N terminal kinase protein like

Overview
NameN terminal kinase protein like
Smed IDSMED30022102
Length (bp)2212
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of N terminal kinase protein like (SMED30022102) t-SNE clustered cells

Violin plots show distribution of expression levels for N terminal kinase protein like (SMED30022102) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of N terminal kinase protein like (SMED30022102) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for N terminal kinase protein like (SMED30022102) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022102

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30022102h1SMcG0013012 dd_Smed_v4_3470_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30022102h1SMcG0013012 dd_Smed_v4_3470_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022102h1SMcG0013012 dd_Smed_v4_3470_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30022102h1SMcG0013012 dd_Smed_v4_3470_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of N terminal kinase protein like vs. Ensembl Human
Match: SCYL1 (SCY1 like pseudokinase 1 [Source:HGNC Symbol;Acc:HGNC:14372])

HSP 1 Score: 362.459 bits (929), Expect = 2.111e-113
Identity = 213/544 (39.15%), Postives = 313/544 (57.54%), Query Frame = 2
Query:  110 MWLFSKDSSVNFPYSRSCEN-EIKLLNGWILSNAVNKK-GEEFSVFLRDISSIDNLSKGTIQNALKKMKTLKHPDLISYVDSNESIKEVQIVTEKVVPLEKYLREKSDSSNFSFVA-SWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDFV----TNIGDDLPSSVVQTDLYWP-----------MDKSKIDSYGFGCLIWETFNQNLSRKSDLKETSKLPGQLVKLFQRLTHPKPNMRLNLDNALKEMSGPAGFADNFYVKTLLFLXXXXXXXXXXXXXFMASLTDLVDSFPDDIAKYKILPHLLMCHQFGGAGIEXXXXXXXXXXXXEASEFETSVVPRLVAMFRSSNRTTRVRLLEQLPTFVDVLPFKVVDMDIFPAVVLGLADTNPIVREATIRAVVHLAPKLSHKNLNEILINHLMNLQLKDEQGGIRTNATVCLAKIAHLLATQIRQTSLLNVLLKCTRDPFVPAKXXXXXXXXXXQHLFLVNDVATKLLPCLSFLTVDPEKEVREQTFKALDFALSRLKEASQNP 1687
            MW F++D   +FP+    E  E  L   W L     K  G   S+F+ D+           + A K+ KTL+HP++++Y+D  E+ K + +VTE V PL  YL+ + ++     +  SWGL QI++ L FL + C + HN + + ++FV+++G+WK+G  D++     N G      + + + Y P            +K   D +  GCLIWE FN  L R + L+   K+P  LV  +  L    P +R N    L+    P GF  N +V+T LFLEEIQIKE  +KQ+F   L+  +D+FP+D  ++K+LP LL   +FG AG  VL PL K+GK L A E++  ++P +V MF S++R  R+RLL+Q+  F+  L    V+  IFP VV G  DTNP +RE T+++++ LAPKL+  NLN  L+ H   LQ KDEQG IR N TVCL KI   L+   R   L +   + TRDPF P++++ V    A+ +L+ +ND A K+LP L  LTVDPEK VR+Q FKA+   LS+L+  S++P
Sbjct:    1 MWFFARDPVRDFPFELIPEPPEGGLPGPWALHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRFKTLRHPNILAYIDGLETEKCLHVVTEAVTPLGIYLKARVEAGGLKELEISWGLHQIVKALSFLVNDCSLIHNNVCMAAVFVDRAGEWKLGGLDYMYSAQGNGGGPPRKGIPELEQYDPPELADSSGRVVREKWSADMWRLGCLIWEVFNGPLPRAAALRNPGKIPKTLVPHYCELVGANPKVRPNPARFLQNCRAPGGFMSNRFVETNLFLEEIQIKEPAEKQKFFQELSKSLDAFPEDFCRHKVLPQLLTAFEFGNAGAVVLTPLFKVGKFLSAEEYQQKIIPVVVKMFSSTDRAMRIRLLQQMEQFIQYLDEPTVNTQIFPHVVHGFLDTNPAIREQTVKSMLLLAPKLNEANLNVELMKHFARLQAKDEQGPIRCNTTVCLGKIGSYLSASTRHRVLTSAFSRATRDPFAPSRVAGVLGFAATHNLYSMNDCAQKILPVLCGLTVDPEKSVRDQAFKAIRSFLSKLESVSEDP 544          
BLAST of N terminal kinase protein like vs. Ensembl Human
Match: SCYL1 (SCY1 like pseudokinase 1 [Source:HGNC Symbol;Acc:HGNC:14372])

HSP 1 Score: 362.073 bits (928), Expect = 2.187e-113
Identity = 213/544 (39.15%), Postives = 313/544 (57.54%), Query Frame = 2
Query:  110 MWLFSKDSSVNFPYSRSCEN-EIKLLNGWILSNAVNKK-GEEFSVFLRDISSIDNLSKGTIQNALKKMKTLKHPDLISYVDSNESIKEVQIVTEKVVPLEKYLREKSDSSNFSFVA-SWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDFV----TNIGDDLPSSVVQTDLYWP-----------MDKSKIDSYGFGCLIWETFNQNLSRKSDLKETSKLPGQLVKLFQRLTHPKPNMRLNLDNALKEMSGPAGFADNFYVKTLLFLXXXXXXXXXXXXXFMASLTDLVDSFPDDIAKYKILPHLLMCHQFGGAGIEXXXXXXXXXXXXEASEFETSVVPRLVAMFRSSNRTTRVRLLEQLPTFVDVLPFKVVDMDIFPAVVLGLADTNPIVREATIRAVVHLAPKLSHKNLNEILINHLMNLQLKDEQGGIRTNATVCLAKIAHLLATQIRQTSLLNVLLKCTRDPFVPAKXXXXXXXXXXQHLFLVNDVATKLLPCLSFLTVDPEKEVREQTFKALDFALSRLKEASQNP 1687
            MW F++D   +FP+    E  E  L   W L     K  G   S+F+ D+           + A K+ KTL+HP++++Y+D  E+ K + +VTE V PL  YL+ + ++     +  SWGL QI++ L FL + C + HN + + ++FV+++G+WK+G  D++     N G      + + + Y P            +K   D +  GCLIWE FN  L R + L+   K+P  LV  +  L    P +R N    L+    P GF  N +V+T LFLEEIQIKE  +KQ+F   L+  +D+FP+D  ++K+LP LL   +FG AG  VL PL K+GK L A E++  ++P +V MF S++R  R+RLL+Q+  F+  L    V+  IFP VV G  DTNP +RE T+++++ LAPKL+  NLN  L+ H   LQ KDEQG IR N TVCL KI   L+   R   L +   + TRDPF P++++ V    A+ +L+ +ND A K+LP L  LTVDPEK VR+Q FKA+   LS+L+  S++P
Sbjct:    1 MWFFARDPVRDFPFELIPEPPEGGLPGPWALHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRFKTLRHPNILAYIDGLETEKCLHVVTEAVTPLGIYLKARVEAGGLKELEISWGLHQIVKALSFLVNDCSLIHNNVCMAAVFVDRAGEWKLGGLDYMYSAQGNGGGPPRKGIPELEQYDPPELADSSGRVVREKWSADMWRLGCLIWEVFNGPLPRAAALRNPGKIPKTLVPHYCELVGANPKVRPNPARFLQNCRAPGGFMSNRFVETNLFLEEIQIKEPAEKQKFFQELSKSLDAFPEDFCRHKVLPQLLTAFEFGNAGAVVLTPLFKVGKFLSAEEYQQKIIPVVVKMFSSTDRAMRIRLLQQMEQFIQYLDEPTVNTQIFPHVVHGFLDTNPAIREQTVKSMLLLAPKLNEANLNVELMKHFARLQAKDEQGPIRCNTTVCLGKIGSYLSASTRHRVLTSAFSRATRDPFAPSRVAGVLGFAATHNLYSMNDCAQKILPVLCGLTVDPEKSVRDQAFKAIRSFLSKLESVSEDP 544          
BLAST of N terminal kinase protein like vs. Ensembl Human
Match: SCYL1 (SCY1 like pseudokinase 1 [Source:HGNC Symbol;Acc:HGNC:14372])

HSP 1 Score: 362.073 bits (928), Expect = 3.553e-113
Identity = 213/544 (39.15%), Postives = 313/544 (57.54%), Query Frame = 2
Query:  110 MWLFSKDSSVNFPYSRSCEN-EIKLLNGWILSNAVNKK-GEEFSVFLRDISSIDNLSKGTIQNALKKMKTLKHPDLISYVDSNESIKEVQIVTEKVVPLEKYLREKSDSSNFSFVA-SWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDFV----TNIGDDLPSSVVQTDLYWP-----------MDKSKIDSYGFGCLIWETFNQNLSRKSDLKETSKLPGQLVKLFQRLTHPKPNMRLNLDNALKEMSGPAGFADNFYVKTLLFLXXXXXXXXXXXXXFMASLTDLVDSFPDDIAKYKILPHLLMCHQFGGAGIEXXXXXXXXXXXXEASEFETSVVPRLVAMFRSSNRTTRVRLLEQLPTFVDVLPFKVVDMDIFPAVVLGLADTNPIVREATIRAVVHLAPKLSHKNLNEILINHLMNLQLKDEQGGIRTNATVCLAKIAHLLATQIRQTSLLNVLLKCTRDPFVPAKXXXXXXXXXXQHLFLVNDVATKLLPCLSFLTVDPEKEVREQTFKALDFALSRLKEASQNP 1687
            MW F++D   +FP+    E  E  L   W L     K  G   S+F+ D+           + A K+ KTL+HP++++Y+D  E+ K + +VTE V PL  YL+ + ++     +  SWGL QI++ L FL + C + HN + + ++FV+++G+WK+G  D++     N G      + + + Y P            +K   D +  GCLIWE FN  L R + L+   K+P  LV  +  L    P +R N    L+    P GF  N +V+T LFLEEIQIKE  +KQ+F   L+  +D+FP+D  ++K+LP LL   +FG AG  VL PL K+GK L A E++  ++P +V MF S++R  R+RLL+Q+  F+  L    V+  IFP VV G  DTNP +RE T+++++ LAPKL+  NLN  L+ H   LQ KDEQG IR N TVCL KI   L+   R   L +   + TRDPF P++++ V    A+ +L+ +ND A K+LP L  LTVDPEK VR+Q FKA+   LS+L+  S++P
Sbjct:    1 MWFFARDPVRDFPFELIPEPPEGGLPGPWALHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRFKTLRHPNILAYIDGLETEKCLHVVTEAVTPLGIYLKARVEAGGLKELEISWGLHQIVKALSFLVNDCSLIHNNVCMAAVFVDRAGEWKLGGLDYMYSAQGNGGGPPRKGIPELEQYDPPELADSSGRVVREKWSADMWRLGCLIWEVFNGPLPRAAALRNPGKIPKTLVPHYCELVGANPKVRPNPARFLQNCRAPGGFMSNRFVETNLFLEEIQIKEPAEKQKFFQELSKSLDAFPEDFCRHKVLPQLLTAFEFGNAGAVVLTPLFKVGKFLSAEEYQQKIIPVVVKMFSSTDRAMRIRLLQQMEQFIQYLDEPTVNTQIFPHVVHGFLDTNPAIREQTVKSMLLLAPKLNEANLNVELMKHFARLQAKDEQGPIRCNTTVCLGKIGSYLSASTRHRVLTSAFSRATRDPFAPSRVAGVLGFAATHNLYSMNDCAQKILPVLCGLTVDPEKSVRDQAFKAIRSFLSKLESVSEDP 544          
BLAST of N terminal kinase protein like vs. Ensembl Human
Match: SCYL1 (SCY1 like pseudokinase 1 [Source:HGNC Symbol;Acc:HGNC:14372])

HSP 1 Score: 362.459 bits (929), Expect = 3.817e-113
Identity = 213/544 (39.15%), Postives = 313/544 (57.54%), Query Frame = 2
Query:  110 MWLFSKDSSVNFPYSRSCEN-EIKLLNGWILSNAVNKK-GEEFSVFLRDISSIDNLSKGTIQNALKKMKTLKHPDLISYVDSNESIKEVQIVTEKVVPLEKYLREKSDSSNFSFVA-SWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDFV----TNIGDDLPSSVVQTDLYWP-----------MDKSKIDSYGFGCLIWETFNQNLSRKSDLKETSKLPGQLVKLFQRLTHPKPNMRLNLDNALKEMSGPAGFADNFYVKTLLFLXXXXXXXXXXXXXFMASLTDLVDSFPDDIAKYKILPHLLMCHQFGGAGIEXXXXXXXXXXXXEASEFETSVVPRLVAMFRSSNRTTRVRLLEQLPTFVDVLPFKVVDMDIFPAVVLGLADTNPIVREATIRAVVHLAPKLSHKNLNEILINHLMNLQLKDEQGGIRTNATVCLAKIAHLLATQIRQTSLLNVLLKCTRDPFVPAKXXXXXXXXXXQHLFLVNDVATKLLPCLSFLTVDPEKEVREQTFKALDFALSRLKEASQNP 1687
            MW F++D   +FP+    E  E  L   W L     K  G   S+F+ D+           + A K+ KTL+HP++++Y+D  E+ K + +VTE V PL  YL+ + ++     +  SWGL QI++ L FL + C + HN + + ++FV+++G+WK+G  D++     N G      + + + Y P            +K   D +  GCLIWE FN  L R + L+   K+P  LV  +  L    P +R N    L+    P GF  N +V+T LFLEEIQIKE  +KQ+F   L+  +D+FP+D  ++K+LP LL   +FG AG  VL PL K+GK L A E++  ++P +V MF S++R  R+RLL+Q+  F+  L    V+  IFP VV G  DTNP +RE T+++++ LAPKL+  NLN  L+ H   LQ KDEQG IR N TVCL KI   L+   R   L +   + TRDPF P++++ V    A+ +L+ +ND A K+LP L  LTVDPEK VR+Q FKA+   LS+L+  S++P
Sbjct:    1 MWFFARDPVRDFPFELIPEPPEGGLPGPWALHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRFKTLRHPNILAYIDGLETEKCLHVVTEAVTPLGIYLKARVEAGGLKELEISWGLHQIVKALSFLVNDCSLIHNNVCMAAVFVDRAGEWKLGGLDYMYSAQGNGGGPPRKGIPELEQYDPPELADSSGRVVREKWSADMWRLGCLIWEVFNGPLPRAAALRNPGKIPKTLVPHYCELVGANPKVRPNPARFLQNCRAPGGFMSNRFVETNLFLEEIQIKEPAEKQKFFQELSKSLDAFPEDFCRHKVLPQLLTAFEFGNAGAVVLTPLFKVGKFLSAEEYQQKIIPVVVKMFSSTDRAMRIRLLQQMEQFIQYLDEPTVNTQIFPHVVHGFLDTNPAIREQTVKSMLLLAPKLNEANLNVELMKHFARLQAKDEQGPIRCNTTVCLGKIGSYLSASTRHRVLTSAFSRATRDPFAPSRVAGVLGFAATHNLYSMNDCAQKILPVLCGLTVDPEKSVRDQAFKAIRSFLSKLESVSEDP 544          
BLAST of N terminal kinase protein like vs. Ensembl Human
Match: SCYL1 (SCY1 like pseudokinase 1 [Source:HGNC Symbol;Acc:HGNC:14372])

HSP 1 Score: 361.688 bits (927), Expect = 4.663e-113
Identity = 213/544 (39.15%), Postives = 313/544 (57.54%), Query Frame = 2
Query:  110 MWLFSKDSSVNFPYSRSCEN-EIKLLNGWILSNAVNKK-GEEFSVFLRDISSIDNLSKGTIQNALKKMKTLKHPDLISYVDSNESIKEVQIVTEKVVPLEKYLREKSDSSNFSFVA-SWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDFV----TNIGDDLPSSVVQTDLYWP-----------MDKSKIDSYGFGCLIWETFNQNLSRKSDLKETSKLPGQLVKLFQRLTHPKPNMRLNLDNALKEMSGPAGFADNFYVKTLLFLXXXXXXXXXXXXXFMASLTDLVDSFPDDIAKYKILPHLLMCHQFGGAGIEXXXXXXXXXXXXEASEFETSVVPRLVAMFRSSNRTTRVRLLEQLPTFVDVLPFKVVDMDIFPAVVLGLADTNPIVREATIRAVVHLAPKLSHKNLNEILINHLMNLQLKDEQGGIRTNATVCLAKIAHLLATQIRQTSLLNVLLKCTRDPFVPAKXXXXXXXXXXQHLFLVNDVATKLLPCLSFLTVDPEKEVREQTFKALDFALSRLKEASQNP 1687
            MW F++D   +FP+    E  E  L   W L     K  G   S+F+ D+           + A K+ KTL+HP++++Y+D  E+ K + +VTE V PL  YL+ + ++     +  SWGL QI++ L FL + C + HN + + ++FV+++G+WK+G  D++     N G      + + + Y P            +K   D +  GCLIWE FN  L R + L+   K+P  LV  +  L    P +R N    L+    P GF  N +V+T LFLEEIQIKE  +KQ+F   L+  +D+FP+D  ++K+LP LL   +FG AG  VL PL K+GK L A E++  ++P +V MF S++R  R+RLL+Q+  F+  L    V+  IFP VV G  DTNP +RE T+++++ LAPKL+  NLN  L+ H   LQ KDEQG IR N TVCL KI   L+   R   L +   + TRDPF P++++ V    A+ +L+ +ND A K+LP L  LTVDPEK VR+Q FKA+   LS+L+  S++P
Sbjct:    1 MWFFARDPVRDFPFELIPEPPEGGLPGPWALHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRFKTLRHPNILAYIDGLETEKCLHVVTEAVTPLGIYLKARVEAGGLKELEISWGLHQIVKALSFLVNDCSLIHNNVCMAAVFVDRAGEWKLGGLDYMYSAQGNGGGPPRKGIPELEQYDPPELADSSGRVVREKWSADMWRLGCLIWEVFNGPLPRAAALRNPGKIPKTLVPHYCELVGANPKVRPNPARFLQNCRAPGGFMSNRFVETNLFLEEIQIKEPAEKQKFFQELSKSLDAFPEDFCRHKVLPQLLTAFEFGNAGAVVLTPLFKVGKFLSAEEYQQKIIPVVVKMFSSTDRAMRIRLLQQMEQFIQYLDEPTVNTQIFPHVVHGFLDTNPAIREQTVKSMLLLAPKLNEANLNVELMKHFARLQAKDEQGPIRCNTTVCLGKIGSYLSASTRHRVLTSAFSRATRDPFAPSRVAGVLGFAATHNLYSMNDCAQKILPVLCGLTVDPEKSVRDQAFKAIRSFLSKLESVSEDP 544          
BLAST of N terminal kinase protein like vs. Ensembl Celegans
Match: W07G4.3 (pep chromosome:WBcel235:V:13038589:13041879:-1 gene:WBGene00012337.1 transcript:W07G4.3.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W07G4.3)

HSP 1 Score: 308.531 bits (789), Expect = 3.718e-93
Identity = 206/560 (36.79%), Postives = 322/560 (57.50%), Query Frame = 2
Query:  116 LFSKDSSVNFPYSRSCENEIKLLNGWILSNAVNKK--GEEFSVFLRDISSIDNLSKGTIQNALKKMKTLKHPDLISYVDSNESIKEVQIVTEKVVPLEKYLREKS-DSSNFSFVASWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDFVTNIGDDLPSSVVQTDLYWPMDKSKIDSYGFGCLIWETFNQNLSRKSDLKETSKLPGQLVKLFQRLTHPKPNMRLNLDNALKEMSGPAGFADNFYVKTLLFLXXXXXXXXXXXXXFMASLTDLVDSFPDDIAKYKILPHLLMCHQFGGAGIEXXXXXXXXXXXXEASEFETSVVPRLVAMFRSSNRTTRVRLLEQLPTFVDVLPFKVVDMDIFPAVVLGLADTNPIVREATIRAVVHLAPKLSHKNLNEILINHLMNLQLKDEQGGIRTNATVCLAKIAHLLATQIRQTSLLNVLLKCTRDPFVPAKXXXXXXXXXXQHLFLVNDVATKLLPCLSFLTVDPEKEVREQTFKALDFALSRLKEASQNPENNKIEPLENK---------EAQKLIGWKNWAV 1759
             F +D    FPY      E    +   + N+  K   GE  ++F  + SS       T++   +K+KT++HP++I+Y+DS E      +VTEK  PLE YL+E     S   FV SWG+FQ+L  L F+    K+ H  +R   +FV   GDWK+G    VT        +  QTDL                ++WE FN      +  +   K+P ++ +L++++   +   RL + + +KE     G+  N +V TLLFLEE ++KE  +KQ F   L + +D FP+D+AKYKILP L++ +++G AG  +L+PL KLG+LL+ +E++ ++VP L  +F S +RTTRV+LLE++  F   L  ++++  IF  +  G  DTNP VRE+T++A+V LA KL++ NLN  L+ +L  LQ  DE GGIRTN T+CL KI HL+A   RQ  L++   +  +DPF P+++++V AL A+Q  + + +++ +++P L  LT DPEK+VR+Q FKA+   L +L++AS+NP    I  LE           + +K+  W +WA+
Sbjct:    8 FFQRDPKSQFPYDIPGAEE-HFFDRVSIGNSFKKAEPGELATIFWDNRSS-------TLKQQAQKLKTMRHPNIITYLDSIELEGTFYLVTEKCKPLELYLKEAGLTESQKEFVVSWGMFQLLNALKFMHE-AKLSHENLR-KGVFVTAGGDWKIGGLHLVTGF------TSPQTDLN-----------QLAIVLWEVFNGFNDAITRPQAPGKIPQRIHELYKKIGA-QSAARLAVCDIIKEYRLTGGYLKNKFVDTLLFLEEFELKEASEKQSFFMHLRENIDIFPEDVAKYKILPKLILTYEYGDAGPNILIPLFKLGRLLDEAEYQRTIVPCLCKLFGSPDRTTRVKLLERIDEFAPHLTPQILNDKIFGNLTSGFLDTNPAVRESTVKAMVSLAEKLNYNNLNVELMKYLARLQGGDEHGGIRTNTTICLGKIGHLIAPAKRQGILISAFTRALKDPFAPSRMASVLALSATQQFYPLVEISNRIVPSLIPLTCDPEKQVRDQAFKAIRGFLEKLEKASENPAC--IPELEAGVKAGASSILDHEKVPQWASWAL 537          
BLAST of N terminal kinase protein like vs. Ensembl Celegans
Match: W07G4.3 (pep chromosome:WBcel235:V:13037016:13041879:-1 gene:WBGene00012337.1 transcript:W07G4.3.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W07G4.3)

