032 OS=Schmidtea mediterranea OX=79327 GN=gcr03... [more]
A0A193KUR93.128e-8951.23GCR304 OS=Schmidtea mediterranea OX=79327 GN=gcr30... [more]
A0A193KUP03.737e-8949.10GCR064 OS=Schmidtea mediterranea OX=79327 GN=gcr06... [more]
A0A193KUG31.313e-6946.83GCR317 OS=Schmidtea mediterranea OX=79327 GN=gcr31... [more]
A0A2T7PZS63.083e-6842.86G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
back to top
BLAST of GCR032 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GALR11.134e-4133.93galanin receptor type 1 [Source:NCBI gene;Acc:1030... [more]
galr2b6.845e-4134.56galanin receptor type 2-like [Source:NCBI gene;Acc... [more]
ENSAMXT00000006013.21.956e-3937.45pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
galr1a1.679e-3634.75galanin receptor type 1 [Source:NCBI gene;Acc:1030... [more]
galr2a1.455e-3530.69galanin receptor type 2 [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of GCR032 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
galr2a4.177e-3630.45galanin receptor 2a [Source:ZFIN;Acc:ZDB-GENE-1306... [more]
oprk19.574e-3529.77opioid receptor, kappa 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
galr1b2.811e-3432.09galanin receptor 1b [Source:ZFIN;Acc:ZDB-GENE-1406... [more]
oprm14.422e-3029.45opioid receptor, mu 1 [Source:ZFIN;Acc:ZDB-GENE-01... [more]
galr1a1.462e-2829.18galanin receptor 1a [Source:ZFIN;Acc:ZDB-GENE-0605... [more]
back to top
BLAST of GCR032 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR032 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO370231.254e-2630.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO363772.861e-2533.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO496194.398e-2428.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO399689.433e-2429.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495701.476e-2328.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of GCR032 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
galr2a3.022e-4034.19galanin receptor type 2 [Source:NCBI gene;Acc:1011... [more]
galr1a9.483e-3634.55galanin receptor 1 [Source:NCBI gene;Acc:101159001... [more]
ENSORLT00000043882.13.589e-3534.64galanin receptor type 1 [Source:NCBI gene;Acc:1011... [more]
ENSORLT00000000456.23.733e-3535.21galanin receptor type 1 [Source:NCBI gene;Acc:1011... [more]
ENSORLT00000046303.14.676e-3535.21galanin receptor type 1 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of GCR032 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000009917.15.764e-11999.48SMESG000009917.1[more]
SMESG000009917.19.172e-11099.44SMESG000009917.1[more]
SMESG000014669.12.405e-9350.32SMESG000014669.1[more]
SMESG000016325.19.508e-9351.23SMESG000016325.1[more]
SMESG000074480.18.038e-7447.18SMESG000074480.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022111 ID=SMED30022111|Name=GCR032|organism=Schmidtea mediterranea sexual|type=transcript|length=1436bp
AAATTTTCTCTTTAGAATTATATTAATTTTGTTTTAATAATGCCAGGATA
AGAATTCATTGGAGGTATTTTATTGCACAAAGATTGAAAACAAATTCAGA
ATGCCAAATTTTACCACCGAGTCCATCATAACTGAAATGGTTGCCCCGTC
AATTTTTGGAGTGATTGTCGTATTTGGATTTTTTGGAAACCTTTTGGTCA
TCCTGGTCGTCTCCATAAATAAGCAGTTGCGAAATGGTACAAATATCCTC
ATCGCATCTCTAGCGATAGCTGACATAACATTTATTACTTTTTGTGTTCC
TTTAACTGCGACGATTTTCATTAAAAAAGGCTGGTTTTTGGGGAGTATTG
CTTGCAAAATATATCAGTTTTTTACATATTTAACGGCGTACATGAGTGTT
TATACTTTGGTATTAATGAGTGTCGATAGGTATTTGGCTGTTGTCCATCC