HSP 1 Score: 308.531 bits (789), Expect = 3.718e-93
Identity = 206/560 (36.79%), Postives = 322/560 (57.50%), Query Frame = 2
Query:  116 LFSKDSSVNFPYSRSCENEIKLLNGWILSNAVNKK--GEEFSVFLRDISSIDNLSKGTIQNALKKMKTLKHPDLISYVDSNESIKEVQIVTEKVVPLEKYLREKS-DSSNFSFVASWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDFVTNIGDDLPSSVVQTDLYWPMDKSKIDSYGFGCLIWETFNQNLSRKSDLKETSKLPGQLVKLFQRLTHPKPNMRLNLDNALKEMSGPAGFADNFYVKTLLFLXXXXXXXXXXXXXFMASLTDLVDSFPDDIAKYKILPHLLMCHQFGGAGIEXXXXXXXXXXXXEASEFETSVVPRLVAMFRSSNRTTRVRLLEQLPTFVDVLPFKVVDMDIFPAVVLGLADTNPIVREATIRAVVHLAPKLSHKNLNEILINHLMNLQLKDEQGGIRTNATVCLAKIAHLLATQIRQTSLLNVLLKCTRDPFVPAKXXXXXXXXXXQHLFLVNDVATKLLPCLSFLTVDPEKEVREQTFKALDFALSRLKEASQNPENNKIEPLENK---------EAQKLIGWKNWAV 1759
             F +D    FPY      E    +   + N+  K   GE  ++F  + SS       T++   +K+KT++HP++I+Y+DS E      +VTEK  PLE YL+E     S   FV SWG+FQ+L  L F+    K+ H  +R   +FV   GDWK+G    VT        +  QTDL                ++WE FN      +  +   K+P ++ +L++++   +   RL + + +KE     G+  N +V TLLFLEE ++KE  +KQ F   L + +D FP+D+AKYKILP L++ +++G AG  +L+PL KLG+LL+ +E++ ++VP L  +F S +RTTRV+LLE++  F   L  ++++  IF  +  G  DTNP VRE+T++A+V LA KL++ NLN  L+ +L  LQ  DE GGIRTN T+CL KI HL+A   RQ  L++   +  +DPF P+++++V AL A+Q  + + +++ +++P L  LT DPEK+VR+Q FKA+   L +L++AS+NP    I  LE           + +K+  W +WA+
Sbjct:    8 FFQRDPKSQFPYDIPGAEE-HFFDRVSIGNSFKKAEPGELATIFWDNRSS-------TLKQQAQKLKTMRHPNIITYLDSIELEGTFYLVTEKCKPLELYLKEAGLTESQKEFVVSWGMFQLLNALKFMHE-AKLSHENLR-KGVFVTAGGDWKIGGLHLVTGF------TSPQTDLN-----------QLAIVLWEVFNGFNDAITRPQAPGKIPQRIHELYKKIGA-QSAARLAVCDIIKEYRLTGGYLKNKFVDTLLFLEEFELKEASEKQSFFMHLRENIDIFPEDVAKYKILPKLILTYEYGDAGPNILIPLFKLGRLLDEAEYQRTIVPCLCKLFGSPDRTTRVKLLERIDEFAPHLTPQILNDKIFGNLTSGFLDTNPAVRESTVKAMVSLAEKLNYNNLNVELMKYLARLQGGDEHGGIRTNTTICLGKIGHLIAPAKRQGILISAFTRALKDPFAPSRMASVLALSATQQFYPLVEISNRIVPSLIPLTCDPEKQVRDQAFKAIRGFLEKLEKASENPAC--IPELEAGVKAGASSILDHEKVPQWASWAL 537          
BLAST of N terminal kinase protein like vs. Ensembl Celegans
Match: W07G4.3 (pep chromosome:WBcel235:V:13036996:13041879:-1 gene:WBGene00012337.1 transcript:W07G4.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W07G4.3)

HSP 1 Score: 308.531 bits (789), Expect = 3.718e-93
Identity = 206/560 (36.79%), Postives = 322/560 (57.50%), Query Frame = 2
Query:  116 LFSKDSSVNFPYSRSCENEIKLLNGWILSNAVNKK--GEEFSVFLRDISSIDNLSKGTIQNALKKMKTLKHPDLISYVDSNESIKEVQIVTEKVVPLEKYLREKS-DSSNFSFVASWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDFVTNIGDDLPSSVVQTDLYWPMDKSKIDSYGFGCLIWETFNQNLSRKSDLKETSKLPGQLVKLFQRLTHPKPNMRLNLDNALKEMSGPAGFADNFYVKTLLFLXXXXXXXXXXXXXFMASLTDLVDSFPDDIAKYKILPHLLMCHQFGGAGIEXXXXXXXXXXXXEASEFETSVVPRLVAMFRSSNRTTRVRLLEQLPTFVDVLPFKVVDMDIFPAVVLGLADTNPIVREATIRAVVHLAPKLSHKNLNEILINHLMNLQLKDEQGGIRTNATVCLAKIAHLLATQIRQTSLLNVLLKCTRDPFVPAKXXXXXXXXXXQHLFLVNDVATKLLPCLSFLTVDPEKEVREQTFKALDFALSRLKEASQNPENNKIEPLENK---------EAQKLIGWKNWAV 1759
             F +D    FPY      E    +   + N+  K   GE  ++F  + SS       T++   +K+KT++HP++I+Y+DS E      +VTEK  PLE YL+E     S   FV SWG+FQ+L  L F+    K+ H  +R   +FV   GDWK+G    VT        +  QTDL                ++WE FN      +  +   K+P ++ +L++++   +   RL + + +KE     G+  N +V TLLFLEE ++KE  +KQ F   L + +D FP+D+AKYKILP L++ +++G AG  +L+PL KLG+LL+ +E++ ++VP L  +F S +RTTRV+LLE++  F   L  ++++  IF  +  G  DTNP VRE+T++A+V LA KL++ NLN  L+ +L  LQ  DE GGIRTN T+CL KI HL+A   RQ  L++   +  +DPF P+++++V AL A+Q  + + +++ +++P L  LT DPEK+VR+Q FKA+   L +L++AS+NP    I  LE           + +K+  W +WA+
Sbjct:    8 FFQRDPKSQFPYDIPGAEE-HFFDRVSIGNSFKKAEPGELATIFWDNRSS-------TLKQQAQKLKTMRHPNIITYLDSIELEGTFYLVTEKCKPLELYLKEAGLTESQKEFVVSWGMFQLLNALKFMHE-AKLSHENLR-KGVFVTAGGDWKIGGLHLVTGF------TSPQTDLN-----------QLAIVLWEVFNGFNDAITRPQAPGKIPQRIHELYKKIGA-QSAARLAVCDIIKEYRLTGGYLKNKFVDTLLFLEEFELKEASEKQSFFMHLRENIDIFPEDVAKYKILPKLILTYEYGDAGPNILIPLFKLGRLLDEAEYQRTIVPCLCKLFGSPDRTTRVKLLERIDEFAPHLTPQILNDKIFGNLTSGFLDTNPAVRESTVKAMVSLAEKLNYNNLNVELMKYLARLQGGDEHGGIRTNTTICLGKIGHLIAPAKRQGILISAFTRALKDPFAPSRMASVLALSATQQFYPLVEISNRIVPSLIPLTCDPEKQVRDQAFKAIRGFLEKLEKASENPAC--IPELEAGVKAGASSILDHEKVPQWASWAL 537          
BLAST of N terminal kinase protein like vs. Ensembl Fly
Match: yata (gene:FBgn0260990 transcript:FBtr0333822)

HSP 1 Score: 374.4 bits (960), Expect = 2.377e-117
Identity = 230/576 (39.93%), Postives = 342/576 (59.38%), Query Frame = 2
Query:  110 MW-LFSKDSSVNFPYS-RSCENEIKLLNGWILSNAVNKKG-EEFSVFLRDISSIDNLSKGTIQNALKKMKTLKHPDLISYVDSNESIKEVQIVTEKVVPLEKYLRE-KSDSSNFSFVASWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDFVTNI-GDDLPSSVVQTDL-------------YWPMDKSKIDSYGFGCLIWETFNQNLSRKSDLKETSKLPGQLVKLFQRLTHPKPNMRLNLDNALKEMSGPAGFADNFYVKTLLFLXXXXXXXXXXXXXFMASLTDLVDSFPDDIAKYKILPHLLMCHQFGGAGIEXXXXXXXXXXXXEASEFETSVVPRLVAMFRSSNRTTRVRLLEQLPTFVDVLPFKVVDMDIFPAVVLGLADTNPIVREATIRAVVHLAPKLSHKNLNEILINHLMNLQLKDEQGGIRTNATVCLAKIAHLLATQIRQTSLLNVLLKCTRDPFVPAKXXXXXXXXXXQHLFLVNDVATKLLPCLSFLTVDPEKEVREQTFKALDFALSRLKEASQNPENNKIEPLENKEAQKLIG-----WKNWAVSFI 1768
            MW  FS+DSS +FPY            + W L  A  K   EE SVF+ DI S  +      + ALK++KTL+HP ++ Y+DS E+ K + + TE V PL  Y  +  SD+       +WG+FQI R L FL++   ++HN +   S+FVN SG+WK+G+ ++V+   G+ +P + +   L                  K  +D +G GCL+WE FN  L ++S+LK+   +P  L  L+  L    P+ R N  + +     P GF  N  V TLLFLEEIQIK++ +K +F + LT  +D+FPD++ ++KILP L+  +++G AG  VL P+ KLGKLL+  E++  +VP +V +F S++R TR RLL+QL  F+  L  +VV+  IFP V  G  DTN  +RE T+++++HLAPKL++ NLN  ++ H   LQ +D+QGGIRTN TVCL KIA  L  Q+RQ  L++  ++  RDPF PA+++ V AL A+Q  FL+++VA ++LP L  LTVDPEK VR+  FK +   L +L++ S++P   +    +   A   IG     W  WAV+ +
Sbjct:    1 MWSFFSRDSSKDFPYDIGEPVGGFDQYSIWTLHKAKRKTTLEEVSVFVYDIRSGSDTKCELAKAALKRLKTLRHPSILQYLDSLETDKMLYVATEAVDPLGTYFSKLGSDNVQKGLYLAWGIFQITRALSFLNNDGNLRHNNVSAWSVFVNASGEWKLGSLEYVSAADGNPMPPAKIPVTLEVYDSPEKNDPSKLKAATKCSVDMWGLGCLVWEAFNGVLKQRSNLKDIEHIPKSLQSLYCELVGASPSNRPNPADIITRCRKPGGFFKNDLVDTLLFLEEIQIKDKAEKNRFFSGLTTHLDNFPDNVCRHKILPQLITAYEYGDAGSAVLAPMFKLGKLLDEVEYQKRIVPCVVKLFASTDRVTRSRLLQQLDLFIAHLQPQVVNDQIFPQVAHGFLDTNATIREQTVKSIIHLAPKLNYNNLNVEVLRHFARLQARDDQGGIRTNTTVCLGKIAPHLHPQVRQRVLVSAFIRAMRDPFPPARVAGVLALAATQQYFLLSEVANRVLPSLCSLTVDPEKTVRDPAFKTIRGFLGKLEKVSEDPSLRETMEADVHTATPSIGNAAATWAGWAVTAV 576          
BLAST of N terminal kinase protein like vs. Ensembl Fly
Match: yata (gene:FBgn0260990 transcript:FBtr0085477)

HSP 1 Score: 374.4 bits (960), Expect = 2.377e-117
Identity = 230/576 (39.93%), Postives = 342/576 (59.38%), Query Frame = 2
Query:  110 MW-LFSKDSSVNFPYS-RSCENEIKLLNGWILSNAVNKKG-EEFSVFLRDISSIDNLSKGTIQNALKKMKTLKHPDLISYVDSNESIKEVQIVTEKVVPLEKYLRE-KSDSSNFSFVASWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDFVTNI-GDDLPSSVVQTDL-------------YWPMDKSKIDSYGFGCLIWETFNQNLSRKSDLKETSKLPGQLVKLFQRLTHPKPNMRLNLDNALKEMSGPAGFADNFYVKTLLFLXXXXXXXXXXXXXFMASLTDLVDSFPDDIAKYKILPHLLMCHQFGGAGIEXXXXXXXXXXXXEASEFETSVVPRLVAMFRSSNRTTRVRLLEQLPTFVDVLPFKVVDMDIFPAVVLGLADTNPIVREATIRAVVHLAPKLSHKNLNEILINHLMNLQLKDEQGGIRTNATVCLAKIAHLLATQIRQTSLLNVLLKCTRDPFVPAKXXXXXXXXXXQHLFLVNDVATKLLPCLSFLTVDPEKEVREQTFKALDFALSRLKEASQNPENNKIEPLENKEAQKLIG-----WKNWAVSFI 1768
            MW  FS+DSS +FPY            + W L  A  K   EE SVF+ DI S  +      + ALK++KTL+HP ++ Y+DS E+ K + + TE V PL  Y  +  SD+       +WG+FQI R L FL++   ++HN +   S+FVN SG+WK+G+ ++V+   G+ +P + +   L                  K  +D +G GCL+WE FN  L ++S+LK+   +P  L  L+  L    P+ R N  + +     P GF  N  V TLLFLEEIQIK++ +K +F + LT  +D+FPD++ ++KILP L+  +++G AG  VL P+ KLGKLL+  E++  +VP +V +F S++R TR RLL+QL  F+  L  +VV+  IFP V  G  DTN  +RE T+++++HLAPKL++ NLN  ++ H   LQ +D+QGGIRTN TVCL KIA  L  Q+RQ  L++  ++  RDPF PA+++ V AL A+Q  FL+++VA ++LP L  LTVDPEK VR+  FK +   L +L++ S++P   +    +   A   IG     W  WAV+ +
Sbjct:    1 MWSFFSRDSSKDFPYDIGEPVGGFDQYSIWTLHKAKRKTTLEEVSVFVYDIRSGSDTKCELAKAALKRLKTLRHPSILQYLDSLETDKMLYVATEAVDPLGTYFSKLGSDNVQKGLYLAWGIFQITRALSFLNNDGNLRHNNVSAWSVFVNASGEWKLGSLEYVSAADGNPMPPAKIPVTLEVYDSPEKNDPSKLKAATKCSVDMWGLGCLVWEAFNGVLKQRSNLKDIEHIPKSLQSLYCELVGASPSNRPNPADIITRCRKPGGFFKNDLVDTLLFLEEIQIKDKAEKNRFFSGLTTHLDNFPDNVCRHKILPQLITAYEYGDAGSAVLAPMFKLGKLLDEVEYQKRIVPCVVKLFASTDRVTRSRLLQQLDLFIAHLQPQVVNDQIFPQVAHGFLDTNATIREQTVKSIIHLAPKLNYNNLNVEVLRHFARLQARDDQGGIRTNTTVCLGKIAPHLHPQVRQRVLVSAFIRAMRDPFPPARVAGVLALAATQQYFLLSEVANRVLPSLCSLTVDPEKTVRDPAFKTIRGFLGKLEKVSEDPSLRETMEADVHTATPSIGNAAATWAGWAVTAV 576          
BLAST of N terminal kinase protein like vs. Ensembl Fly
Match: CG1344 (gene:FBgn0027507 transcript:FBtr0086034)

HSP 1 Score: 62.3882 bits (150), Expect = 1.025e-9
Identity = 33/109 (30.28%), Postives = 56/109 (51.38%), Query Frame = 2
Query:  278 GTIQNALKKMKTLKHPDLISYVDSNESIKEVQIVTEKVVPLEKYLREKSDSSNFSFVASWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDFVTNIGD 604
            G I+ A+K +   +HP ++ Y+ + E      + TE+V PL++ L +++D          GL  IL  L+FL      +H  I   SI+V +SG W++  F++V    D
Sbjct:   63 GPIERAIKNLMVYRHPYILKYIATWEKSGRKYLATERVRPLDEVLAQQTD-----IEVCLGLRTILCALIFLVEKALARHLNINTQSIYVTESGSWRLAGFEYVWRATD 166          
BLAST of N terminal kinase protein like vs. Ensembl Fly
Match: CG1344 (gene:FBgn0027507 transcript:FBtr0331967)

HSP 1 Score: 62.3882 bits (150), Expect = 1.025e-9
Identity = 33/109 (30.28%), Postives = 56/109 (51.38%), Query Frame = 2
Query:  278 GTIQNALKKMKTLKHPDLISYVDSNESIKEVQIVTEKVVPLEKYLREKSDSSNFSFVASWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDFVTNIGD 604
            G I+ A+K +   +HP ++ Y+ + E      + TE+V PL++ L +++D          GL  IL  L+FL      +H  I   SI+V +SG W++  F++V    D
Sbjct:   63 GPIERAIKNLMVYRHPYILKYIATWEKSGRKYLATERVRPLDEVLAQQTD-----IEVCLGLRTILCALIFLVEKALARHLNINTQSIYVTESGSWRLAGFEYVWRATD 166          
BLAST of N terminal kinase protein like vs. Ensembl Fly
Match: CG1951 (gene:FBgn0039623 transcript:FBtr0085342)

HSP 1 Score: 58.151 bits (139), Expect = 2.872e-8
Identity = 79/334 (23.65%), Postives = 140/334 (41.92%), Query Frame = 2
Query:  161 CENEIKLLNGWILSNAVNKKG-EEFSVFLRDISSIDNLSKG-------TIQNALKKMKTLKHPDLISYVDS-NESIKEVQIVTEKV-VPLEKYLRE--KSDSSNFSFVASWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDF-VTN--IGDDLP-----------SSVVQTDLYWPMDKSKIDS--------YGFGCLIW--------ETFNQNLSR----KSDLKE-----TSKLPGQLVKLFQRLTHPKPNMRLNLDNALKEMSGPAGFADNFYVKTLLFLXXXXXXXXXXXXXFMASLTDLVDSFPDDIAKYKILPHLL 1009
            C   + L+  W + N   K   +E SVF+ +  S++  SK        T++  ++++  ++HP +++      ES   +   TE V   L   + +  +S+   +      GL Q+  GL FL    KI H  I   +I +NK+  WK+  FDF + N    D  P             + Q  L +   +  ++S        +  G LI+        + F  + S      +DL +      + +P +L +  + L HP  N+R      L E+   A F D   VKTL +L+ +   +   K +F   L  ++ + P  +  + ILP+L+
Sbjct:   38 CTAGVGLM--WKVYNGHKKSTKQEVSVFVFEKKSLERWSKDDRETMLETLRRGVQQLTKIRHPHVLTVQHPLEESRDSLAFATEPVFASLANVVGDNVRSEKKLYDVEIRHGLLQLFDGLQFLHQDAKIVHRNISAETIVINKNRSWKLFGFDFCIANQPATDGTPHWPFREYTTSLHVLAQPSLEYTAPELALNSVNTPDSDLFSLGVLIFTIYAGKPLKMFGSDYSSFRRYANDLNQRKYPPMNAVPSELTESLKALLHPSANLR----PKLHELKQIAYFQD-VGVKTLSYLDSLYQWDNLQKSKFYKGLPQIIPTLPHRVNLHSILPYLV 364          
BLAST of N terminal kinase protein like vs. Ensembl Zebrafish
Match: scyl1 (SCY1-like, kinase-like 1 [Source:ZFIN;Acc:ZDB-GENE-030131-8915])

HSP 1 Score: 364.385 bits (934), Expect = 1.231e-113
Identity = 232/578 (40.14%), Postives = 337/578 (58.30%), Query Frame = 2
Query:  110 MW-LFSKDSSVNFPYSRSCENEIKLLNG-WILSNAVNKK-GEEFSVFLRDISSIDNLSKGTIQNALKKMKTLKHPDLISYVDSNESIKEVQIVTEKVVPLEKYLR---EKSDSSNFSFVASWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDFVTN-IGDDL---PSSVVQTDL--YWP-------MDKSKIDSYGFGCLIWETFNQNLSRKSDLKETSKLPGQLVKLFQRLTHPKPNMRLNLDNALKEMSGPAGFADNFYVKTLLFLXXXXXXXXXXXXXFMASLTDLVDSFPDDIAKYKILPHLLMCHQFGGAGIEXXXXXXXXXXXXEASEFETSVVPRLVAMFRSSNRTTRVRLLEQLPTFVDVLPFKVVDMDIFPAVVLGLADTNPIVREATIRAVVHLAPKLSHKNLNEILINHLMNLQLKDEQGGIRTNATVCLAKIAHLLATQIRQTSLLNVLLKCTRDPFVPAKXXXXXXXXXXQHLFLVNDVATKLLPCLSFLTVDPEKEVREQTFKALDFALSRLKEASQNPENNKIEPLE------NKEAQKLIGWKNWAVSFI 1768
            MW  F++D   +F Y    EN+ K  +G W LS    K  GE  SVF+ ++S          + A K+ KTL+HP+++SYVD  E+ K + IVTE V PL  +L+   EK  +S+     SWGL QI++ L FL + C + HN + + ++FV+++G+WK+G  D VT+  GD +   P  V+  DL  Y P        +K   D +  GCLIWE FN +L R S L+   K+P QLV  +  L    P +R N    L     P GF +N +V++ LFLEEIQIKE  +KQQF   L++ +DSFP+D  K+K+LP LL   +FG AG  VL PL K+GK L A E++  ++P +V MF S++R  R+RLL+Q+  F+  L    V+  IFP VV G  DTNP +RE T+++++ LAPKL+  NLN+ L+ H   LQ +D+QG IR N TVCL KIA  L   +RQ  L++   + T+DPF  ++ + V    A+   + V + A ++LP L  LTVDP+K VR+Q FKA+   LS+L+  S++P  +K+  +E       +       W  WAV+ +
Sbjct:    1 MWSFFARDPIKDFNYELLPENQEK--SGIWTLSRGKRKSTGEPVSVFVYEVSQGTEEQTQLAKAAFKRTKTLRHPNILSYVDGLETEKSLYIVTEPVTPLAAHLKLQAEKGGASDLEV--SWGLHQIVKALSFLVNDCHLNHNNLGMWAVFVDRAGEWKLGGLDHVTSEQGDSITLPPPKVINPDLERYDPPESPNSGGEKWTGDVWRLGCLIWEVFNGSLPRASSLRSLGKIPKQLVPHYCELVGANPKIRPNPARFLLNCRSPGGFMNNSFVESCLFLEEIQIKEPAEKQQFFQDLSENLDSFPEDFCKHKVLPQLLTAFEFGNAGAVVLTPLFKVGKYLSAEEYQQKIIPVIVKMFSSTDRAMRIRLLQQMEQFIQYLNEAAVNSQIFPHVVHGFTDTNPAIREQTVKSMLLLAPKLNETNLNQELMRHFARLQARDDQGPIRCNTTVCLGKIAPYLNAGMRQRVLISAFSRATKDPFPASRAAGVLGFAATHQYYSVAESANRILPTLCTLTVDPDKNVRDQAFKAIKSFLSKLETVSEDP--SKLTEIEKDVTAAGQTGGSAATWAGWAVTGV 572          
BLAST of N terminal kinase protein like vs. Ensembl Zebrafish
Match: scyl3 (SCY1-like, kinase-like 3 [Source:ZFIN;Acc:ZDB-GENE-030131-2559])

HSP 1 Score: 72.0182 bits (175), Expect = 2.094e-14
Identity = 43/140 (30.71%), Postives = 74/140 (52.86%), Query Frame = 2
Query:  173 IKLLNGWILSNAVNKKGEEFSVFLRDISSIDNLSKGTIQNALKKMKTLKHPDLISYVDSNESIKEVQIVTEKVVPLEKYLREKSDSSNFSFVASWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDFVT 592
            + L +G  + +A+ + G+  SVF+    + D ++K     A K +KTL+HP L+ ++  +     + +VTE V PL++ L   S           GL+ +L+ LVFL    K  HN + ++S+FV + G WK+G  + V 
Sbjct:   18 LTLPSGLTMFSALLRDGKPASVFVHKQDNEDKVNK-----AAKHLKTLRHPCLLRFLSCSVQDGGIHLVTEPVQPLKRLLDNLSAEE-----ICAGLYDLLQALVFLHDRGKSSHNNVCISSVFVGEDGHWKLGGMETVC 147          
BLAST of N terminal kinase protein like vs. Ensembl Zebrafish
Match: scyl3 (SCY1-like, kinase-like 3 [Source:ZFIN;Acc:ZDB-GENE-030131-2559])

HSP 1 Score: 72.7886 bits (177), Expect = 8.689e-13
Identity = 93/384 (24.22%), Postives = 164/384 (42.71%), Query Frame = 2
Query:  173 IKLLNGWILSNAVNKKGEEFSVFLRDISSIDNLSKGTIQNALKKMKTLKHPDLISYVDSNESIKEVQIVTEKVVPLEKYLREKSDSSNFSFVASWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDFVTNIGDDLPS------SVVQTDLYWPMDK------------SKIDSYGFGCLIWETFNQNLSRKSDLKETSKLPGQLVKLFQ-RLTHPKPNMRLNLDNALKEMSGPAGFADNFYVKTLLFLXXXXXXXXXXXXXFMASLTDLVDSFPDDIAKYKI-------------------LPHLLMCHQFGG--AGIEXXXXXXXXXXXXEASEFETSVVPRLVAMFRSSNRTTRVRLLEQLPTFVDVLPFK 1204
            + L +G  + +A+ + G+  SVF+    + D ++K     A K +KTL+HP L+ ++  +     + +VTE V PL++ L    D+ +   + + GL+ +L+ LVFL    K  HN + ++S+FV + G WK+G  + V    +  P       +V +     P +K               D++ FG ++           SD      L   L  + Q  L  P    R +L   L        F  N ++  + FL+ + +K +E+K +F   L D V + P+++   ++                   LPHLL   Q     AG E LL L         S +   VVP L+ +++ +    R+ LL  +  + +  P +
Sbjct:   18 LTLPSGLTMFSALLRDGKPASVFVHKQDNEDKVNK-----AAKHLKTLRHPCLLRFLSCSVQDGGIHLVTEPVQPLKRLL----DNLSAEEICA-GLYDLLQALVFLHDRGKSSHNNVCISSVFVGEDGHWKLGGMETVCKFSEATPEFLKSIQNVRENGAIPPEEKLEGFKTLPEKHAHSRDAFSFGVMVEALLPLLTGHVSD-----DLLVSLKNMLQASLLTPDHKSRPSLSTLLTH-----NFFRNDFLDIMNFLKSLTLKNEEEKNEFFKFLLDRVQNLPEELIATRLAPKLLNSLVFAEPMAVKSFLPHLLQPKQDSSVNAGEECLLSL---------SLYRRYVVPHLLKLYKVNEEHVRMVLLSHIHVYAEFFPLE 372          
BLAST of N terminal kinase protein like vs. Ensembl Zebrafish
Match: SCYL2 (si:ch211-244b2.1 [Source:ZFIN;Acc:ZDB-GENE-041210-205])

HSP 1 Score: 57.3806 bits (137), Expect = 5.569e-8
Identity = 79/336 (23.51%), Postives = 132/336 (39.29%), Query Frame = 2
Query:  191 WILSNAVNKKG-EEFSVFLRDISSIDNLSK-------GTIQNALKKMKTLKHPDLISYVDSNESIKE-VQIVTEKV-VPLEKYLRE--------KSDSSNFSFV---ASWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDF---VTNIGDDLPSSVVQ------TDLYWPMDK-------------SKIDSYGFGCLIWETFNQ--------------NLSRKSDLKET------SKLPGQLVKLFQRLTHPKPNMRLNLDNALKEMSGPAGFADNFYVKTLLFLXXXXXXXXXXXXXFMASLTDLVDSFPDDIAKYKILPHLL 1009
            W + N   K   +E +VF+ D   ID   K        +++  ++++  L+HP L++     E  ++ +   TE V   L   L +         +D  ++        +GL Q+  GL FL S  K+ H  +   +I +NKSG WK+  FDF    +N  D  P  V +        L  P  +             S  D Y  G LI   FN+              + SR+ D          S++P ++ +  + L     N+R + D   K       F D+    TL + + +  ++   K QF   L  ++   P  +  Y+ILP L+
Sbjct:   47 WRIYNGTKKSTKQEVAVFVFDKKVIDRYQKFEKDQIIDSLKKGIQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGQWDNLPSPVPTDIKDYKLYDVETKYGLLQVSEGLSFLHSGVKMVHGNLCSENIILNKSGAWKIMGFDFSISSSNPSDAEPKYVCKEWDPNLPPLCLPNPEYVAPEYILSVSCDSASDMYSLGVLIHAVFNEGKPVFKVNKQDIFKSFSRQLDQLSHLSPGVLSQIPEEVRQHVKMLLSVTSNVRPDADQMTK-----IPFFDDVGAMTLQYFDSLFQRDNLQKSQFFKGLPKVLPKLPKRVVVYRILPALM 377          
BLAST of N terminal kinase protein like vs. Ensembl Zebrafish
Match: SCYL2 (si:ch211-244b2.1 [Source:ZFIN;Acc:ZDB-GENE-041210-205])

HSP 1 Score: 57.3806 bits (137), Expect = 5.569e-8
Identity = 79/336 (23.51%), Postives = 132/336 (39.29%), Query Frame = 2
Query:  191 WILSNAVNKKG-EEFSVFLRDISSIDNLSK-------GTIQNALKKMKTLKHPDLISYVDSNESIKE-VQIVTEKV-VPLEKYLRE--------KSDSSNFSFV---ASWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDF---VTNIGDDLPSSVVQ------TDLYWPMDK-------------SKIDSYGFGCLIWETFNQ--------------NLSRKSDLKET------SKLPGQLVKLFQRLTHPKPNMRLNLDNALKEMSGPAGFADNFYVKTLLFLXXXXXXXXXXXXXFMASLTDLVDSFPDDIAKYKILPHLL 1009
            W + N   K   +E +VF+ D   ID   K        +++  ++++  L+HP L++     E  ++ +   TE V   L   L +         +D  ++        +GL Q+  GL FL S  K+ H  +   +I +NKSG WK+  FDF    +N  D  P  V +        L  P  +             S  D Y  G LI   FN+              + SR+ D          S++P ++ +  + L     N+R + D   K       F D+    TL + + +  ++   K QF   L  ++   P  +  Y+ILP L+
Sbjct:   47 WRIYNGTKKSTKQEVAVFVFDKKVIDRYQKFEKDQIIDSLKKGIQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGQWDNLPSPVPTDIKDYKLYDVETKYGLLQVSEGLSFLHSGVKMVHGNLCSENIILNKSGAWKIMGFDFSISSSNPSDAEPKYVCKEWDPNLPPLCLPNPEYVAPEYILSVSCDSASDMYSLGVLIHAVFNEGKPVFKVNKQDIFKSFSRQLDQLSHLSPGVLSQIPEEVRQHVKMLLSVTSNVRPDADQMTK-----IPFFDDVGAMTLQYFDSLFQRDNLQKSQFFKGLPKVLPKLPKRVVVYRILPALM 377          
BLAST of N terminal kinase protein like vs. Ensembl Xenopus
Match: scyl1 (SCY1-like, kinase-like 1 [Source:NCBI gene;Acc:548903])

HSP 1 Score: 375.555 bits (963), Expect = 2.786e-118
Identity = 228/573 (39.79%), Postives = 335/573 (58.46%), Query Frame = 2
Query:  110 MWLFSKDSSVNFPYSRSCENEIKLLNGWILSNAVNK-KGEEFSVFLRDISSIDNLSKGTIQNALKKMKTLKHPDLISYVDSNESIKEVQIVTEKVVPLEKYLREKSDSSNFSFVA-SWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDFVTNIG--DDLPSSVVQTDLYWP---MDKSKI-------DSYGFGCLIWETFNQNLSRKSDLKETSKLPGQLVKLFQRLTHPKPNMRLNLDNALKEMSGPAGFADNFYVKTLLFLXXXXXXXXXXXXXFMASLTDLVDSFPDDIAKYKILPHLLMCHQFGGAGIEXXXXXXXXXXXXEASEFETSVVPRLVAMFRSSNRTTRVRLLEQLPTFVDVLPFKVVDMDIFPAVVLGLADTNPIVREATIRAVVHLAPKLSHKNLNEILINHLMNLQLKDEQGGIRTNATVCLAKIAHLLATQIRQTSLLNVLLKCTRDPFVPAKXXXXXXXXXXQHLFLVNDVATKLLPCLSFLTVDPEKEVREQTFKALDFALSRLKEASQNPENNKIEPLENKEAQKLI------GWKNWAVSFI 1768
            MW +S+D + +FPY  + E E +L  GW +     K  G+  SVF  +I           + ALK++KTLKHP+++SYVD  E+ K + IVTE V PL  Y++ ++DS   S +  SWGL QI++ L FL +   + HN + ++++FV+++G+WK+G  D++   G  D  P   ++ + Y P    D+SK        D +  GCLIWE FN  L R + L+   K+P  LV  +  L    P +R N    L+    P GF  N +V+T LFLEEIQIK+  +KQ F   L++ +DSFP+D  ++KILP LL   +FG AG  VL PL K+GK L A E++  ++P +V MF S++R  R+RLL+Q+  F+  L    V+  IFP VV G  DTNP +RE T+++++ LAPKL+  NLN  L+ H   LQ +D+QG IR N TVCL KIA  L    RQ  L++   + T+DPF P++ + V    A+ + + + D A K+LP L  +TVDPEK VREQ FKA+   L +L+  S++P  +++  LE       +      GW  WAV+ +
Sbjct:    1 MWFWSRDPARDFPYDVTGERE-ELPAGWGVQKGKKKTGGDAVSVFTYEIRPGAEEQTQAAKTALKRIKTLKHPNILSYVDGLETDKCLYIVTEPVTPLGTYVKLRTDSGGVSELEISWGLHQIVKALSFLVNDGNLIHNNVCMSAVFVDRAGEWKLGGLDYMYTAGAEDTAPLKGIEMEKYNPPEKTDRSKTSKEKWSADMWCLGCLIWEVFNGPLPRPTALRSLGKIPKSLVPHYCELVGANPKVRPNPARFLQNCRSPGGFFCNSFVETNLFLEEIQIKDPAEKQTFFEQLSENLDSFPEDFCRHKILPQLLTAFEFGSAGAVVLPPLFKIGKFLNADEYQQKIIPVVVKMFSSTDRAMRIRLLQQMENFIQYLNEPTVNAQIFPHVVHGFMDTNPAIREQTVKSMLLLAPKLNENNLNMELMKHFARLQARDDQGPIRCNTTVCLGKIAPYLNPATRQRVLISAFSRATKDPFSPSRAAGVLGFAATHNFYSLTDCAGKVLPVLCGVTVDPEKNVREQAFKAIRSFLDKLETVSEDP--SQLAELEKDVHTASVSPSVVGGWAGWAVTGV 570          
BLAST of N terminal kinase protein like vs. Ensembl Xenopus
Match: scyl1 (SCY1-like, kinase-like 1 [Source:NCBI gene;Acc:548903])

HSP 1 Score: 372.859 bits (956), Expect = 3.541e-118
Identity = 229/575 (39.83%), Postives = 336/575 (58.43%), Query Frame = 2
Query:  110 MWLFSKDSSVNFPYSRSCENEIKLLNGWILSNAVNK-KGEEFSVFLRDISSIDNLSKGTIQNALKKMKTLKHPDLISYVDSNESIKEVQIVTEKVVPLEKYLREKSDSSNFSFVA-SWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDFVTNIG--DDLPSSVVQTDLYWP---MDKSKI-------DSYGFGCLIWETFNQNLSRKSDLKETSKLPGQLVKLFQRLTHPKPNMRLNLDNALKEMSGPAGFADNFYVKTLLFLXXXXXXXXXXXXXFMASLTDLVDSFPDDIAKYKILPHLLMCHQFGGAGIEXXXXXXXXXXXXEASEFETSVVPRLVAMFRSSNRTTRVRLLEQLPTFVDVLPFKVVDMDIFPAVVLGLADTNPIVREATIRAVVHLAPKLSHKNLNEILINHLMNLQLKDEQGGIRTNATVCLAKIAHLL--ATQIRQTSLLNVLLKCTRDPFVPAKXXXXXXXXXXQHLFLVNDVATKLLPCLSFLTVDPEKEVREQTFKALDFALSRLKEASQNPENNKIEPLENKEAQKLI------GWKNWAVSFI 1768
            MW +S+D + +FPY  + E E +L  GW +     K  G+  SVF  +I           + ALK++KTLKHP+++SYVD  E+ K + IVTE V PL  Y++ ++DS   S +  SWGL QI++ L FL +   + HN + ++++FV+++G+WK+G  D++   G  D  P   ++ + Y P    D+SK        D +  GCLIWE FN  L R + L+   K+P  LV  +  L    P +R N    L+    P GF  N +V+T LFLEEIQIK+  +KQ F   L++ +DSFP+D  ++KILP LL   +FG AG  VL PL K+GK L A E++  ++P +V MF S++R  R+RLL+Q+  F+  L    V+  IFP VV G  DTNP +RE T+++++ LAPKL+  NLN  L+ H   LQ +D+QG IR N TVCL KIA  L  A   RQ  L++   + T+DPF P++ + V    A+ + + + D A K+LP L  +TVDPEK VREQ FKA+   L +L+  S++P  +++  LE       +      GW  WAV+ +
Sbjct:    1 MWFWSRDPARDFPYDVTGERE-ELPAGWGVQKGKKKTGGDAVSVFTYEIRPGAEEQTQAAKTALKRIKTLKHPNILSYVDGLETDKCLYIVTEPVTPLGTYVKLRTDSGGVSELEISWGLHQIVKALSFLVNDGNLIHNNVCMSAVFVDRAGEWKLGGLDYMYTAGAEDTAPLKGIEMEKYNPPEKTDRSKTSKEKWSADMWCLGCLIWEVFNGPLPRPTALRSLGKIPKSLVPHYCELVGANPKVRPNPARFLQNCRSPGGFFCNSFVETNLFLEEIQIKDPAEKQTFFEQLSENLDSFPEDFCRHKILPQLLTAFEFGSAGAVVLPPLFKIGKFLNADEYQQKIIPVVVKMFSSTDRAMRIRLLQQMENFIQYLNEPTVNAQIFPHVVHGFMDTNPAIREQTVKSMLLLAPKLNENNLNMELMKHFARLQARDDQGPIRCNTTVCLGKIAPYLNPAVSTRQRVLISAFSRATKDPFSPSRAAGVLGFAATHNFYSLTDCAGKVLPVLCGVTVDPEKNVREQAFKAIRSFLDKLETVSEDP--SQLAELEKDVHTASVSPSVVGGWAGWAVTGV 572          
BLAST of N terminal kinase protein like vs. Ensembl Xenopus
Match: scyl1 (SCY1-like, kinase-like 1 [Source:NCBI gene;Acc:548903])

HSP 1 Score: 375.17 bits (962), Expect = 6.451e-118
Identity = 228/573 (39.79%), Postives = 335/573 (58.46%), Query Frame = 2
Query:  110 MWLFSKDSSVNFPYSRSCENEIKLLNGWILSNAVNK-KGEEFSVFLRDISSIDNLSKGTIQNALKKMKTLKHPDLISYVDSNESIKEVQIVTEKVVPLEKYLREKSDSSNFSFVA-SWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDFVTNIG--DDLPSSVVQTDLYWP---MDKSKI-------DSYGFGCLIWETFNQNLSRKSDLKETSKLPGQLVKLFQRLTHPKPNMRLNLDNALKEMSGPAGFADNFYVKTLLFLXXXXXXXXXXXXXFMASLTDLVDSFPDDIAKYKILPHLLMCHQFGGAGIEXXXXXXXXXXXXEASEFETSVVPRLVAMFRSSNRTTRVRLLEQLPTFVDVLPFKVVDMDIFPAVVLGLADTNPIVREATIRAVVHLAPKLSHKNLNEILINHLMNLQLKDEQGGIRTNATVCLAKIAHLLATQIRQTSLLNVLLKCTRDPFVPAKXXXXXXXXXXQHLFLVNDVATKLLPCLSFLTVDPEKEVREQTFKALDFALSRLKEASQNPENNKIEPLENKEAQKLI------GWKNWAVSFI 1768
            MW +S+D + +FPY  + E E +L  GW +     K  G+  SVF  +I           + ALK++KTLKHP+++SYVD  E+ K + IVTE V PL  Y++ ++DS   S +  SWGL QI++ L FL +   + HN + ++++FV+++G+WK+G  D++   G  D  P   ++ + Y P    D+SK        D +  GCLIWE FN  L R + L+   K+P  LV  +  L    P +R N    L+    P GF  N +V+T LFLEEIQIK+  +KQ F   L++ +DSFP+D  ++KILP LL   +FG AG  VL PL K+GK L A E++  ++P +V MF S++R  R+RLL+Q+  F+  L    V+  IFP VV G  DTNP +RE T+++++ LAPKL+  NLN  L+ H   LQ +D+QG IR N TVCL KIA  L    RQ  L++   + T+DPF P++ + V    A+ + + + D A K+LP L  +TVDPEK VREQ FKA+   L +L+  S++P  +++  LE       +      GW  WAV+ +
Sbjct:    1 MWFWSRDPARDFPYDVTGERE-ELPAGWGVQKGKKKTGGDAVSVFTYEIRPGAEEQTQAAKTALKRIKTLKHPNILSYVDGLETDKCLYIVTEPVTPLGTYVKLRTDSGGVSELEISWGLHQIVKALSFLVNDGNLIHNNVCMSAVFVDRAGEWKLGGLDYMYTAGAEDTAPLKGIEMEKYNPPEKTDRSKTSKEKWSADMWCLGCLIWEVFNGPLPRPTALRSLGKIPKSLVPHYCELVGANPKVRPNPARFLQNCRSPGGFFCNSFVETNLFLEEIQIKDPAEKQTFFEQLSENLDSFPEDFCRHKILPQLLTAFEFGSAGAVVLPPLFKIGKFLNADEYQQKIIPVVVKMFSSTDRAMRIRLLQQMENFIQYLNEPTVNAQIFPHVVHGFMDTNPAIREQTVKSMLLLAPKLNENNLNMELMKHFARLQARDDQGPIRCNTTVCLGKIAPYLNPATRQRVLISAFSRATKDPFSPSRAAGVLGFAATHNFYSLTDCAGKVLPVLCGVTVDPEKNVREQAFKAIRSFLDKLETVSEDP--SQLAELEKDVHTASVSPSVVGGWAGWAVTGV 570          
BLAST of N terminal kinase protein like vs. Ensembl Xenopus
Match: scyl1 (SCY1-like, kinase-like 1 [Source:NCBI gene;Acc:548903])