GATTGCGAGTATTCCAATTAGAACAGAAAAGAACGTCTTGAAAATCGTCC
TATCGACATGGGTAATCTTTATGCTATGTAATTGCCCACTGCTGTTCAAT
TCCGGGGTGGCGTATCCTCCAACTTCCGTCAATGATACGAAAGACTTTTA
CTGTACATATATGCCAACAGTTCGTTACAATGAAACACTAATGGGTTATT
TAGAAAATGGCCAATTTGGACGGGTCTACATTCTTTTATTTTCGATATTT
GCTTATTTGTTGCCTCTTTCAGCAATTATATTATTATACACGTTCTTGAT
ATGGAAATTACTTTTCAACAGTGAGTCTCGGATATCCCAATCCGACAAAG
CTTTACAATCAAAAAAGAGAGTTACAAGAATGGTTGTCATTGTTGTGGTT
ATTTTTGCATTGTGTTGGATGCCAATACAGATTGTTTTCATCATCCAATT
CCTAGGCAGTGAGCCCGACAATGCGGCGTTCAAAGCATTCCATGTATTTG
CAAGCGCCCTGGCTTATTCGAACAGCATGATGAATCCGATTTTGTATGCA
TTTTTCTCCAATAATTTCCGAGTTGCATTTAAGAGCGTCCTTTTTTGTCA
AAAACAATCGTTTTCCGGAAGAGATTTCGAAAAAACGAATTTAAACATCA
ATCGAAATCTTTCCGAGCAACGAGCCTCTCGAAAGGCTCTCACTAAGAAA
GATTGTGAAGTGAATATATATTCAGACAATAAGAACAATAAAATCCTTTC
AAGTTCCGGCTACACTAATCTCTCTAAGCTGTGAATCACTGATTGTTGAT
TGTAATTATATTGCATGCTATTTTGTTTTAATGCATTGATTTTACACATG
GTTTTAATTGATTTTCTAAAGGAGAAGTGAAATGTCAATTATTTTAGGTG
ATCTGAAGGGGTAATATTATTAAAAGGAAAGTTCCTAATGATCCATATAT
CAATATTTTATTGAAATATAACCATTATTTACAAAA
back to top

protein sequence of SMED30022111-orf-1

>SMED30022111-orf-1 ID=SMED30022111-orf-1|Name=SMED30022111-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=378bp
MPNFTTESIITEMVAPSIFGVIVVFGFFGNLLVILVVSINKQLRNGTNIL
IASLAIADITFITFCVPLTATIFIKKGWFLGSIACKIYQFFTYLTAYMSV
YTLVLMSVDRYLAVVHPIASIPIRTEKNVLKIVLSTWVIFMLCNCPLLFN
SGVAYPPTSVNDTKDFYCTYMPTVRYNETLMGYLENGQFGRVYILLFSIF
AYLLPLSAIILLYTFLIWKLLFNSESRISQSDKALQSKKRVTRMVVIVVV
IFALCWMPIQIVFIIQFLGSEPDNAAFKAFHVFASALAYSNSMMNPILYA
FFSNNFRVAFKSVLFCQKQSFSGRDFEKTNLNINRNLSEQRASRKALTKK
DCEVNIYSDNKNNKILSSSGYTNLSKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003104enteric muscle cell
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0004871signal transducer activity
Vocabulary: INTERPRO
TermDefinition
IPR000405Galanin_rcpt
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007165signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 53..74
score: 31.95
coord: 287..313
score: 35.81
coord: 134..155
score: 18.95
coord: 20..44
score: 28.14
coord: 247..271
score: 32.33
coord: 98..120
score: 32.84
coord: 200..223
score: 23.96
IPR000276G protein-coupled receptor, rhodopsin-likeSMARTSM013817TM_GPCR_Srsx_2coord: 29..320
e-value: 3.5E-7
score: -3.6
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 35..305
e-value: 1.9E-53
score: 181.5
IPR000276G protein-coupled receptor, rhodopsin-likePROSITEPS00237G_PROTEIN_RECEP_F1_1coord: 104..120
IPR000405Galanin receptor familyPRINTSPR00663GALANINRcoord: 67..81
score: 45.33
coord: 126..142
score: 29.41
coord: 84..102
score: 36.84
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 2..364
e-value: 9.3E-84
score: 282.9
NoneNo IPR availablePANTHERPTHR24230:SF126ALLATOSTATIN A RECEPTOR 2, ISOFORM Acoord: 9..335
NoneNo IPR availablePANTHERPTHR24230G-PROTEIN COUPLED RECEPTORcoord: 9..335
NoneNo IPR availableCDDcd150967tmA_AstA_R_insectcoord: 20..316
e-value: 2.54732E-100
score: 296.9
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 7..330
NoneNo IPR availableTMHMMTMhelixcoord: 206..228
NoneNo IPR availableTMHMMTMhelixcoord: 20..42
NoneNo IPR availableTMHMMTMhelixcoord: 139..161
NoneNo IPR availableTMHMMTMhelixcoord: 286..308
NoneNo IPR availableTMHMMTMhelixcoord: 55..77
NoneNo IPR availableTMHMMTMhelixcoord: 92..114
NoneNo IPR availableTMHMMTMhelixcoord: 249..271
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 35..305
score: 48.476