HSP 1 Score: 374.4 bits (960), Expect = 1.372e-117
Identity = 228/573 (39.79%), Postives = 335/573 (58.46%), Query Frame = 2
Query:  110 MWLFSKDSSVNFPYSRSCENEIKLLNGWILSNAVNK-KGEEFSVFLRDISSIDNLSKGTIQNALKKMKTLKHPDLISYVDSNESIKEVQIVTEKVVPLEKYLREKSDSSNFSFVA-SWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDFVTNIG--DDLPSSVVQTDLYWP---MDKSKI-------DSYGFGCLIWETFNQNLSRKSDLKETSKLPGQLVKLFQRLTHPKPNMRLNLDNALKEMSGPAGFADNFYVKTLLFLXXXXXXXXXXXXXFMASLTDLVDSFPDDIAKYKILPHLLMCHQFGGAGIEXXXXXXXXXXXXEASEFETSVVPRLVAMFRSSNRTTRVRLLEQLPTFVDVLPFKVVDMDIFPAVVLGLADTNPIVREATIRAVVHLAPKLSHKNLNEILINHLMNLQLKDEQGGIRTNATVCLAKIAHLLATQIRQTSLLNVLLKCTRDPFVPAKXXXXXXXXXXQHLFLVNDVATKLLPCLSFLTVDPEKEVREQTFKALDFALSRLKEASQNPENNKIEPLENKEAQKLI------GWKNWAVSFI 1768
            MW +S+D + +FPY  + E E +L  GW +     K  G+  SVF  +I           + ALK++KTLKHP+++SYVD  E+ K + IVTE V PL  Y++ ++DS   S +  SWGL QI++ L FL +   + HN + ++++FV+++G+WK+G  D++   G  D  P   ++ + Y P    D+SK        D +  GCLIWE FN  L R + L+   K+P  LV  +  L    P +R N    L+    P GF  N +V+T LFLEEIQIK+  +KQ F   L++ +DSFP+D  ++KILP LL   +FG AG  VL PL K+GK L A E++  ++P +V MF S++R  R+RLL+Q+  F+  L    V+  IFP VV G  DTNP +RE T+++++ LAPKL+  NLN  L+ H   LQ +D+QG IR N TVCL KIA  L    RQ  L++   + T+DPF P++ + V    A+ + + + D A K+LP L  +TVDPEK VREQ FKA+   L +L+  S++P  +++  LE       +      GW  WAV+ +
Sbjct:    1 MWFWSRDPARDFPYDVTGERE-ELPAGWGVQKGKKKTGGDAVSVFTYEIRPGAEEQTQAAKTALKRIKTLKHPNILSYVDGLETDKCLYIVTEPVTPLGTYVKLRTDSGGVSELEISWGLHQIVKALSFLVNDGNLIHNNVCMSAVFVDRAGEWKLGGLDYMYTAGAEDTAPLKGIEMEKYNPPEKTDRSKTSKEKWSADMWCLGCLIWEVFNGPLPRPTALRSLGKIPKSLVPHYCELVGANPKVRPNPARFLQNCRSPGGFFCNSFVETNLFLEEIQIKDPAEKQTFFEQLSENLDSFPEDFCRHKILPQLLTAFEFGSAGAVVLPPLFKIGKFLNADEYQQKIIPVVVKMFSSTDRAMRIRLLQQMENFIQYLNEPTVNAQIFPHVVHGFMDTNPAIREQTVKSMLLLAPKLNENNLNMELMKHFARLQARDDQGPIRCNTTVCLGKIAPYLNPATRQRVLISAFSRATKDPFSPSRAAGVLGFAATHNFYSLTDCAGKVLPVLCGVTVDPEKNVREQAFKAIRSFLDKLETVSEDP--SQLAELEKDVHTASVSPSVVGGWAGWAVTGV 570          
BLAST of N terminal kinase protein like vs. Ensembl Xenopus
Match: scyl1 (SCY1-like, kinase-like 1 [Source:NCBI gene;Acc:548903])

HSP 1 Score: 367.851 bits (943), Expect = 1.123e-116
Identity = 222/542 (40.96%), Postives = 323/542 (59.59%), Query Frame = 2
Query:  110 MWLFSKDSSVNFPYSRSCENEIKLLNGWILSNAVNK-KGEEFSVFLRDISSIDNLSKGTIQNALKKMKTLKHPDLISYVDSNESIKEVQIVTEKVVPLEKYLREKSDSSNFSFVA-SWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDFVTNIG--DDLPSSVVQTDLYWP---MDKSKI-------DSYGFGCLIWETFNQNLSRKSDLKETSKLPGQLVKLFQRLTHPKPNMRLNLDNALKEMSGPAGFADNFYVKTLLFLXXXXXXXXXXXXXFMASLTDLVDSFPDDIAKYKILPHLLMCHQFGGAGIEXXXXXXXXXXXXEASEFETSVVPRLVAMFRSSNRTTRVRLLEQLPTFVDVLPFKVVDMDIFPAVVLGLADTNPIVREATIRAVVHLAPKLSHKNLNEILINHLMNLQLKDEQGGIRTNATVCLAKIAHLL--ATQIRQTSLLNVLLKCTRDPFVPAKXXXXXXXXXXQHLFLVNDVATKLLPCLSFLTVDPEKEVREQTFKALDFALSRLKEASQNP 1687
            MW +S+D + +FPY  + E E +L  GW +     K  G+  SVF  +I           + ALK++KTLKHP+++SYVD  E+ K + IVTE V PL  Y++ ++DS   S +  SWGL QI++ L FL +   + HN + ++++FV+++G+WK+G  D++   G  D  P   ++ + Y P    D+SK        D +  GCLIWE FN  L R + L+   K+P  LV  +  L    P +R N    L+    P GF  N +V+T LFLEEIQIK+  +KQ F   L++ +DSFP+D  ++KILP LL   +FG AG  VL PL K+GK L A E++  ++P +V MF S++R  R+RLL+Q+  F+  L    V+  IFP VV G  DTNP +RE T+++++ LAPKL+  NLN  L+ H   LQ +D+QG IR N TVCL KIA  L  A   RQ  L++   + T+DPF P++ + V    A+ + + + D A K+LP L  +TVDPEK VREQ FKA+   L +L+  S++P
Sbjct:    1 MWFWSRDPARDFPYDVTGERE-ELPAGWGVQKGKKKTGGDAVSVFTYEIRPGAEEQTQAAKTALKRIKTLKHPNILSYVDGLETDKCLYIVTEPVTPLGTYVKLRTDSGGVSELEISWGLHQIVKALSFLVNDGNLIHNNVCMSAVFVDRAGEWKLGGLDYMYTAGAEDTAPLKGIEMEKYNPPEKTDRSKTSKEKWSADMWCLGCLIWEVFNGPLPRPTALRSLGKIPKSLVPHYCELVGANPKVRPNPARFLQNCRSPGGFFCNSFVETNLFLEEIQIKDPAEKQTFFEQLSENLDSFPEDFCRHKILPQLLTAFEFGSAGAVVLPPLFKIGKFLNADEYQQKIIPVVVKMFSSTDRAMRIRLLQQMENFIQYLNEPTVNAQIFPHVVHGFMDTNPAIREQTVKSMLLLAPKLNENNLNMELMKHFARLQARDDQGPIRCNTTVCLGKIAPYLNPAVSTRQRVLISAFSRATKDPFSPSRAAGVLGFAATHNFYSLTDCAGKVLPVLCGVTVDPEKNVREQAFKAIRSFLDKLETVSEDP 541          
BLAST of N terminal kinase protein like vs. Ensembl Mouse
Match: Scyl1 (SCY1-like 1 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1931787])

HSP 1 Score: 358.607 bits (919), Expect = 1.809e-112
Identity = 211/544 (38.79%), Postives = 314/544 (57.72%), Query Frame = 2
Query:  110 MWLFSKDSSVNFPYSRSCENEIKLLNG-WILSNAVNKK-GEEFSVFLRDISSIDNLSKGTIQNALKKMKTLKHPDLISYVDSNESIKEVQIVTEKVVPLEKYLREKSDSSNFSFVA-SWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDFV----TNIGDDLPSSVVQTDLYWP-----------MDKSKIDSYGFGCLIWETFNQNLSRKSDLKETSKLPGQLVKLFQRLTHPKPNMRLNLDNALKEMSGPAGFADNFYVKTLLFLXXXXXXXXXXXXXFMASLTDLVDSFPDDIAKYKILPHLLMCHQFGGAGIEXXXXXXXXXXXXEASEFETSVVPRLVAMFRSSNRTTRVRLLEQLPTFVDVLPFKVVDMDIFPAVVLGLADTNPIVREATIRAVVHLAPKLSHKNLNEILINHLMNLQLKDEQGGIRTNATVCLAKIAHLLATQIRQTSLLNVLLKCTRDPFVPAKXXXXXXXXXXQHLFLVNDVATKLLPCLSFLTVDPEKEVREQTFKALDFALSRLKEASQNP 1687
            MW F++D   +FP+  S E       G WIL     K  G   S+F+ D+           + A K++KTL+HP++++Y+D  E+ K + IVTE V PL  YL+ ++++        SWGL QI++ L FL + C + HN + + ++FV+++G+WK+G  D++     N G      + + + Y P            +K   D +  GCLIWE FN +L R + L+   K+P  LV  +  L    P +R N    L+    P GF  N +V+T LFLEEIQIKE  +KQ+F   L+  +DSFP+D  ++K+LP LL   +FG AG  VL PL K+GK L A E++  ++P +V MF S++R  R+RLL+Q+  F+  L    V+  IFP V  G  DTNP +RE T+++++ LAPKL+  NLN  L+ H   LQ KD+QG IR N TVCL KI   L+   R   L +   + T+DPF P++++ V    A+ +L+ ++D A K+LP L  LTVDPEK VR+Q FK +   LS+L+  S++P
Sbjct:    1 MWFFARDPVRDFPFELSPEPPEGGPPGPWILHRGRKKATGSAVSIFVYDVKPGAEEQTQVAKAAFKRLKTLRHPNILAYIDGLETEKCLHIVTEAVTPLGTYLKARAEAGGLKEQELSWGLHQIVKALSFLVNDCNLIHNNVCMAAVFVDRAGEWKLGGLDYMYSAQGNGGGPPSKGIPELEQYDPPELADSSSRAVREKWSADMWRLGCLIWEVFNGSLPRAAALRNPGKIPKSLVTHYCELVGANPKVRPNPARFLQNCRAPGGFMSNRFVETNLFLEEIQIKEPAEKQKFFQELSKSLDSFPEDFCRHKVLPQLLTAFEFGNAGAVVLTPLFKVGKSLRAEEYQEKIIPVVVKMFSSTDRAMRIRLLQQMEQFIQYLDEPTVNTQIFPHVTHGFLDTNPAIREQTVKSMLLLAPKLNEANLNVELMKHFARLQAKDDQGPIRCNTTVCLGKIGSYLSASTRHRVLTSAFSRATKDPFAPSRVAGVLGFAATHNLYSMDDCAHKILPVLCGLTVDPEKSVRDQAFKTIRSFLSKLESVSEDP 544          
BLAST of N terminal kinase protein like vs. Ensembl Mouse
Match: Scyl1 (SCY1-like 1 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1931787])

HSP 1 Score: 358.607 bits (919), Expect = 3.440e-112
Identity = 211/544 (38.79%), Postives = 314/544 (57.72%), Query Frame = 2
Query:  110 MWLFSKDSSVNFPYSRSCENEIKLLNG-WILSNAVNKK-GEEFSVFLRDISSIDNLSKGTIQNALKKMKTLKHPDLISYVDSNESIKEVQIVTEKVVPLEKYLREKSDSSNFSFVA-SWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDFV----TNIGDDLPSSVVQTDLYWP-----------MDKSKIDSYGFGCLIWETFNQNLSRKSDLKETSKLPGQLVKLFQRLTHPKPNMRLNLDNALKEMSGPAGFADNFYVKTLLFLXXXXXXXXXXXXXFMASLTDLVDSFPDDIAKYKILPHLLMCHQFGGAGIEXXXXXXXXXXXXEASEFETSVVPRLVAMFRSSNRTTRVRLLEQLPTFVDVLPFKVVDMDIFPAVVLGLADTNPIVREATIRAVVHLAPKLSHKNLNEILINHLMNLQLKDEQGGIRTNATVCLAKIAHLLATQIRQTSLLNVLLKCTRDPFVPAKXXXXXXXXXXQHLFLVNDVATKLLPCLSFLTVDPEKEVREQTFKALDFALSRLKEASQNP 1687
            MW F++D   +FP+  S E       G WIL     K  G   S+F+ D+           + A K++KTL+HP++++Y+D  E+ K + IVTE V PL  YL+ ++++        SWGL QI++ L FL + C + HN + + ++FV+++G+WK+G  D++     N G      + + + Y P            +K   D +  GCLIWE FN +L R + L+   K+P  LV  +  L    P +R N    L+    P GF  N +V+T LFLEEIQIKE  +KQ+F   L+  +DSFP+D  ++K+LP LL   +FG AG  VL PL K+GK L A E++  ++P +V MF S++R  R+RLL+Q+  F+  L    V+  IFP V  G  DTNP +RE T+++++ LAPKL+  NLN  L+ H   LQ KD+QG IR N TVCL KI   L+   R   L +   + T+DPF P++++ V    A+ +L+ ++D A K+LP L  LTVDPEK VR+Q FK +   LS+L+  S++P
Sbjct:    1 MWFFARDPVRDFPFELSPEPPEGGPPGPWILHRGRKKATGSAVSIFVYDVKPGAEEQTQVAKAAFKRLKTLRHPNILAYIDGLETEKCLHIVTEAVTPLGTYLKARAEAGGLKEQELSWGLHQIVKALSFLVNDCNLIHNNVCMAAVFVDRAGEWKLGGLDYMYSAQGNGGGPPSKGIPELEQYDPPELADSSSRAVREKWSADMWRLGCLIWEVFNGSLPRAAALRNPGKIPKSLVTHYCELVGANPKVRPNPARFLQNCRAPGGFMSNRFVETNLFLEEIQIKEPAEKQKFFQELSKSLDSFPEDFCRHKVLPQLLTAFEFGNAGAVVLTPLFKVGKSLRAEEYQEKIIPVVVKMFSSTDRAMRIRLLQQMEQFIQYLDEPTVNTQIFPHVTHGFLDTNPAIREQTVKSMLLLAPKLNEANLNVELMKHFARLQAKDDQGPIRCNTTVCLGKIGSYLSASTRHRVLTSAFSRATKDPFAPSRVAGVLGFAATHNLYSMDDCAHKILPVLCGLTVDPEKSVRDQAFKTIRSFLSKLESVSEDP 544          
BLAST of N terminal kinase protein like vs. Ensembl Mouse
Match: Scyl1 (SCY1-like 1 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1931787])

HSP 1 Score: 358.607 bits (919), Expect = 4.631e-112
Identity = 211/544 (38.79%), Postives = 314/544 (57.72%), Query Frame = 2
Query:  110 MWLFSKDSSVNFPYSRSCENEIKLLNG-WILSNAVNKK-GEEFSVFLRDISSIDNLSKGTIQNALKKMKTLKHPDLISYVDSNESIKEVQIVTEKVVPLEKYLREKSDSSNFSFVA-SWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDFV----TNIGDDLPSSVVQTDLYWP-----------MDKSKIDSYGFGCLIWETFNQNLSRKSDLKETSKLPGQLVKLFQRLTHPKPNMRLNLDNALKEMSGPAGFADNFYVKTLLFLXXXXXXXXXXXXXFMASLTDLVDSFPDDIAKYKILPHLLMCHQFGGAGIEXXXXXXXXXXXXEASEFETSVVPRLVAMFRSSNRTTRVRLLEQLPTFVDVLPFKVVDMDIFPAVVLGLADTNPIVREATIRAVVHLAPKLSHKNLNEILINHLMNLQLKDEQGGIRTNATVCLAKIAHLLATQIRQTSLLNVLLKCTRDPFVPAKXXXXXXXXXXQHLFLVNDVATKLLPCLSFLTVDPEKEVREQTFKALDFALSRLKEASQNP 1687
            MW F++D   +FP+  S E       G WIL     K  G   S+F+ D+           + A K++KTL+HP++++Y+D  E+ K + IVTE V PL  YL+ ++++        SWGL QI++ L FL + C + HN + + ++FV+++G+WK+G  D++     N G      + + + Y P            +K   D +  GCLIWE FN +L R + L+   K+P  LV  +  L    P +R N    L+    P GF  N +V+T LFLEEIQIKE  +KQ+F   L+  +DSFP+D  ++K+LP LL   +FG AG  VL PL K+GK L A E++  ++P +V MF S++R  R+RLL+Q+  F+  L    V+  IFP V  G  DTNP +RE T+++++ LAPKL+  NLN  L+ H   LQ KD+QG IR N TVCL KI   L+   R   L +   + T+DPF P++++ V    A+ +L+ ++D A K+LP L  LTVDPEK VR+Q FK +   LS+L+  S++P
Sbjct:    1 MWFFARDPVRDFPFELSPEPPEGGPPGPWILHRGRKKATGSAVSIFVYDVKPGAEEQTQVAKAAFKRLKTLRHPNILAYIDGLETEKCLHIVTEAVTPLGTYLKARAEAGGLKEQELSWGLHQIVKALSFLVNDCNLIHNNVCMAAVFVDRAGEWKLGGLDYMYSAQGNGGGPPSKGIPELEQYDPPELADSSSRAVREKWSADMWRLGCLIWEVFNGSLPRAAALRNPGKIPKSLVTHYCELVGANPKVRPNPARFLQNCRAPGGFMSNRFVETNLFLEEIQIKEPAEKQKFFQELSKSLDSFPEDFCRHKVLPQLLTAFEFGNAGAVVLTPLFKVGKSLRAEEYQEKIIPVVVKMFSSTDRAMRIRLLQQMEQFIQYLDEPTVNTQIFPHVTHGFLDTNPAIREQTVKSMLLLAPKLNEANLNVELMKHFARLQAKDDQGPIRCNTTVCLGKIGSYLSASTRHRVLTSAFSRATKDPFAPSRVAGVLGFAATHNLYSMDDCAHKILPVLCGLTVDPEKSVRDQAFKTIRSFLSKLESVSEDP 544          
BLAST of N terminal kinase protein like vs. Ensembl Mouse
Match: Scyl1 (SCY1-like 1 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1931787])

HSP 1 Score: 358.607 bits (919), Expect = 7.561e-112
Identity = 211/544 (38.79%), Postives = 314/544 (57.72%), Query Frame = 2
Query:  110 MWLFSKDSSVNFPYSRSCENEIKLLNG-WILSNAVNKK-GEEFSVFLRDISSIDNLSKGTIQNALKKMKTLKHPDLISYVDSNESIKEVQIVTEKVVPLEKYLREKSDSSNFSFVA-SWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDFV----TNIGDDLPSSVVQTDLYWP-----------MDKSKIDSYGFGCLIWETFNQNLSRKSDLKETSKLPGQLVKLFQRLTHPKPNMRLNLDNALKEMSGPAGFADNFYVKTLLFLXXXXXXXXXXXXXFMASLTDLVDSFPDDIAKYKILPHLLMCHQFGGAGIEXXXXXXXXXXXXEASEFETSVVPRLVAMFRSSNRTTRVRLLEQLPTFVDVLPFKVVDMDIFPAVVLGLADTNPIVREATIRAVVHLAPKLSHKNLNEILINHLMNLQLKDEQGGIRTNATVCLAKIAHLLATQIRQTSLLNVLLKCTRDPFVPAKXXXXXXXXXXQHLFLVNDVATKLLPCLSFLTVDPEKEVREQTFKALDFALSRLKEASQNP 1687
            MW F++D   +FP+  S E       G WIL     K  G   S+F+ D+           + A K++KTL+HP++++Y+D  E+ K + IVTE V PL  YL+ ++++        SWGL QI++ L FL + C + HN + + ++FV+++G+WK+G  D++     N G      + + + Y P            +K   D +  GCLIWE FN +L R + L+   K+P  LV  +  L    P +R N    L+    P GF  N +V+T LFLEEIQIKE  +KQ+F   L+  +DSFP+D  ++K+LP LL   +FG AG  VL PL K+GK L A E++  ++P +V MF S++R  R+RLL+Q+  F+  L    V+  IFP V  G  DTNP +RE T+++++ LAPKL+  NLN  L+ H   LQ KD+QG IR N TVCL KI   L+   R   L +   + T+DPF P++++ V    A+ +L+ ++D A K+LP L  LTVDPEK VR+Q FK +   LS+L+  S++P
Sbjct:    1 MWFFARDPVRDFPFELSPEPPEGGPPGPWILHRGRKKATGSAVSIFVYDVKPGAEEQTQVAKAAFKRLKTLRHPNILAYIDGLETEKCLHIVTEAVTPLGTYLKARAEAGGLKEQELSWGLHQIVKALSFLVNDCNLIHNNVCMAAVFVDRAGEWKLGGLDYMYSAQGNGGGPPSKGIPELEQYDPPELADSSSRAVREKWSADMWRLGCLIWEVFNGSLPRAAALRNPGKIPKSLVTHYCELVGANPKVRPNPARFLQNCRAPGGFMSNRFVETNLFLEEIQIKEPAEKQKFFQELSKSLDSFPEDFCRHKVLPQLLTAFEFGNAGAVVLTPLFKVGKSLRAEEYQEKIIPVVVKMFSSTDRAMRIRLLQQMEQFIQYLDEPTVNTQIFPHVTHGFLDTNPAIREQTVKSMLLLAPKLNEANLNVELMKHFARLQAKDDQGPIRCNTTVCLGKIGSYLSASTRHRVLTSAFSRATKDPFAPSRVAGVLGFAATHNLYSMDDCAHKILPVLCGLTVDPEKSVRDQAFKTIRSFLSKLESVSEDP 544          
BLAST of N terminal kinase protein like vs. Ensembl Mouse
Match: Scyl1 (SCY1-like 1 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1931787])

HSP 1 Score: 143.28 bits (360), Expect = 2.435e-38
Identity = 78/249 (31.33%), Postives = 125/249 (50.20%), Query Frame = 2
Query:  110 MWLFSKDSSVNFPYSRSCENEIKLLNG-WILSNAVNKK-GEEFSVFLRDISSIDNLSKGTIQNALKKMKTLKHPDLISYVDSNESIKEVQIVTEKVVPLEKYLREKSDSSNFSFVA-SWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDFVTNIGDDLPSSVVQTDLYWPMDKSKIDSYGFGCLIWETFNQNLSRKSDLKETSKLPGQLVKLFQRLTHPKPNMRLNLDNALKEMSGP 847
            MW F++D   +FP+  S E       G WIL     K  G   S+F+ D+           + A K++KTL+HP++++Y+D  E+ K + IVTE V PL  YL+ ++++        SWGL QI++ L FL + C + HN + + ++FV+++G+WK+G  D+++                        D +  GCLIWE FN +L R + L+   K+P  LV  +  L    P +R N    L+    P
Sbjct:    1 MWFFARDPVRDFPFELSPEPPEGGPPGPWILHRGRKKATGSAVSIFVYDVKPGAEEQTQVAKAAFKRLKTLRHPNILAYIDGLETEKCLHIVTEAVTPLGTYLKARAEAGGLKEQELSWGLHQIVKALSFLVNDCNLIHNNVCMAAVFVDRAGEWKLGGLDYMS-----------------------ADMWRLGCLIWEVFNGSLPRAAALRNPGKIPKSLVTHYCELVGANPKVRPNPARFLQNCRAP 226          
BLAST of N terminal kinase protein like vs. UniProt/SwissProt
Match: sp|Q28FH2|SCYL1_XENTR (N-terminal kinase-like protein OS=Xenopus tropicalis OX=8364 GN=scyl1 PE=2 SV=1)

HSP 1 Score: 374.4 bits (960), Expect = 7.268e-117
Identity = 228/573 (39.79%), Postives = 335/573 (58.46%), Query Frame = 2
Query:  110 MWLFSKDSSVNFPYSRSCENEIKLLNGWILSNAVNK-KGEEFSVFLRDISSIDNLSKGTIQNALKKMKTLKHPDLISYVDSNESIKEVQIVTEKVVPLEKYLREKSDSSNFSFVA-SWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDFVTNIG--DDLPSSVVQTDLYWP---MDKSKI-------DSYGFGCLIWETFNQNLSRKSDLKETSKLPGQLVKLFQRLTHPKPNMRLNLDNALKEMSGPAGFADNFYVKTLLFLXXXXXXXXXXXXXFMASLTDLVDSFPDDIAKYKILPHLLMCHQFGGAGIEXXXXXXXXXXXXEASEFETSVVPRLVAMFRSSNRTTRVRLLEQLPTFVDVLPFKVVDMDIFPAVVLGLADTNPIVREATIRAVVHLAPKLSHKNLNEILINHLMNLQLKDEQGGIRTNATVCLAKIAHLLATQIRQTSLLNVLLKCTRDPFVPAKXXXXXXXXXXQHLFLVNDVATKLLPCLSFLTVDPEKEVREQTFKALDFALSRLKEASQNPENNKIEPLENKEAQKLI------GWKNWAVSFI 1768
            MW +S+D + +FPY  + E E +L  GW +     K  G+  SVF  +I           + ALK++KTLKHP+++SYVD  E+ K + IVTE V PL  Y++ ++DS   S +  SWGL QI++ L FL +   + HN + ++++FV+++G+WK+G  D++   G  D  P   ++ + Y P    D+SK        D +  GCLIWE FN  L R + L+   K+P  LV  +  L    P +R N    L+    P GF  N +V+T LFLEEIQIK+  +KQ F   L++ +DSFP+D  ++KILP LL   +FG AG  VL PL K+GK L A E++  ++P +V MF S++R  R+RLL+Q+  F+  L    V+  IFP VV G  DTNP +RE T+++++ LAPKL+  NLN  L+ H   LQ +D+QG IR N TVCL KIA  L    RQ  L++   + T+DPF P++ + V    A+ + + + D A K+LP L  +TVDPEK VREQ FKA+   L +L+  S++P  +++  LE       +      GW  WAV+ +
Sbjct:    1 MWFWSRDPARDFPYDVTGERE-ELPAGWGVQKGKKKTGGDAVSVFTYEIRPGAEEQTQAAKTALKRIKTLKHPNILSYVDGLETDKCLYIVTEPVTPLGTYVKLRTDSGGVSELEISWGLHQIVKALSFLVNDGNLIHNNVCMSAVFVDRAGEWKLGGLDYMYTAGAEDTAPLKGIEMEKYNPPEKTDRSKTSKEKWSADMWCLGCLIWEVFNGPLPRPTALRSLGKIPKSLVPHYCELVGANPKVRPNPARFLQNCRSPGGFFCNSFVETNLFLEEIQIKDPAEKQTFFEQLSENLDSFPEDFCRHKILPQLLTAFEFGSAGAVVLPPLFKIGKFLNADEYQQKIIPVVVKMFSSTDRAMRIRLLQQMENFIQYLNEPTVNAQIFPHVVHGFMDTNPAIREQTVKSMLLLAPKLNENNLNMELMKHFARLQARDDQGPIRCNTTVCLGKIAPYLNPATRQRVLISAFSRATKDPFSPSRAAGVLGFAATHNFYSLTDCAGKVLPVLCGVTVDPEKNVREQAFKAIRSFLDKLETVSEDP--SQLAELEKDVHTASVSPSVVGGWAGWAVTGV 570          
BLAST of N terminal kinase protein like vs. UniProt/SwissProt
Match: sp|Q561M0|SCYL1_XENLA (N-terminal kinase-like protein OS=Xenopus laevis OX=8355 GN=scyl1 PE=2 SV=1)

HSP 1 Score: 369.392 bits (947), Expect = 5.769e-115
Identity = 225/573 (39.27%), Postives = 333/573 (58.12%), Query Frame = 2
Query:  110 MWLFSKDSSVNFPYSRSCENEIKLLNGWILSNAVNK-KGEEFSVFLRDISSIDNLSKGTIQNALKKMKTLKHPDLISYVDSNESIKEVQIVTEKVVPLEKYLREKSDSSNFSFVA-SWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDFVTNIGDD--LPSSVVQTDLYWP---MDKSKI-------DSYGFGCLIWETFNQNLSRKSDLKETSKLPGQLVKLFQRLTHPKPNMRLNLDNALKEMSGPAGFADNFYVKTLLFLXXXXXXXXXXXXXFMASLTDLVDSFPDDIAKYKILPHLLMCHQFGGAGIEXXXXXXXXXXXXEASEFETSVVPRLVAMFRSSNRTTRVRLLEQLPTFVDVLPFKVVDMDIFPAVVLGLADTNPIVREATIRAVVHLAPKLSHKNLNEILINHLMNLQLKDEQGGIRTNATVCLAKIAHLLATQIRQTSLLNVLLKCTRDPFVPAKXXXXXXXXXXQHLFLVNDVATKLLPCLSFLTVDPEKEVREQTFKALDFALSRLKEASQNPENNKIEPLE------NKEAQKLIGWKNWAVSFI 1768
            MW +S+D + +FPY  + E E +L  GW +     K  G+  SVF  +I           + A K++KTLKHP+++SYVD  E+ K + IVTE V PLE Y++ ++DS   S +  SWGL QI++ L FL +   + HN + ++++FV+++G+WK+G  D++   G +   P   V+ + Y P    D+SK        D +  GCLIWE FN  L R + L+   K+   LV  +  L    P +R N    L+    P GF  N +V+T LFLEEIQIK+  +KQ F   L++ +DSFP+D  ++KILP LL   +FG AG  VL PL K+GK L A E++  ++P +V MF S++R  R+RLL+Q+  F+  L    V+  IFP VV G  DTNP +RE T+++++ LAPKL+  NLN  L+ H   LQ +D+QG IR N TVCL KIA  L    RQ  L++   + T+DPF P++ + V    A+ + + + D A K+LP L  +T+DPEK VREQ FK +   L +L+  S +P  +++  LE      +     + GW  WAV+ +
Sbjct:    1 MWFWSRDPARDFPYDVTGERE-ELPGGWGIQKGKKKTGGDPVSVFTYEIRPGAEEQTQAAKTASKRIKTLKHPNILSYVDGLETDKCLYIVTEPVTPLETYVKLRTDSGGVSELEISWGLHQIVKALSFLVNDGNLIHNNVCMSAVFVDRAGEWKLGGLDYMYTAGAENTAPRKGVEMEKYNPPEKTDRSKTSKEKWSADMWCLGCLIWEVFNGPLPRPTALRSLGKIAKSLVPHYCELVGANPKIRPNPSRFLQNCRSPGGFFCNSFVETNLFLEEIQIKDPAEKQTFFEQLSENLDSFPEDFCRHKILPQLLTAFEFGSAGAVVLPPLFKIGKFLNADEYQQKIIPVVVKMFSSTDRAMRIRLLQQMENFIQYLNEPTVNAQIFPHVVHGFMDTNPAIREQTVKSMLLLAPKLNENNLNMDLMKHFARLQARDDQGPIRCNTTVCLGKIAPYLNPATRQRVLISAFSRATKDPFAPSRAAGVLGFAATHNFYSMADCAGKVLPVLCGVTLDPEKNVREQAFKTIRSFLDKLETVSGDP--SQLAELEKDVHTASASPSVVGGWAGWAVTGV 570          
BLAST of N terminal kinase protein like vs. UniProt/SwissProt
Match: sp|A6QLH6|SCYL1_BOVIN (N-terminal kinase-like protein OS=Bos taurus OX=9913 GN=SCYL1 PE=2 SV=1)

HSP 1 Score: 363.614 bits (932), Expect = 6.792e-113
Identity = 211/544 (38.79%), Postives = 316/544 (58.09%), Query Frame = 2
Query:  110 MWLFSKDSSVNFPYS-RSCENEIKLLNGWILSNAVNKK-GEEFSVFLRDISSIDNLSKGTIQNALKKMKTLKHPDLISYVDSNESIKEVQIVTEKVVPLEKYLREKSDSSNFSFVA-SWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDFV----TNIGDDLPSSVVQTDLYWP-----------MDKSKIDSYGFGCLIWETFNQNLSRKSDLKETSKLPGQLVKLFQRLTHPKPNMRLNLDNALKEMSGPAGFADNFYVKTLLFLXXXXXXXXXXXXXFMASLTDLVDSFPDDIAKYKILPHLLMCHQFGGAGIEXXXXXXXXXXXXEASEFETSVVPRLVAMFRSSNRTTRVRLLEQLPTFVDVLPFKVVDMDIFPAVVLGLADTNPIVREATIRAVVHLAPKLSHKNLNEILINHLMNLQLKDEQGGIRTNATVCLAKIAHLLATQIRQTSLLNVLLKCTRDPFVPAKXXXXXXXXXXQHLFLVNDVATKLLPCLSFLTVDPEKEVREQTFKALDFALSRLKEASQNP 1687
            MW F++D   +FP+       E      W+L     K  G   S+F+ D+  +        + A K++KTL+HP++++Y+D  E+ K + +VTE V PL  YL+ ++++     +  SWGL QI++ L FL + C + HN + + ++FV+++G+WK+G  D++     N G      + + + Y P            +K   D +  GCLIWE FN  L R + L+   K+P  LV  +  L    P +R N    L+    P GF +N +V+T LFLEEIQIKE  +KQ+F   L+  +DSFP+D  ++K+LP LL   +FG AG  VL PL K+GK L A E++  ++P +V MF S++R  R+RLL+Q+  F+  L    V+  IFP VV G  DTNP +RE T+++++ LAPKL+  NLN  L+ H   LQ KDEQG IR N TVCL KI   L+   R   L +   + T+DPF P++++ V    A+ +L+ +ND A K+LP L  LTVDPEK VR+Q FKA+   LS+L+  S++P
Sbjct:    1 MWFFARDPVRDFPFELSPEPPEGSPPGPWVLHRGRKKATGSPVSIFVYDVKPVAEEQTQVAKAAFKRLKTLRHPNILAYIDGLETDKCLHVVTEAVTPLGVYLKARAEAGGLKELELSWGLHQIVKALSFLVNDCSLIHNNVCMAAVFVDRAGEWKLGGLDYMYSAQGNGGGPPRKGIPELEQYDPPELADGSGRAVREKWSADMWRLGCLIWEVFNGPLPRAAALRNPGKIPKSLVPHYCELVGANPKVRPNPARFLQNCRAPGGFMNNRFVETNLFLEEIQIKEPAEKQKFFQELSKSLDSFPEDFCRHKVLPQLLTAFEFGSAGAVVLTPLFKVGKFLNAEEYQQKIIPVVVKMFSSTDRAMRIRLLQQMEQFIQYLDEPTVNTQIFPHVVHGFLDTNPAIREQTVKSMLLLAPKLNETNLNVELMKHFARLQAKDEQGPIRCNTTVCLGKIGSYLSASTRHRVLTSAFSRATKDPFAPSRVAGVLGFAATHNLYSMNDCAHKILPVLCGLTVDPEKSVRDQAFKAIRSFLSKLESVSEDP 544          
BLAST of N terminal kinase protein like vs. UniProt/SwissProt
Match: sp|Q96KG9|SCYL1_HUMAN (N-terminal kinase-like protein OS=Homo sapiens OX=9606 GN=SCYL1 PE=1 SV=1)

HSP 1 Score: 362.459 bits (929), Expect = 1.833e-112
Identity = 213/544 (39.15%), Postives = 313/544 (57.54%), Query Frame = 2
Query:  110 MWLFSKDSSVNFPYSRSCEN-EIKLLNGWILSNAVNKK-GEEFSVFLRDISSIDNLSKGTIQNALKKMKTLKHPDLISYVDSNESIKEVQIVTEKVVPLEKYLREKSDSSNFSFVA-SWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDFV----TNIGDDLPSSVVQTDLYWP-----------MDKSKIDSYGFGCLIWETFNQNLSRKSDLKETSKLPGQLVKLFQRLTHPKPNMRLNLDNALKEMSGPAGFADNFYVKTLLFLXXXXXXXXXXXXXFMASLTDLVDSFPDDIAKYKILPHLLMCHQFGGAGIEXXXXXXXXXXXXEASEFETSVVPRLVAMFRSSNRTTRVRLLEQLPTFVDVLPFKVVDMDIFPAVVLGLADTNPIVREATIRAVVHLAPKLSHKNLNEILINHLMNLQLKDEQGGIRTNATVCLAKIAHLLATQIRQTSLLNVLLKCTRDPFVPAKXXXXXXXXXXQHLFLVNDVATKLLPCLSFLTVDPEKEVREQTFKALDFALSRLKEASQNP 1687
            MW F++D   +FP+    E  E  L   W L     K  G   S+F+ D+           + A K+ KTL+HP++++Y+D  E+ K + +VTE V PL  YL+ + ++     +  SWGL QI++ L FL + C + HN + + ++FV+++G+WK+G  D++     N G      + + + Y P            +K   D +  GCLIWE FN  L R + L+   K+P  LV  +  L    P +R N    L+    P GF  N +V+T LFLEEIQIKE  +KQ+F   L+  +D+FP+D  ++K+LP LL   +FG AG  VL PL K+GK L A E++  ++P +V MF S++R  R+RLL+Q+  F+  L    V+  IFP VV G  DTNP +RE T+++++ LAPKL+  NLN  L+ H   LQ KDEQG IR N TVCL KI   L+   R   L +   + TRDPF P++++ V    A+ +L+ +ND A K+LP L  LTVDPEK VR+Q FKA+   LS+L+  S++P
Sbjct:    1 MWFFARDPVRDFPFELIPEPPEGGLPGPWALHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRFKTLRHPNILAYIDGLETEKCLHVVTEAVTPLGIYLKARVEAGGLKELEISWGLHQIVKALSFLVNDCSLIHNNVCMAAVFVDRAGEWKLGGLDYMYSAQGNGGGPPRKGIPELEQYDPPELADSSGRVVREKWSADMWRLGCLIWEVFNGPLPRAAALRNPGKIPKTLVPHYCELVGANPKVRPNPARFLQNCRAPGGFMSNRFVETNLFLEEIQIKEPAEKQKFFQELSKSLDAFPEDFCRHKVLPQLLTAFEFGNAGAVVLTPLFKVGKFLSAEEYQQKIIPVVVKMFSSTDRAMRIRLLQQMEQFIQYLDEPTVNTQIFPHVVHGFLDTNPAIREQTVKSMLLLAPKLNEANLNVELMKHFARLQAKDEQGPIRCNTTVCLGKIGSYLSASTRHRVLTSAFSRATRDPFAPSRVAGVLGFAATHNLYSMNDCAQKILPVLCGLTVDPEKSVRDQAFKAIRSFLSKLESVSEDP 544          
BLAST of N terminal kinase protein like vs. UniProt/SwissProt
Match: sp|Q9EQC5|SCYL1_MOUSE (N-terminal kinase-like protein OS=Mus musculus OX=10090 GN=Scyl1 PE=1 SV=1)

HSP 1 Score: 358.607 bits (919), Expect = 5.289e-111
Identity = 211/544 (38.79%), Postives = 314/544 (57.72%), Query Frame = 2
Query:  110 MWLFSKDSSVNFPYSRSCENEIKLLNG-WILSNAVNKK-GEEFSVFLRDISSIDNLSKGTIQNALKKMKTLKHPDLISYVDSNESIKEVQIVTEKVVPLEKYLREKSDSSNFSFVA-SWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDFV----TNIGDDLPSSVVQTDLYWP-----------MDKSKIDSYGFGCLIWETFNQNLSRKSDLKETSKLPGQLVKLFQRLTHPKPNMRLNLDNALKEMSGPAGFADNFYVKTLLFLXXXXXXXXXXXXXFMASLTDLVDSFPDDIAKYKILPHLLMCHQFGGAGIEXXXXXXXXXXXXEASEFETSVVPRLVAMFRSSNRTTRVRLLEQLPTFVDVLPFKVVDMDIFPAVVLGLADTNPIVREATIRAVVHLAPKLSHKNLNEILINHLMNLQLKDEQGGIRTNATVCLAKIAHLLATQIRQTSLLNVLLKCTRDPFVPAKXXXXXXXXXXQHLFLVNDVATKLLPCLSFLTVDPEKEVREQTFKALDFALSRLKEASQNP 1687
            MW F++D   +FP+  S E       G WIL     K  G   S+F+ D+           + A K++KTL+HP++++Y+D  E+ K + IVTE V PL  YL+ ++++        SWGL QI++ L FL + C + HN + + ++FV+++G+WK+G  D++     N G      + + + Y P            +K   D +  GCLIWE FN +L R + L+   K+P  LV  +  L    P +R N    L+    P GF  N +V+T LFLEEIQIKE  +KQ+F   L+  +DSFP+D  ++K+LP LL   +FG AG  VL PL K+GK L A E++  ++P +V MF S++R  R+RLL+Q+  F+  L    V+  IFP V  G  DTNP +RE T+++++ LAPKL+  NLN  L+ H   LQ KD+QG IR N TVCL KI   L+   R   L +   + T+DPF P++++ V    A+ +L+ ++D A K+LP L  LTVDPEK VR+Q FK +   LS+L+  S++P
Sbjct:    1 MWFFARDPVRDFPFELSPEPPEGGPPGPWILHRGRKKATGSAVSIFVYDVKPGAEEQTQVAKAAFKRLKTLRHPNILAYIDGLETEKCLHIVTEAVTPLGTYLKARAEAGGLKEQELSWGLHQIVKALSFLVNDCNLIHNNVCMAAVFVDRAGEWKLGGLDYMYSAQGNGGGPPSKGIPELEQYDPPELADSSSRAVREKWSADMWRLGCLIWEVFNGSLPRAAALRNPGKIPKSLVTHYCELVGANPKVRPNPARFLQNCRAPGGFMSNRFVETNLFLEEIQIKEPAEKQKFFQELSKSLDSFPEDFCRHKVLPQLLTAFEFGNAGAVVLTPLFKVGKSLRAEEYQEKIIPVVVKMFSSTDRAMRIRLLQQMEQFIQYLDEPTVNTQIFPHVTHGFLDTNPAIREQTVKSMLLLAPKLNEANLNVELMKHFARLQAKDDQGPIRCNTTVCLGKIGSYLSASTRHRVLTSAFSRATKDPFAPSRVAGVLGFAATHNLYSMDDCAHKILPVLCGLTVDPEKSVRDQAFKTIRSFLSKLESVSEDP 544          
BLAST of N terminal kinase protein like vs. TrEMBL
Match: A0A4S2L3G9 (Protein kinase domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_009998 PE=4 SV=1)

HSP 1 Score: 422.55 bits (1085), Expect = 1.822e-132
Identity = 252/561 (44.92%), Postives = 356/561 (63.46%), Query Frame = 2
Query:  119 FSKDSSVNFPYSRSCENEIKLLNG-----WILSNAVNKK--GEEFSVFLRDISSIDNLS--KGTIQNALKK----MKTLKHPDLISYVDSNESIK------EVQIVTEKVVPLEKYLREKSDSSNFSFVASWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDFVTNIGDDLPSSVVQ----------TDLYWPMDKSKIDSYGFGCLIWETFNQNLSRKSDLKETS-----KLPGQLVKLFQRL-----THPKPNMRLNLDNALKEM--SGPAGFADNFYVKTLLFLXXXXXXXXXXXXXFMASLTDLVDSFPDDIAKYKILPHLLMCHQFGGAGIEXXXXXXXXXXXXEASEFETSVVPRLVAMFRSSNRTTRVRLLEQLPTFVDVLPFKVVDMDIFPAVVLGLADTNPIVREATIRAVVHLAPKLSHKNLNEILINHLMNLQLKDEQGGIRTNATVCLAKIAHLLATQIRQTSLLNVLLKCTRDPFVPAKXXXXXXXXXXQHLFLVNDVATKLLPCLSFLTVDPEKEVREQTFKALDFALSRLKEAS 1678
            F+ D    F  + S       ++G     W + NA NKK   +E SVF  ++ S+ +     G++  +L +    MKTL+HP++++++   E         E  ++TE+VVPL  YLR K+DS NF+ ++SWG++QI R L FL+   K+ HN +R+ ++FV  +G+WK+GA DFV  + D  PSS             +D Y P D   +DS+G GC IWE FN N S +   + +S     +LP  LV  ++RL     T   P  RL +   L +   S   GF  N YV TLLFLEEIQ+K+ ++K +F+++LTD V SFPDD+ ++KILPHLL   ++G AG+E L+P+++L  LL +SEFE++V+P LV +F +  R TRVRLLEQLP FV  LP K V+  IF +V  G +D NP+VREAT+RA+VHLAPKLS K LN+ L  +L+ +Q KDEQGGIRTNAT+CLAK+A   +TQ++Q  LLN  L+ TRD FVPA+ +A+SAL A+Q L+  + +A KLLPCLSFLTVDPEK +R+  F+++   L  LK+ S
Sbjct:   23 FTSDPVAGFALTASENTVYHTIDGAFGLEWQVRNAYNKKKNADEVSVFSCNLQSVQSSMPMTGSVVESLHQTTRWMKTLRHPNILNWIAGTELASGQKLPIEFHLITERVVPLRDYLRVKADSGNFNLMSSWGIYQISRALSFLNDDAKLTHNAVRMDAVFVTTAGEWKLGALDFVGPVDDPPPSSRSTAAFVRLDQNGSDPYLPPDTRLVDSWGLGCFIWELFNPNTSLRDRSQLSSPDALQRLPASLVSSYRRLIALNGTVRGPKRRLTVTQFLDQARNSDKQGFFVNEYVDTLLFLEEIQLKDPQEKTRFLSALTDQVSSFPDDVCRHKILPHLLNGLRYGSAGVEALIPILRLIPLLSSSEFESNVLPCLVKLFAAPERATRVRLLEQLPNFVKNLPPKAVESQIFTSVATGFSDANPVVREATVRAMVHLAPKLSAKLLNDTLPRYLIGVQAKDEQGGIRTNATICLAKLATQFSTQVQQGVLLNAFLRATRDQFVPARKAALSALAATQDLYKTDQLAGKLLPCLSFLTVDPEKSIRDDAFQSIYTVLDHLKKVS 583          
BLAST of N terminal kinase protein like vs. TrEMBL
Match: A0A1S8X0C7 (HEAT repeat protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_03934 PE=4 SV=1)

HSP 1 Score: 420.624 bits (1080), Expect = 9.139e-132
Identity = 252/561 (44.92%), Postives = 356/561 (63.46%), Query Frame = 2
Query:  119 FSKDSSVNFPYSRSCENEIKLLNG-----WILSNAVNKK--GEEFSVFLRDISSIDNLS--KGTIQNALKK----MKTLKHPDLISYVDSNESIK------EVQIVTEKVVPLEKYLREKSDSSNFSFVASWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDFVTNIGDDLPSSVVQ----------TDLYWPMDKSKIDSYGFGCLIWETFNQNLSRKSDLKETS-----KLPGQLVKLFQRL-----THPKPNMRLNLDNALKEM--SGPAGFADNFYVKTLLFLXXXXXXXXXXXXXFMASLTDLVDSFPDDIAKYKILPHLLMCHQFGGAGIEXXXXXXXXXXXXEASEFETSVVPRLVAMFRSSNRTTRVRLLEQLPTFVDVLPFKVVDMDIFPAVVLGLADTNPIVREATIRAVVHLAPKLSHKNLNEILINHLMNLQLKDEQGGIRTNATVCLAKIAHLLATQIRQTSLLNVLLKCTRDPFVPAKXXXXXXXXXXQHLFLVNDVATKLLPCLSFLTVDPEKEVREQTFKALDFALSRLKEAS 1678
            F+ D    F  + S +     ++G     W + NA NKK   +E SVF  ++ S  +     G++  +L +    MKTL+HP++++++   E         E  ++TE+VVPL  YLR K+DS NF+ ++SWG++QI R L FL+   K+ HN +R+ ++FV  +G+WK+GA DFV  + D  PSS             +D Y P D   +DS+G GC IWE FN N S +   + +S     +LP  LV  ++RL     T   P  RL +   L +   S   GF  N YV TLLFLEEIQ+K+ ++K +F+++LTD V SFPDD+ ++KILPHLL   ++G AG+E L+P+++L  LL +SEFE++V+P LV +F +  R TRVRLLEQLP FV  LP K V+  IF +V  G +D NP+VREAT+RA+VHLAPKLS K LN+ L  +L+ +Q KDEQGGIRTNAT+CLAK+A   +TQ++Q  LLN  L+ TRD FVPA+ +A+SAL A+Q L+  + +A KLLPCLSFLTVDPEK +R+  F+++   L  LK+ S
Sbjct:   23 FTSDPVAGFALTASEDAVYHTIDGAFGLEWRVRNAYNKKKNTDEVSVFSCNLQSFQSSMPMTGSVVESLHQTTRWMKTLRHPNILNWIAGTELASGQKLPIEFHLITERVVPLRDYLRVKADSGNFNLMSSWGIYQISRALSFLNDDAKLAHNAVRMDAVFVTTAGEWKLGALDFVGPVDDPPPSSRSTGAFVHLDKNGSDPYLPPDTRLVDSWGLGCFIWELFNPNTSLRDRSQLSSPDALQRLPASLVSSYRRLIALNATVRGPKRRLTVTQFLDQARNSDKQGFFVNEYVDTLLFLEEIQLKDPQEKTRFLSALTDQVSSFPDDVCRHKILPHLLNGLRYGSAGVEALMPILRLIPLLSSSEFESNVLPCLVKLFAAPERATRVRLLEQLPNFVKNLPPKAVESQIFSSVATGFSDANPVVREATVRAMVHLAPKLSAKLLNDTLPRYLIGVQAKDEQGGIRTNATICLAKLATQFSTQVQQGVLLNSFLRATRDQFVPARKAALSALTATQDLYKTDQLAGKLLPCLSFLTVDPEKSIRDDAFQSIYTVLDHLKKVS 583          
BLAST of N terminal kinase protein like vs. TrEMBL
Match: G7Y7W1 (SCY1-like protein OS=Clonorchis sinensis OX=79923 GN=CLF_102416 PE=4 SV=1)

HSP 1 Score: 420.239 bits (1079), Expect = 1.227e-131
Identity = 252/561 (44.92%), Postives = 356/561 (63.46%), Query Frame = 2
Query:  119 FSKDSSVNFPYSRSCENEIKLLNG-----WILSNAVNKK--GEEFSVFLRDISSIDNLS--KGTIQNALKK----MKTLKHPDLISYVDSNESIK------EVQIVTEKVVPLEKYLREKSDSSNFSFVASWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDFVTNIGDDLPSSVVQ----------TDLYWPMDKSKIDSYGFGCLIWETFNQNLSRKSDLKETS-----KLPGQLVKLFQRL-----THPKPNMRLNLDNALKEM--SGPAGFADNFYVKTLLFLXXXXXXXXXXXXXFMASLTDLVDSFPDDIAKYKILPHLLMCHQFGGAGIEXXXXXXXXXXXXEASEFETSVVPRLVAMFRSSNRTTRVRLLEQLPTFVDVLPFKVVDMDIFPAVVLGLADTNPIVREATIRAVVHLAPKLSHKNLNEILINHLMNLQLKDEQGGIRTNATVCLAKIAHLLATQIRQTSLLNVLLKCTRDPFVPAKXXXXXXXXXXQHLFLVNDVATKLLPCLSFLTVDPEKEVREQTFKALDFALSRLKEAS 1678
            F+ D    F  + S +     ++G     W + NA NKK   EE SVF  ++ SI       G++  +L +    MKTL+HP++++++   E         E  ++TE+VVPL+ YLR K+DS NF+ ++SWG++QI R L FL+   K+ HN +R+ ++FV  +G+WK+GA DFV  + D  PSS             +D Y P D   +DS+G GC IWE FN N S +   + +S     +LP  LV  ++RL     T   P  RL +   L +   S   GF  N YV TLLFLEEIQ+K+ ++K +F+++LTD V +FPDD+ ++KILPHLL   ++G AG+E L+P+++L  LL +SEFE++V+P LV +F +  R TRVRLLEQLP FV  LP K V+  IF +V  G +D NP+VREAT+RA+VHLAPKL  K LN+ L  +L+ +Q KDEQGGIRTNAT+CLAK+A   +TQ++Q  LLN  L+ TRD FVPA+ +A+SAL A+Q L+  + +A KLLPCLSFLTVDPEK +R+  F+++   L  LK+ S
Sbjct:   23 FTGDPVAGFALTASEDAVYHTIDGAFSLEWRVRNAYNKKKNAEEVSVFSCNLQSIQPSMPMTGSVVESLHQTTRWMKTLRHPNILNWIAGTELASGQKLPNEFHLITERVVPLKDYLRVKADSGNFNLMSSWGIYQISRALSFLNDDAKLAHNAVRMDAVFVTTAGEWKLGALDFVGPVDDPPPSSRSTAAFVRLDQNGSDPYLPPDNRLVDSWGLGCFIWELFNPNTSLRDRSQLSSPDALQRLPASLVSSYRRLIALNATVRGPKRRLTVTQFLDQARNSDKQGFFVNEYVDTLLFLEEIQLKDPQEKSRFLSALTDQVSNFPDDVCRHKILPHLLNGLRYGSAGVEALIPILRLIPLLSSSEFESNVLPCLVKLFAAPERATRVRLLEQLPNFVKNLPPKAVESQIFSSVATGFSDANPVVREATVRAMVHLAPKLPAKLLNDTLPRYLIGVQAKDEQGGIRTNATICLAKLATQFSTQVQQGVLLNAFLRATRDQFVPARKAALSALAATQDLYKTDQLAGKLLPCLSFLTVDPEKSIRDDAFQSIYTVLDHLKKVS 583          
BLAST of N terminal kinase protein like vs. TrEMBL
Match: A0A267ER90 (Protein kinase domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000480g2 PE=4 SV=1)

HSP 1 Score: 415.231 bits (1066), Expect = 4.511e-130
Identity = 242/586 (41.30%), Postives = 352/586 (60.07%), Query Frame = 2
Query:   95 KTKLYMW-LFSKDSSVNFPYSRSCENEIKLLNGWILSNAVNKKG----EEFSVFLRDI--SSIDNLSKGTIQNALKKMKTLKHPDLISYVDSNESIKEVQIVTEKVVPLEKYLREKSDSSNFSFVASWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDFVTNIGDDLPSSVVQT------DLYWP---------MDKSKIDSYGFGCLIWETFNQNLSRKSDLKETSKLPGQLVKLFQRLTHPKPNMRLNLDNALKEMSGPAGFADNFYVKTLLFLXXXXXXXXXXXXXFMASLTDLVDSFPDDIAKYKILPHLLMCHQFGGAGIEXXXXXXXXXXXXEASEFETSVVPRLVAMFRSSNRTTRVRLLEQLPTFVDVLPFKVVDMDIFPAVVLGLADTNPIVREATIRAVVHLAPKLSHKNLNEILINHLMNLQLKDEQGGIRTNATVCLAKIAHLLATQIRQTSLLNVLLKCTRDPFVPAKXXXXXXXXXXQHLFLVNDVATKLLPCLSFLTVDPEKEVREQTFKALDFALSRLKEASQNPENNKIEPLENKEAQKLIG------WKNWAVSFI 1768
            KT + MW LFSKD + +FPY       ++ +  W L +   KKG    ++FS+F  D   ++ D  +    ++  K  KTL+HP +++Y D  ++ K + +VTE+V PL +YLR K+DS++F+ +ASWG+ Q+ +GL FL+  C++ H ++R  S+FVN +G+WK+ AF     + +  PS  V +      D+Y P          D+  IDS+G GC +WE FN+ L+ + DL++   +P  L   +  L   +   R    + L+  S P GF DN Y + LL LE++ +   E+K QF+  L + + +FPDD+AK+K+LP L+   Q+GG G EVLLPL+ L +L + SEFE  +VP L+ +F    R  RVRLLEQLP+++  LP +VV+  I      G  DT+P+VRE TIRA VHLA KL+ KNLNE L  HL  LQ+KDEQGG+R NATVCL K+A  +A   RQ  LL   LKC RDPF PA+ +A+ A  ++   + + D A +LLP L  LT+DP KEVRE  F+A++  L RL++AS +PE  +   LE++ A           W NWAVS +
Sbjct:   11 KTSIPMWSLFSKDPATSFPYEAG--EVVERVGDWAL-HRCRKKGSDNWDQFSLFAFDCRAAAADPAAIARAKSCAKHSKTLRHPCVLTYADGLDTDKVLYVVTERVWPLFEYLRTKADSTSFTLLASWGISQVAKGLAFLNRDCRLLHGRVRAASVFVNSAGEWKLWAFQHTAPLEN--PSGAVASAGVELPDIYLPGDADRLVKAADRETIDSWGLGCFVWEVFNRPLTSRQDLRQLGHVPQALQPAYAELIRDRAAQRCPAADFLQRCSKPGGFFDNPYTRALLQLEQLHVLAAEEKSQFLGQLAEQLSNFPDDVAKHKVLPQLVNILQYGGGGSEVLLPLLHLSRLCDKSEFEGRIVPCLIRLFSLPERVARVRLLEQLPSYIGHLPDRVVNEQILQPFCQGFHDTSPVVREHTIRAAVHLAEKLNAKNLNEELPKHLTRLQVKDEQGGVRANATVCLGKLAGHMAPATRQGPLLAQFLKCLRDPFPPARQAALLACASTLSFYTLRDTACRLLPALCPLTLDPSKEVREHAFQAINACLQRLRKASDSPE--EAADLESQVAATRGADSTSKSWANWAVSAL 589          
BLAST of N terminal kinase protein like vs. TrEMBL
Match: A0A1I8GL38 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 411.764 bits (1057), Expect = 7.359e-129
Identity = 240/581 (41.31%), Postives = 349/581 (60.07%), Query Frame = 2
Query:  110 MW-LFSKDSSVNFPYSRSCENEIKLLNGWILSNAVNKKG----EEFSVFLRDI--SSIDNLSKGTIQNALKKMKTLKHPDLISYVDSNESIKEVQIVTEKVVPLEKYLREKSDSSNFSFVASWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDFVTNIGDDLPSSVVQT------DLYWP---------MDKSKIDSYGFGCLIWETFNQNLSRKSDLKETSKLPGQLVKLFQRLTHPKPNMRLNLDNALKEMSGPAGFADNFYVKTLLFLXXXXXXXXXXXXXFMASLTDLVDSFPDDIAKYKILPHLLMCHQFGGAGIEXXXXXXXXXXXXEASEFETSVVPRLVAMFRSSNRTTRVRLLEQLPTFVDVLPFKVVDMDIFPAVVLGLADTNPIVREATIRAVVHLAPKLSHKNLNEILINHLMNLQLKDEQGGIRTNATVCLAKIAHLLATQIRQTSLLNVLLKCTRDPFVPAKXXXXXXXXXXQHLFLVNDVATKLLPCLSFLTVDPEKEVREQTFKALDFALSRLKEASQNPENNKIEPLENKEAQKLIG------WKNWAVSFI 1768
            MW LFSKD + +FPY       ++ +  W L +   KKG    ++FS+F  D   ++ D  +    ++  K  KTL+HP +++Y D  ++ K + +VTE+V PL +YLR K+DS++F+ +ASWG+ Q+ +GL FL+  C++ H ++R  S+FVN +G+WK+ AF     + +  PS  V +      D+Y P          D+  IDS+G GC +WE FN+ L+ + DL++   +P  L   +  L   +   R    + L+  S P GF DN Y + LL LE++ +   E+K QF+  L + + +FPDD+AK+K+LP L+   Q+GG G EVLLPL+ L +L + SEFE  +VP L+ +F    R  RVRLLEQLP+++  LP +VV+  I      G  DT+P+VRE TIRA VHLA KL+ KNLNE L  HL  LQ+KDEQGG+R NATVCL K+A  +A   RQ  LL   LKC RDPF PA+ +A+ A  ++   + + D A +LLP L  LT+DP KEVRE  F+A++  L RL++AS +PE  +   LE++ A           W NWAVS +
Sbjct:    1 MWSLFSKDPATSFPYEAG--EVVERVGDWAL-HRCRKKGSDNWDQFSLFAFDCRAAAADPAAIARAKSCAKHSKTLRHPCVLTYADGLDTDKVLYVVTERVWPLFEYLRTKADSTSFTLLASWGISQVAKGLAFLNRDCRLLHGRVRAASVFVNSAGEWKLWAFQHTAPLEN--PSGAVASAGVELPDIYLPGDADRLVKAADRETIDSWGLGCFVWEVFNRPLTSRQDLRQLGHVPQALQPAYAELIRDRAAQRCPAADFLQRCSKPGGFFDNPYTRALLQLEQLHVLAAEEKSQFLGQLAEQLSNFPDDVAKHKVLPQLVNILQYGGGGSEVLLPLLHLSRLCDKSEFEGRIVPCLIRLFSLPERVARVRLLEQLPSYIGHLPDRVVNEQILQPFCQGFHDTSPVVREHTIRAAVHLAEKLNAKNLNEELPKHLTRLQVKDEQGGVRANATVCLGKLAGHMAPATRQGPLLAQFLKCLRDPFPPARQAALLACASTLSFYTLRDTACRLLPALCPLTLDPSKEVREHAFQAINACLQRLRKASDSPE--EAADLESQVAATRGADSTSKSWANWAVSAL 574          
BLAST of N terminal kinase protein like vs. Ensembl Cavefish
Match: scyl1 (SCY1 like pseudokinase 1 [Source:NCBI gene;Acc:103037485])

HSP 1 Score: 357.836 bits (917), Expect = 5.367e-111
Identity = 239/637 (37.52%), Postives = 343/637 (53.85%), Query Frame = 2
Query:  110 MW-LFSKDSSVNFPYSRSCENEIKLLNG-WILSNAVNKK-GEEFSVFLRDISSIDNLSKGTIQNALKKMKTLKHPDLISYVDSNESIKEVQIVTEKVVPLEKYLREKSDSSNFSFVA-SWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDFVTNIGDDL----PSSVVQTDL--YWP-------MDKSKIDSYGFGCLIWETFNQNLSRKSDLKETSKLPGQLVKLFQRLTHPKPNMRLNLDNALKEMSGPAGFADNFYVKTLLFLXXXXXXXXXXXXXFMASLTDLVDSFPDDIAKYKILPHLLMCHQFGGAGIEXXXXXXXXXXXXEASEFETSVVPRLVAMFRSSNRTTRVRLLEQLPTFVDVLPFKVVDMDIFPAVVLGLADTNPIVREATIRAVVHLAPKLSHKNLNEILINHLMNLQLKDEQGGIRTNATVCLAKIAHLLATQIRQTSLLNVLLKCTRDPFVPAKXXXXXXXXXXQHLFLVNDVATKLLPCLSFLTVDPEKEVREQTFKALDFALSRLKEASQNP----ENNKIEPLENKEAQKLIGWKNWAVSFIXXXXXX------XXXXXXXXXXXXXXEPARETNITKTLSPES---MKIANPDKIVVRQQIIDH 1930
            MW  F++D   +F Y    EN+ K  +G W L     K  GE  S+FL +++          + A K+MKTL+HP+++SYVD  E+ K + +VTE V PL  +L+ +S+S     +  SWGL Q ++ L FL + C + HN +   +IFV+++G+WK+G  D VT+   +     P+ VV  DL  Y P        +K   D +  GCLIWE FN  L R S L+   K+P QLV  +  L    P  R N    L+      GF  N +V++ LFLE+IQIKE  +KQQF   L++ +DSFP+D  K+K+LP LL   +FG AG  VL PL K+GK L A E++  ++P +V MF S++R  R+RLL+Q+  F+  L    V+  IFP VV G  DTNP +RE T+++++ LAPKL+  NLN+ L+ H   LQ +D+QG IR N TVCL KIA  L   +RQ  L +   + T+DPF  ++ + V    A+ H + V + A ++LP L  LTVDP+K VR+Q FKA+   L++L+  S +P    E  K      +       W  WAV+ +    +             T     +  PA  T       PE+      A P  IVV Q    H
Sbjct:    1 MWSFFARDPVKDFNYEILPENQDK--SGIWTLHRGKRKTTGEPVSIFLYEVAQGTEEQTQLAKAAFKRMKTLRHPNILSYVDGLETDKSLYLVTEPVTPLAAHLKARSESGGSGELEISWGLHQTVKALSFLVNDCHLLHNNLGTWAIFVDRAGEWKLGGLDHVTSDQGEPTSLPPAKVVNPDLEKYDPPESPNSGGEKWSGDVWRLGCLIWEVFNGPLPRASSLRSLGKIPKQLVPHYCELVGANPKARPNPARFLQNCRSSGGFLSNSFVESNLFLEQIQIKEPAEKQQFFQDLSENLDSFPEDFCKHKVLPQLLTAFEFGIAGAVVLTPLFKVGKYLSAEEYQQKIIPVIVKMFSSTDRAMRIRLLQQMEQFIQYLNEAAVNSQIFPHVVHGFTDTNPAIREQTVKSMLLLAPKLNETNLNQELMRHFARLQSRDDQGPIRCNTTVCLGKIAPYLNAGLRQRVLTSAFSRATKDPFPASRAAGVLGFAATHHYYSVTECAGRILPTLCPLTVDPDKNVRDQAFKAIKSFLTKLETVSDDPTKLAEIEKDVTASGQAGGSAATWAGWAVTGVSSLTSKLIRNAPAGSEGATAGNASAGIPASATGAANATGPETKAHTPTAPPSGIVVNQSEASH 635          
BLAST of N terminal kinase protein like vs. Ensembl Cavefish
Match: scyl3 (SCY1 like pseudokinase 3 [Source:NCBI gene;Acc:103037917])

HSP 1 Score: 103.605 bits (257), Expect = 1.891e-22
Identity = 107/427 (25.06%), Postives = 189/427 (44.26%), Query Frame = 2
Query:  155 RSC---ENEIKLLNGWILSNAVNKKGEEFSVFLRDISSIDNLSKGTIQNALKKMKTLKHPDLISYVDSNESIKEVQIVTEKVVPLEKYLREKSDSSNFSFVASWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDFVTNIGDDLP------SSVVQTDLYWPMDK------------SKIDSYGFGCLIWETFNQNLSRKSDLKETSKLPGQLVKLFQ-RLTHPKPNMRLNLDNALKEMSGPAGFADNFYVKTLLFLXXXXXXXXXXXXXFMASLTDLVDSFPDDIAKYKI-------------------LPHLLMCHQFGGAGIEXXXXXXXXXXXXEASEFETSVVPRLVAMFRSSNRTTRVRLLEQLPTFVDVLPFKVVDMDIFPAVVLGLADTNPIVREATIRAVVHLAPKL 1312
            RSC   E  + L +G  + +A+ + G+  SVF+    + D ++K     A K +KTL+HP L+ ++  +     + +VTE+V PLE  L    DS     + + G++ +L+ LVFL    K  HN + ++S+FV++ G WK+G  + V    +  P      ++V ++    P +K               D++ FG L+     + L    +   + +L   L  + Q  L  P P  R  L + L        F  N ++  + FL+ + +K +E+K +F   L D V S P+++   ++                   LPHLL   +  G G+     L           +   V P+L+ +F+ +    R+ LL  +  + +      +   I P V+LG+ DTN  +   T++A+  L P L
Sbjct:    9 RSCILEEPLLTLPSGLTMYSAILQDGKAASVFVYKQGNEDKVNK-----AAKHLKTLRHPSLLRFLSCSVQNGGIHLVTERVKPLELLL----DSLTPEEICA-GIYDLLQALVFLHDRGKSSHNNVCMSSVFVSEDGHWKLGGMETVCKFAEATPEFLASVATVRESSAIPPEEKLDGFKTLPDKHAHSRDAFSFGVLV-----EALIPLLNGYVSEELAESLRSMLQVSLLTPDPTARSPLSSLLTHE-----FFRNDFLDIMNFLKSLTLKSEEEKHEFFKFLLDRVHSLPEELIGARLAPKLLNSLVFAEPTAVKSFLPHLLQPKKDSGVGVADECLLSMPL-------YRRHVFPQLLKLFKVNEEHVRMVLLSHIHIYAEFFSHDELKNQILPQVLLGMRDTNDTLVAMTLQALAVLVPLL 408          
BLAST of N terminal kinase protein like vs. Ensembl Cavefish
Match: scyl3 (SCY1 like pseudokinase 3 [Source:NCBI gene;Acc:103037917])

HSP 1 Score: 103.605 bits (257), Expect = 1.960e-22
Identity = 107/427 (25.06%), Postives = 189/427 (44.26%), Query Frame = 2
Query:  155 RSC---ENEIKLLNGWILSNAVNKKGEEFSVFLRDISSIDNLSKGTIQNALKKMKTLKHPDLISYVDSNESIKEVQIVTEKVVPLEKYLREKSDSSNFSFVASWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDFVTNIGDDLP------SSVVQTDLYWPMDK------------SKIDSYGFGCLIWETFNQNLSRKSDLKETSKLPGQLVKLFQ-RLTHPKPNMRLNLDNALKEMSGPAGFADNFYVKTLLFLXXXXXXXXXXXXXFMASLTDLVDSFPDDIAKYKI-------------------LPHLLMCHQFGGAGIEXXXXXXXXXXXXEASEFETSVVPRLVAMFRSSNRTTRVRLLEQLPTFVDVLPFKVVDMDIFPAVVLGLADTNPIVREATIRAVVHLAPKL 1312
            RSC   E  + L +G  + +A+ + G+  SVF+    + D ++K     A K +KTL+HP L+ ++  +     + +VTE+V PLE  L    DS     + + G++ +L+ LVFL    K  HN + ++S+FV++ G WK+G  + V    +  P      ++V ++    P +K               D++ FG L+     + L    +   + +L   L  + Q  L  P P  R  L + L        F  N ++  + FL+ + +K +E+K +F   L D V S P+++   ++                   LPHLL   +  G G+     L           +   V P+L+ +F+ +    R+ LL  +  + +      +   I P V+LG+ DTN  +   T++A+  L P L
Sbjct:    9 RSCILEEPLLTLPSGLTMYSAILQDGKAASVFVYKQGNEDKVNK-----AAKHLKTLRHPSLLRFLSCSVQNGGIHLVTERVKPLELLL----DSLTPEEICA-GIYDLLQALVFLHDRGKSSHNNVCMSSVFVSEDGHWKLGGMETVCKFAEATPEFLASVATVRESSAIPPEEKLDGFKTLPDKHAHSRDAFSFGVLV-----EALIPLLNGYVSEELAESLRSMLQVSLLTPDPTARSPLSSLLTHE-----FFRNDFLDIMNFLKSLTLKSEEEKHEFFKFLLDRVHSLPEELIGARLAPKLLNSLVFAEPTAVKSFLPHLLQPKKDSGVGVADECLLSMPL-------YRRHVFPQLLKLFKVNEEHVRMVLLSHIHIYAEFFSHDELKNQILPQVLLGMRDTNDTLVAMTLQALAVLVPLL 408          
BLAST of N terminal kinase protein like vs. Ensembl Cavefish
Match: si:ch211-244b2.1 (SCY1 like pseudokinase 2 [Source:NCBI gene;Acc:103035475])

HSP 1 Score: 55.8398 bits (133), Expect = 1.506e-7
Identity = 78/335 (23.28%), Postives = 131/335 (39.10%), Query Frame = 2
Query:  191 WILSNAVNKKG-EEFSVFLRDISSIDNLSK-------GTIQNALKKMKTLKHPDLISYVDSNESIKE-VQIVTEKV-VPLEKYLRE--------KSDSSNFSFV---ASWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDF---VTNIGDDLPSSVVQ------TDLYWPMDK-------------SKIDSYGFGCLIWETFNQ--------------NLSRKSDLKET------SKLPGQLVKLFQRLTHPKPNMRLNLDNALKEMSGPAGFADNFYVKTLLFLXXXXXXXXXXXXXFMASLTDLVDSFPDDIAKYKILPHL 1006
            W + N   K   +E +VF+ D   +D   K        +++  ++++  L+HP L++     E  ++ +   TE V   L   L +         +D  ++        +GL QI  GL FL S  K+ H  +   +I +NKSG WK+  FDF    +N  D  P  V +        L  P  +             S  D Y  G ++   FN+              + SR+ D          SK+P ++ +  + L     N+R + D   K       F D+    TL + + +  ++   K QF   L  ++   P  +  Y+ILP L
Sbjct:   47 WRIYNGTKKSTKQEVAVFVFDKKIVDRYQKFEKDQIIDSLKKGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGQWDNLPSPVPTDIKDYKLYDVETKYGLLQISEGLSFLHSGVKMVHGNLCPENIILNKSGAWKIMGFDFSISSSNPSDAEPKYVCKEWDPNSPPLCLPNPEYVAPEYILSVSCDSASDMYSLGVVVHAVFNEGKPVFRVNKQDIFKSFSRQLDQLSRLSPGVLSKIPDEVREHVKMLLSVTANVRPDADQMTK-----IPFFDDVGAVTLQYFDSLFQRDNLQKSQFYKGLPKVLPKLPKRVVVYRILPAL 376          
BLAST of N terminal kinase protein like vs. Ensembl Cavefish
Match: si:ch211-244b2.1 (SCY1 like pseudokinase 2 [Source:NCBI gene;Acc:103035475])

HSP 1 Score: 55.8398 bits (133), Expect = 1.641e-7
Identity = 78/335 (23.28%), Postives = 131/335 (39.10%), Query Frame = 2
Query:  191 WILSNAVNKKG-EEFSVFLRDISSIDNLSK-------GTIQNALKKMKTLKHPDLISYVDSNESIKE-VQIVTEKV-VPLEKYLRE--------KSDSSNFSFV---ASWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDF---VTNIGDDLPSSVVQ------TDLYWPMDK-------------SKIDSYGFGCLIWETFNQ--------------NLSRKSDLKET------SKLPGQLVKLFQRLTHPKPNMRLNLDNALKEMSGPAGFADNFYVKTLLFLXXXXXXXXXXXXXFMASLTDLVDSFPDDIAKYKILPHL 1006
            W + N   K   +E +VF+ D   +D   K        +++  ++++  L+HP L++     E  ++ +   TE V   L   L +         +D  ++        +GL QI  GL FL S  K+ H  +   +I +NKSG WK+  FDF    +N  D  P  V +        L  P  +             S  D Y  G ++   FN+              + SR+ D          SK+P ++ +  + L     N+R + D   K       F D+    TL + + +  ++   K QF   L  ++   P  +  Y+ILP L
Sbjct:   47 WRIYNGTKKSTKQEVAVFVFDKKIVDRYQKFEKDQIIDSLKKGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGQWDNLPSPVPTDIKDYKLYDVETKYGLLQISEGLSFLHSGVKMVHGNLCPENIILNKSGAWKIMGFDFSISSSNPSDAEPKYVCKEWDPNSPPLCLPNPEYVAPEYILSVSCDSASDMYSLGVVVHAVFNEGKPVFRVNKQDIFKSFSRQLDQLSRLSPGVLSKIPDEVREHVKMLLSVTANVRPDADQMTK-----IPFFDDVGAVTLQYFDSLFQRDNLQKSQFYKGLPKVLPKLPKRVVVYRILPAL 376          
BLAST of N terminal kinase protein like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003368.1 (pep scaffold:Pmarinus_7.0:GL479057:9948:36045:-1 gene:ENSPMAG00000003073.1 transcript:ENSPMAT00000003368.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.3218 bits (168), Expect = 2.335e-12
Identity = 96/470 (20.43%), Postives = 187/470 (39.79%), Query Frame = 2
Query:  224 EEFSVFLRDISSIDNLSKGTIQNALKKMKT-------LKHPDLISYVDSNESIKE-VQIVTEKV-----------------VPLEKYLREKSDSSNFSFVASWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDFVTNIGDDLPSSVVQTDLYW-----PMDKSKI-----------------DSYGFGCLIWETFNQ-------------------NLSRKSDLKET--SKLPGQLVKLFQRLTHPKPNMRLNLDNALKEMSGPAGFADNFYVKTLLFLXXXXXXXXXXXXXFMASLTDLVDSFPDDIAKYKILPHLLMCHQFGGAGIEXXXXXXXXXXXXEAS--EFETSVVPRLVAMFRSSNRTTRVRL-LEQLPTFVDVLPFKVVDMDIFPAVVLGLADTNPIVREATIRAVVHLAPKLSHKNLNEILINHLMNLQLKDEQGGIRTNATVCLAKI 1420
            +E +VF+ +   +D L +   ++A++ +K        L+HP L++     E  ++ +   TE V                 VPLE    +  D         +GL Q+  GL FL +  K+ H  +   +I +NK+G WK+  FDF  +  +     V  T   W     PM + +I                 D Y  G L++  FN+                   +L + S+L  +   K+P  +    + L +  P +R + D   K       + D+    TL +L+ +  ++   K QF   L+ ++   P  + + ++LP L    +F    +   +    L    + +  E+   V+P L+ +F+       + + L+++   +   P + +   + P +   L   +  ++E  +  +   A  + + ++   LI  + N  L+     +R NA VCL K+
Sbjct:   62 QEVAVFVFEKKQVDRLGRTEREHAVEVLKRGVQQLTRLRHPRLLTVQHPIEESRDCLAFCTEPVFASLSNVLGQHENLPCPVPLEIRDHQLHDVET-----KYGLLQLAEGLSFLHNGVKMVHGNLTPENIVLNKNGAWKIMGFDFCISSSNPSEREVAFTCKEWVPDLPPMCQPRIEFLAPEYILSVSCDVASDMYSLGMLMYAVFNKGQPIFQMDGTHDMFKSFSRHLDKLSNLGPSVMQKVPEDVRDHLKMLLNVTPTVRPDADQLAK-----IPYFDDVGAMTLQYLDSLFQRDNLQKSQFFKGLSKVLSKLPKRVVQQRVLPSLTT--EFVNPDMVPFVLPNVLLIAEDCTKEEYVRMVLPDLIPVFKLQEPIQVLLIFLQKMDLLLTKTPAEDIKQHVLPMIFRALEAPSTQIQELCLGIIPTFANLIEYPSMKNALIPRIKNSCLQTTSLAVRVNALVCLGKL 519          
BLAST of N terminal kinase protein like vs. Ensembl Yeast
Match: SCY1 (Putative kinase; suppressor of GTPase mutant; similar to bovine rhodopsin kinase; may have a role in intracellular sterol transport [Source:SGD;Acc:S000003051])

HSP 1 Score: 51.6026 bits (122), Expect = 4.323e-7
Identity = 73/315 (23.17%), Postives = 123/315 (39.05%), Query Frame = 2
Query:  284 IQNALKKMKTLKHPDLISYVDS-NESIKEVQIVTEKVVP-LEKYLREKSDS-SNF-------SFVASWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDFVTNIGDDLPSSVVQTDLYWPMDKSKI-------------------------DSYGFGCLIWETFN-QNLSRKSDLKETSKLPGQ--------------LVKLFQRLTHPKP------------NMRLNLDNALKEMSGPAGFADNFYVKTLLFLXXXXXXXXXXXXXFMASLTDLVDSFPDDIAKYKILPHLL-MCHQFGGAGI 1039
            ++N    +  LKHP++++ ++   E  K    VTE V   LE   RE  D   NF       + V   G+ Q++  L F+ +     H  I+  +IF+N++ DWK+    ++  I    P     ++ + P    ++                         D +  G LI+  +  ++L R  +     KL                   K+ Q+L H  P            N+ L LD         + F  +  VKTL FL+++  K  E+K  F+  L +L+  FP  + + K LP LL +  QF    +
Sbjct:   84 LRNQANNLAKLKHPNILTLIEPLEEHSKNFMFVTEFVTSSLETVFRETDDEEQNFLQGHVKDNIVVQRGILQLVNALDFVHNRASFVHLNIQPRAIFINENSDWKISGLGYLVKI----PPGTNTSEYFLPQYDPRVPPFMHLQLNYTAPEIVFENTLTFKNDYFSLGLLIYFLYTGKDLFRSENSTSEYKLEYNKFESKISTMSWDNIFSKVPQKLRHCIPKLINRDIYSRYDNITLILD---------SEFFQDPLVKTLNFLDDLPTKNNEEKYVFLEGLVNLLPEFPPALLQKKFLPILLELLSQFCAEKV 385          
BLAST of N terminal kinase protein like vs. Ensembl Nematostella
Match: EDO33568 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRT0])

HSP 1 Score: 344.354 bits (882), Expect = 6.026e-108
Identity = 217/564 (38.48%), Postives = 328/564 (58.16%), Query Frame = 2
Query:  140 NFPYS---RSCENEIKLLNGWILSNAVNKK-GEEFSVFLRDISSIDNLSKGTIQNALKKMKTLKHPDLISYVDSNESIKEVQIVTEKVVPLEKYLREKSDSSNFSFVASWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDFVTNI----GDDLPSSVVQTDL----------YWPMDKS----KIDSYGFGCLIWETFNQNLSRKSDLKETSKLPGQLVKLFQRLTHPKPNMRLNLDNALKEMSGPAGFADNFYVKTLLFLXXXXXXXXXXXXXFMASLTDLVDSFPDDIAKYKILPHLLMCHQFGGAGIEXXXXXXXXXXXXEASEFETSVVPRLVAMFRSSNRTTRVRLLEQLPTFVDVLPFKVVDMDIFPAVVLGLADTNPIVREATIRAVVHLAPKLSHKNLNEILINHLMNLQLKDEQGGIRTNATVCLAKIAHLLATQIRQTSLLNVLLKCTRDPFVPAKXXXXXXXXXXQHLFLVNDVATKLLPCLSFLTVDPEKEVREQTFKALDFALSRLKEASQNPENNKIEPLENKEAQ-KLIGWKNWAVS 1762
            NFPY    +   +E K  + W +     K  G+  +VF  D+ +  +      ++A+K++KTL+HP++++Y+DS ES   + +VTE V PLE Y+ +++ S       SWG+ QI  GL FL + C + H  I + SI+V+ +G+WK+G  ++V  I    G D+  + +   L          Y  M+K       D +G GCLIWE FN  L R + LK   K+P  L+  +  L    P +R N    ++       + DN +V+  LFL E+QIK+ +++++F +SL+  VD+FP+   K++ILP L+   +FG AG  VL PL K+GKLLE+ E+E  +VP +V +F S++R TR++LL+QL  FV  L  +VVD  IFP V LG  DT P +RE T++A++ L PKLS K +N  L+ H   LQ+ D++ GIRTN TVCL KIA  L    RQ  L++  L+  RDPF PA+ + V A   +   + + DVA ++LP L  LTVDPEK+VR+QTFKA+   + +L++AS++PE+      +   A      W  WAV+
Sbjct:    7 NFPYEVGEKLPASESK--SPWSVHQGKKKATGQAVTVFALDVKASSDHKIQLAKSAIKRLKTLRHPNIVTYIDSLESDTLIYLVTEPVTPLEIYMADET-SIKSDLAISWGIHQIAAGLSFLLNDCNLMHGNICMASIYVDVAGEWKLGGVEYVQPIEPPPGADVTDNSILPALQVYDPPEGRKYSKMNKKLQKWSADVWGLGCLIWEVFNGTLPRPASLKTVGKIPKSLLVHYGELVSANPRIRPNPTKFIENCRASGNYLDNAFVEANLFLSELQIKDPKEQKKFFSSLSSSVDTFPEPFCKHRILPQLINAFEFGAAGSAVLGPLFKVGKLLESEEYEKRIVPCVVKLFSSTDRATRIQLLQQLELFVQHLKPQVVDEQIFPHVALGFGDTVPAMREQTVKAMLLLTPKLSEKTINSHLLKHFAKLQM-DQEAGIRTNTTVCLGKIACHLPPATRQKVLVSAFLRPFRDPFPPARTAGVMAFCVTSEFYPLKDVAARILPALCPLTVDPEKKVRDQTFKAVKLFIGKLEKASEDPESAMNTAADQSTADGSASSWTGWAVT 566          
BLAST of N terminal kinase protein like vs. Ensembl Nematostella
Match: EDO34376 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPJ1])

HSP 1 Score: 70.0922 bits (170), Expect = 5.058e-13
Identity = 74/259 (28.57%), Postives = 113/259 (43.63%), Query Frame = 2
Query:  305 MKTLKHPDLISYVDSNESIKEVQIVTEKVVPLEKYLREKSDSSNFSFVASWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVN-KSGDWKVGA------FDFVTNIGDDLPSSVVQTDLYWPMDK---------------SKIDSYGFGCLIWETFNQNLSRKSDL--KETSKLPGQLVKLFQRLTHPKPNMRLNLDNALKEMSGPAGFADNFYVKTLLFLXXXXXXXXXXXXXFMASLTDLVDSFPDDIAKYKILPHLL 1009
            +K L+HP ++ Y  S+    EV +VTE V PLE  L   +D +    VA  G++ I++ LVFL     + HN + L+S++V+   G WK+G       F  VTN   +    +  +    P +K                 +D+Y FG  + +     L  + DL   E+ +    +   F    H  P MR  L   L        F  N Y+  L FL  I +K   DK++F  SL   +   P D+   ++LP LL
Sbjct:   41 LKVLRHPAILKYYSSHNGSDEVAMVTEPVEPLEHVL---NDLAVDEIVA--GIYNIVQALVFLHDNGGLSHNSVGLSSVYVSVYDGAWKLGGMQCVSKFTEVTNEFLETAKPLRDSKSITPEEKVNARDGKISLVPEVYHSLDAYAFGMFVCDV----LESRPDLIGSESDRFSALMQNSF---LHNTPKMRPKLCTLLDNE-----FFKNDYLDVLSFLNNITVKTDIDKEKFFCSLAVKLKGIPADVVAKRLLPRLL 282          
BLAST of N terminal kinase protein like vs. Ensembl Nematostella
Match: EDO49420 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGF7])

HSP 1 Score: 51.6026 bits (122), Expect = 4.244e-7
Identity = 47/165 (28.48%), Postives = 78/165 (47.27%), Query Frame = 2
Query:  260 IDNLSKGTIQNALKK---MKTLKHPDLISYVDSNESIKEVQIVTEKV-VPLEKYLREKSDSSNFSFVASWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDFVTNIGDDLP----SSVVQTDLYWPMD--------KSKIDSYGFGCLIWETFN 706
            +D+  +G   +AL++   +K LKH +++   D   S K++ +V E     L+KY        + S V S+ +FQ+LRGL F  S   + H  ++  ++ +NK G+ K+  F      G  +P    S+ V T  Y P D         + ID +  GC+  E  N
Sbjct:   37 LDDDDEGVPSSALREICLLKELKHNNIVRLYDVLHSEKKLTLVFEFCDQDLKKYFDSCQGEVDASVVKSF-MFQLLRGLAFCHSH-NVLHRDLKPQNLLINKDGELKLADFGLARAFG--IPVRCFSAEVVTLWYRPPDVLMGAKLYSTSIDMWSAGCIFAEMAN 197          
BLAST of N terminal kinase protein like vs. Ensembl Medaka
Match: SCYL1 (SCY1 like pseudokinase 1 [Source:NCBI gene;Acc:101173232])

HSP 1 Score: 350.517 bits (898), Expect = 1.793e-109
Identity = 222/576 (38.54%), Postives = 327/576 (56.77%), Query Frame = 2
Query:  110 MW-LFSKDSSVNFPYSRSCENEIKLLNGWILSNAVNK-KGEEFSVFLRDISSIDNLSKGTIQNALKKMKTLKHPDLISYVDSNESIKEVQIVTEKVVPLEKYLREKSDSSNFS-FVASWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDFVT-NIGDDLPSSVVQTDLYWPMDKSKIDS---------------YGFGCLIWETFNQNLSRKSDLKETSKLPGQLVKLFQRLTHPKPNMRLNLDNALKEMSGPAGFADNFYVKTLLFLXXXXXXXXXXXXXFMASLTDLVDSFPDDIAKYKILPHLLMCHQFGGAGIEXXXXXXXXXXXXEASEFETSVVPRLVAMFRSSNRTTRVRLLEQLPTFVDVLPFKVVDMDIFPAVVLGLADTNPIVREATIRAVVHLAPKLSHKNLNEILINHLMNLQLKDEQGGIRTNATVCLAKIAHLLATQIRQTSLLNVLLKCTRDPFVPAKXXXXXXXXXXQHLFLVNDVATKLLPCLSFLTVDPEKEVREQTFKALDFALSRLKEASQNPEN-NKIEPLENKEAQKLIG---WKNWAVSFI 1768
            MW  F++D   +F Y     +  +    W L     K  GE  SVF+ ++S          + A K+MKTL+HP++++YVD  E+ K + +VTE+V PL  +L+ +++ S       SWGL QI++ L FL + C + HN + + +IFV+++G+WK+GA D V    GD    S+ +    +P D  K D                +  GCLIWE FN  L R S L+   K+P  LV  +  L    P  R N    L+    P GF  N +V++ LFLEEIQIKE  +KQQF   L+D +DSFP+D  K+K+LP LL   +FG AG  +L PL K+GK L A E++  ++P +V MF S++R  R+RLL+Q+  F+  L    V+  IFP VV G  DTNP +RE T+++++ LAPKL+  NLN+ L+     LQ +DEQG IR N TVCL KIA  L    RQ  L++   + T+DPF  ++ + V    A+ + + + ++A ++LP L  +TVDP+K VR+QTFKA+   LS+L+  S++P   ++IE      AQ       W  WAV+ +
Sbjct:    1 MWSFFARDPVKDFGY-EILPDSPERSGIWSLHRGKRKTSGEPVSVFVYEVSQGTEQQTQLAKAAFKRMKTLRHPNILAYVDGLETDKSLYLVTEQVTPLAVHLKAQTEKSGVGELEVSWGLHQIVKALSFLVNDCHLLHNNMGIWAIFVDRAGEWKLGALDHVAPEQGDPSGISLPEPKSVYP-DMEKYDPPEMSNNSGEKWAGEVWRLGCLIWEVFNGPLPRTSSLRSLGKIPKSLVPHYCELVGANPRARPNPARFLQNCRAPGGFLSNSFVESNLFLEEIQIKEPAEKQQFFQELSDNLDSFPEDFCKHKVLPQLLTAFEFGNAGAVILTPLFKVGKFLSADEYQQKIIPVIVKMFSSTDRAMRIRLLQQMEQFIQYLNEAAVNSQIFPHVVHGFTDTNPAIREQTVKSMLLLAPKLNETNLNQELMRQFARLQARDEQGPIRCNTTVCLGKIASYLNAGTRQRILISAFSRATKDPFPASRAAGVLGFAATHNYYSITEIAGRILPTLCTVTVDPDKNVRDQTFKAIKSFLSKLEMVSEDPAKLSEIEKDVESSAQPAGASSSWAGWAVTGV 574          
BLAST of N terminal kinase protein like vs. Ensembl Medaka
Match: SCYL1 (SCY1 like pseudokinase 1 [Source:NCBI gene;Acc:101173232])

HSP 1 Score: 349.362 bits (895), Expect = 5.961e-108
Identity = 222/576 (38.54%), Postives = 327/576 (56.77%), Query Frame = 2
Query:  110 MW-LFSKDSSVNFPYSRSCENEIKLLNGWILSNAVNK-KGEEFSVFLRDISSIDNLSKGTIQNALKKMKTLKHPDLISYVDSNESIKEVQIVTEKVVPLEKYLREKSDSSNFS-FVASWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDFVT-NIGDDLPSSVVQTDLYWPMDKSKIDS---------------YGFGCLIWETFNQNLSRKSDLKETSKLPGQLVKLFQRLTHPKPNMRLNLDNALKEMSGPAGFADNFYVKTLLFLXXXXXXXXXXXXXFMASLTDLVDSFPDDIAKYKILPHLLMCHQFGGAGIEXXXXXXXXXXXXEASEFETSVVPRLVAMFRSSNRTTRVRLLEQLPTFVDVLPFKVVDMDIFPAVVLGLADTNPIVREATIRAVVHLAPKLSHKNLNEILINHLMNLQLKDEQGGIRTNATVCLAKIAHLLATQIRQTSLLNVLLKCTRDPFVPAKXXXXXXXXXXQHLFLVNDVATKLLPCLSFLTVDPEKEVREQTFKALDFALSRLKEASQNPEN-NKIEPLENKEAQKLIG---WKNWAVSFI 1768
            MW  F++D   +F Y     +  +    W L     K  GE  SVF+ ++S          + A K+MKTL+HP++++YVD  E+ K + +VTE+V PL  +L+ +++ S       SWGL QI++ L FL + C + HN + + +IFV+++G+WK+GA D V    GD    S+ +    +P D  K D                +  GCLIWE FN  L R S L+   K+P  LV  +  L    P  R N    L+    P GF  N +V++ LFLEEIQIKE  +KQQF   L+D +DSFP+D  K+K+LP LL   +FG AG  +L PL K+GK L A E++  ++P +V MF S++R  R+RLL+Q+  F+  L    V+  IFP VV G  DTNP +RE T+++++ LAPKL+  NLN+ L+     LQ +DEQG IR N TVCL KIA  L    RQ  L++   + T+DPF  ++ + V    A+ + + + ++A ++LP L  +TVDP+K VR+QTFKA+   LS+L+  S++P   ++IE      AQ       W  WAV+ +
Sbjct:    1 MWSFFARDPVKDFGY-EILPDSPERSGIWSLHRGKRKTSGEPVSVFVYEVSQGTEQQTQLAKAAFKRMKTLRHPNILAYVDGLETDKSLYLVTEQVTPLAVHLKAQTEKSGVGELEVSWGLHQIVKALSFLVNDCHLLHNNMGIWAIFVDRAGEWKLGALDHVAPEQGDPSGISLPEPKSVYP-DMEKYDPPEMSNNSGEKWAGEVWRLGCLIWEVFNGPLPRTSSLRSLGKIPKSLVPHYCELVGANPRARPNPARFLQNCRAPGGFLSNSFVESNLFLEEIQIKEPAEKQQFFQELSDNLDSFPEDFCKHKVLPQLLTAFEFGNAGAVILTPLFKVGKFLSADEYQQKIIPVIVKMFSSTDRAMRIRLLQQMEQFIQYLNEAAVNSQIFPHVVHGFTDTNPAIREQTVKSMLLLAPKLNETNLNQELMRQFARLQARDEQGPIRCNTTVCLGKIASYLNAGTRQRILISAFSRATKDPFPASRAAGVLGFAATHNYYSITEIAGRILPTLCTVTVDPDKNVRDQTFKAIKSFLSKLEMVSEDPAKLSEIEKDVESSAQPAGASSSWAGWAVTGV 574          
BLAST of N terminal kinase protein like vs. Ensembl Medaka
Match: scyl3 (SCY1 like pseudokinase 3 [Source:NCBI gene;Acc:101155267])

HSP 1 Score: 78.9518 bits (193), Expect = 1.029e-14
Identity = 49/158 (31.01%), Postives = 83/158 (52.53%), Query Frame = 2
Query:  152 SRSC----ENEIKLLNGWILSNAVNKKGEEFSVFLRDISSIDNLSKGTIQNALKKMKTLKHPDLISYVDSNESIKEVQIVTEKVVPLEKYLREKSDSSNFSFVASWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDFVTNIGDDLP 613
            +R C    E  + L +G    +AV + G+  +VF+    + D + K     A K +KTL+HP L+ ++  +     + +VTE+V PL+  L    DS +   + + G+F +L+ LVFL    K  HN + ++S+FVN+ G WK+G  + V    +  P
Sbjct:    8 ARGCSLMGEPLLTLPSGLTTYSAVLQDGKPATVFVHRAGNEDKVKK-----AAKHLKTLRHPCLLRFLSCSVQAGAIHLVTERVQPLQLLL----DSLSPEEICA-GIFDLLQALVFLHERGKSSHNNVCISSVFVNEDGHWKLGGMEAVCKFSEATP 155          
BLAST of N terminal kinase protein like vs. Ensembl Medaka
Match: si:ch211-244b2.1 (SCY1 like pseudokinase 2 [Source:NCBI gene;Acc:101171295])

HSP 1 Score: 70.0922 bits (170), Expect = 6.597e-12
Identity = 105/488 (21.52%), Postives = 193/488 (39.55%), Query Frame = 2
Query:  191 WILSNAVNKKG-EEFSVFLRDISSIDNLSK-------GTIQNALKKMKTLKHPDLISYVDSNESIKE-VQIVTEKVV---------------PLEKYLREKSDSSNFSFVASWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDF---VTNIGD------------DLPSSVVQTDLYWPMD-------KSKIDSYGFGCL------------------IWETFNQNLSRKSDLKET--SKLPGQLVKLFQRLTHPKPNMRLNLDNALKEMSGPAGFADNFYVKTLLFLXXXXXXXXXXXXXFMASLTDLVDSFPDDIAKYKILPHLLMCHQFGGAGIEXXXXXXXXXXXXEAS--EFETSVVPRLVAMFR------SSNRTTRVRLLEQLPTFVDVLPFKVVDMDIFPAVVLGLADTNPIVREATIRAVVHLAPKLSHKNLNEILINHLMNLQLKDEQGGIRTNATVCLAKIAHLL 1432
            W + N   K   +E +VF+ D   ID   K        +++  ++++  L+HP L++     E  ++ +   TE V                P+ K ++E      +     +GL QI  GL FL S  K+ H  +   +I +NKSG WK+  FDF    TN  D            +LP   +    Y   +        S  D Y  G +                  I+++F++ L + S +  T   K+P ++ +  + L    PN+R + D   K       F D+    TL + + +  ++   K QF   L  ++   P  +  Y+ILP L    +F    +   +    L    E +  E+   ++P L  +F+      +SN    +  L+++   +   P + +   + P V   +   +  ++E  +  +   A  + + ++   LI  + +  L+     +R N+ VCL KI   L
Sbjct:   47 WRIYNGTKKSTKQEVAVFVFDKKMIDKYQKFDKDQIIDSLKKGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLSNVLGQWDNLPSPVPKDIKEYKL---YDVETKYGLLQISEGLSFLHSGVKMVHGNLCPENIILNKSGAWKIMGFDFSISSTNPSDAEPKYTCKEWEPNLPPLCLPNPEYLAPEYILSVSCDSASDMYSLGVVMHAVFNEGKPVFQVNKHDIFKSFSRQLDQLSSMSPTVLGKIPEEVREHAKMLLSVTPNVRPDADQITK-----IPFFDDVGAVTLQYFDSLFQRDNLQKSQFYKGLPKVLPKLPKRVVVYRILPAL--TSEFVNPDMVPFVLPNVLLIAEECTKEEYVRLIMPDLSPVFKLQEPVQASNMILLI-FLQKMDLLLTKTPPEDIKNSVLPMVYRAVEAPSIQIQELCLNIIPSFANLIDYPSMKNSLIPRIKSACLQTSSLAVRVNSLVCLGKILEYL 523          
BLAST of N terminal kinase protein like vs. Ensembl Medaka
Match: si:ch211-244b2.1 (SCY1 like pseudokinase 2 [Source:NCBI gene;Acc:101171295])

HSP 1 Score: 69.3218 bits (168), Expect = 9.275e-12
Identity = 103/483 (21.33%), Postives = 191/483 (39.54%), Query Frame = 2
Query:  191 WILSNAVNKKG-EEFSVFLRDISSIDNLSK-------GTIQNALKKMKTLKHPDLISYVDSNESIKE-VQIVTEKVV---------------PLEKYLREKSDSSNFSFVASWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDF---VTNIGD------------DLPSSVVQTDLYWPMD-------KSKIDSYGFGCL------------------IWETFNQNLSRKSDLKET--SKLPGQLVKLFQRLTHPKPNMRLNLDNALKEMSGPAGFADNFYVKTLLFLXXXXXXXXXXXXXFMASLTDLVDSFPDDIAKYKILPHLLMCHQFGGAGIEXXXXXXXXXXXXEAS--EFETSVVPRLVAMFRSSNRTTRVRL-LEQLPTFVDVLPFKVVDMDIFPAVVLGLADTNPIVREATIRAVVHLAPKLSHKNLNEILINHLMNLQLKDEQGGIRTNATVCLAKIAHLL 1432
            W + N   K   +E +VF+ D   ID   K        +++  ++++  L+HP L++     E  ++ +   TE V                P+ K ++E      +     +GL QI  GL FL S  K+ H  +   +I +NKSG WK+  FDF    TN  D            +LP   +    Y   +        S  D Y  G +                  I+++F++ L + S +  T   K+P ++ +  + L    PN+R + D   K       F D+    TL + + +  ++   K QF   L  ++   P  +  Y+ILP L    +F    +   +    L    E +  E+   ++P L  +F+       + + L+++   +   P + +   + P V   +   +  ++E  +  +   A  + + ++   LI  + +  L+     +R N+ VCL KI   L
Sbjct:   47 WRIYNGTKKSTKQEVAVFVFDKKMIDKYQKFDKDQIIDSLKKGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLSNVLGQWDNLPSPVPKDIKEYKL---YDVETKYGLLQISEGLSFLHSGVKMVHGNLCPENIILNKSGAWKIMGFDFSISSTNPSDAEPKYTCKEWEPNLPPLCLPNPEYLAPEYILSVSCDSASDMYSLGVVMHAVFNEGKPVFQVNKHDIFKSFSRQLDQLSSMSPTVLGKIPEEVREHAKMLLSVTPNVRPDADQITK-----IPFFDDVGAVTLQYFDSLFQRDNLQKSQFYKGLPKVLPKLPKRVVVYRILPAL--TSEFVNPDMVPFVLPNVLLIAEECTKEEYVRLIMPDLSPVFKLQEPVQILLIFLQKMDLLLTKTPPEDIKNSVLPMVYRAVEAPSIQIQELCLNIIPSFANLIDYPSMKNSLIPRIKSACLQTSSLAVRVNSLVCLGKILEYL 519          
BLAST of N terminal kinase protein like vs. Planmine SMEST
Match: SMESG000008254.1 (SMESG000008254.1)

HSP 1 Score: 1256.51 bits (3250), Expect = 0.000e+0
Identity = 689/694 (99.28%), Postives = 691/694 (99.57%), Query Frame = 2
Query:  110 MWLFSKDSSVNFPYSRSCENEIKLLNGWILSNAVNKKGEEFSVFLRDISSIDNLSKGTIQNALKKMKTLKHPDLISYVDSNESIKEVQIVTEKVVPLEKYLREKSDSSNFSFVASWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDFVTNIGDDLPSSVVQTDLYWPMDKSKIDSYGFGCLIWETFNQNLSRKSDLKETSKLPGQLVKLFQRLTHPKPNMRLNLDNALKEMSGPAGFADNFYVKTLLFLXXXXXXXXXXXXXFMASLTDLVDSFPDDIAKYKILPHLLMCHQFGGAGIEXXXXXXXXXXXXEASEFETSVVPRLVAMFRSSNRTTRVRLLEQLPTFVDVLPFKVVDMDIFPAVVLGLADTNPIVREATIRAVVHLAPKLSHKNLNEILINHLMNLQLKDEQGGIRTNATVCLAKIAHLLATQIRQTSLLNVLLKCTRDPFVPAKXXXXXXXXXXQHLFLVNDVATKLLPCLSFLTVDPEKEVREQTFKALDFALSRLKEASQNPENNKIEPLENKEAQKLIGWKNWAVSFIXXXXXXXXXXXXXXXXXXXXEPARETNITKTLSPESMKIANPDKIVVRQQIIDHXXXXXXXXXXWAPLEDIGFDSQPTVRSIETTWDSNPDDFFDNIIKESAPVKPQSKLQLKKTIEVKKHVSNNKKSPTSNEDGWGDVDW 2191
            MWLFSKDSSVNFPYSRSCENEIKLLNGWILSNAVNKKGEEFSVFLRDISSIDNLSKGTIQNALKKMKTLKHPDLISYVDSNESIKEVQIVTEKVVPLEKYLREKSDSSNFSFVASWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDFVTNIGDDLPSSVVQTDLYWPMDKSKIDSYGFGCLIWETFN+NLSRKSDLKETSKLPGQLVKLFQRLTHPKPNMRLNLDNALKEMSGPAGFADNFYVKTLLFLEEIQIKEQEDKQQFMASLTDLVDSFPDDIAKYKILPHLLMCHQFGGAGIEVLLPLVKLGKLLEASEFETSVVPRLVAMFRSSNRTTRVRLLEQLPTFVDVLPFKVVDMDIFPAVVLGLADTNPIVREATIRAVVHLAPKLSHKNLNEILINHLMNLQLKDEQGGIRTNATVCLAKIAHLLATQIRQTSLLNVLLKCTRDPFVPAKLSAVSALVASQHLFLVNDVATKLLPCLSFLTVDPEKEVREQTFKALDFALSRLKEASQNPENNKIEPLENKEAQKLIGWKNWAVSFIKKNETTTSKNNTTTLTNHSSEPARETNITKTLSPE MKIANPDKIV RQQIIDHNEEENDDDNEWAPLEDIGFDSQPTVRSI+TTWDSNPDDFFDNIIKESAPVKPQSKLQLKKTIEVKKHVSNN KSPTSNEDGWGDVDW
Sbjct:    1 MWLFSKDSSVNFPYSRSCENEIKLLNGWILSNAVNKKGEEFSVFLRDISSIDNLSKGTIQNALKKMKTLKHPDLISYVDSNESIKEVQIVTEKVVPLEKYLREKSDSSNFSFVASWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSGDWKVGAFDFVTNIGDDLPSSVVQTDLYWPMDKSKIDSYGFGCLIWETFNRNLSRKSDLKETSKLPGQLVKLFQRLTHPKPNMRLNLDNALKEMSGPAGFADNFYVKTLLFLEEIQIKEQEDKQQFMASLTDLVDSFPDDIAKYKILPHLLMCHQFGGAGIEVLLPLVKLGKLLEASEFETSVVPRLVAMFRSSNRTTRVRLLEQLPTFVDVLPFKVVDMDIFPAVVLGLADTNPIVREATIRAVVHLAPKLSHKNLNEILINHLMNLQLKDEQGGIRTNATVCLAKIAHLLATQIRQTSLLNVLLKCTRDPFVPAKLSAVSALVASQHLFLVNDVATKLLPCLSFLTVDPEKEVREQTFKALDFALSRLKEASQNPENNKIEPLENKEAQKLIGWKNWAVSFIKKNETTTSKNNTTTLTNHSSEPARETNITKTLSPEPMKIANPDKIVARQQIIDHNEEENDDDNEWAPLEDIGFDSQPTVRSIDTTWDSNPDDFFDNIIKESAPVKPQSKLQLKKTIEVKKHVSNNIKSPTSNEDGWGDVDW 694          
The following BLAST results are available for this feature:
BLAST of N terminal kinase protein like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SCYL12.111e-11339.15SCY1 like pseudokinase 1 [Source:HGNC Symbol;Acc:H... [more]
SCYL12.187e-11339.15SCY1 like pseudokinase 1 [Source:HGNC Symbol;Acc:H... [more]
SCYL13.553e-11339.15SCY1 like pseudokinase 1 [Source:HGNC Symbol;Acc:H... [more]
SCYL13.817e-11339.15SCY1 like pseudokinase 1 [Source:HGNC Symbol;Acc:H... [more]
SCYL14.663e-11339.15SCY1 like pseudokinase 1 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of N terminal kinase protein like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
W07G4.33.718e-9336.79pep chromosome:WBcel235:V:13038589:13041879:-1 gen... [more]
W07G4.33.718e-9336.79pep chromosome:WBcel235:V:13037016:13041879:-1 gen... [more]
W07G4.33.718e-9336.79pep chromosome:WBcel235:V:13036996:13041879:-1 gen... [more]
back to top
BLAST of N terminal kinase protein like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
yata2.377e-11739.93gene:FBgn0260990 transcript:FBtr0333822[more]
yata2.377e-11739.93gene:FBgn0260990 transcript:FBtr0085477[more]
CG13441.025e-930.28gene:FBgn0027507 transcript:FBtr0086034[more]
CG13441.025e-930.28gene:FBgn0027507 transcript:FBtr0331967[more]
CG19512.872e-823.65gene:FBgn0039623 transcript:FBtr0085342[more]
back to top
BLAST of N terminal kinase protein like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scyl11.231e-11340.14SCY1-like, kinase-like 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
scyl32.094e-1430.71SCY1-like, kinase-like 3 [Source:ZFIN;Acc:ZDB-GENE... [more]
scyl38.689e-1324.22SCY1-like, kinase-like 3 [Source:ZFIN;Acc:ZDB-GENE... [more]
SCYL25.569e-823.51si:ch211-244b2.1 [Source:ZFIN;Acc:ZDB-GENE-041210-... [more]
SCYL25.569e-823.51si:ch211-244b2.1 [Source:ZFIN;Acc:ZDB-GENE-041210-... [more]
back to top
BLAST of N terminal kinase protein like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scyl12.786e-11839.79SCY1-like, kinase-like 1 [Source:NCBI gene;Acc:548... [more]
scyl13.541e-11839.83SCY1-like, kinase-like 1 [Source:NCBI gene;Acc:548... [more]
scyl16.451e-11839.79SCY1-like, kinase-like 1 [Source:NCBI gene;Acc:548... [more]
scyl11.372e-11739.79SCY1-like, kinase-like 1 [Source:NCBI gene;Acc:548... [more]
scyl11.123e-11640.96SCY1-like, kinase-like 1 [Source:NCBI gene;Acc:548... [more]
back to top
BLAST of N terminal kinase protein like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Scyl11.809e-11238.79SCY1-like 1 (S. cerevisiae) [Source:MGI Symbol;Acc... [more]
Scyl13.440e-11238.79SCY1-like 1 (S. cerevisiae) [Source:MGI Symbol;Acc... [more]
Scyl14.631e-11238.79SCY1-like 1 (S. cerevisiae) [Source:MGI Symbol;Acc... [more]
Scyl17.561e-11238.79SCY1-like 1 (S. cerevisiae) [Source:MGI Symbol;Acc... [more]
Scyl12.435e-3831.33SCY1-like 1 (S. cerevisiae) [Source:MGI Symbol;Acc... [more]
back to top
BLAST of N terminal kinase protein like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q28FH2|SCYL1_XENTR7.268e-11739.79N-terminal kinase-like protein OS=Xenopus tropical... [more]
sp|Q561M0|SCYL1_XENLA5.769e-11539.27N-terminal kinase-like protein OS=Xenopus laevis O... [more]
sp|A6QLH6|SCYL1_BOVIN6.792e-11338.79N-terminal kinase-like protein OS=Bos taurus OX=99... [more]
sp|Q96KG9|SCYL1_HUMAN1.833e-11239.15N-terminal kinase-like protein OS=Homo sapiens OX=... [more]
sp|Q9EQC5|SCYL1_MOUSE5.289e-11138.79N-terminal kinase-like protein OS=Mus musculus OX=... [more]
back to top
BLAST of N terminal kinase protein like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2L3G91.822e-13244.92Protein kinase domain-containing protein OS=Opisth... [more]
A0A1S8X0C79.139e-13244.92HEAT repeat protein (Fragment) OS=Opisthorchis viv... [more]
G7Y7W11.227e-13144.92SCY1-like protein OS=Clonorchis sinensis OX=79923 ... [more]
A0A267ER904.511e-13041.30Protein kinase domain-containing protein (Fragment... [more]
A0A1I8GL387.359e-12941.31Protein kinase domain-containing protein OS=Macros... [more]
back to top
BLAST of N terminal kinase protein like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scyl15.367e-11137.52SCY1 like pseudokinase 1 [Source:NCBI gene;Acc:103... [more]
scyl31.891e-2225.06SCY1 like pseudokinase 3 [Source:NCBI gene;Acc:103... [more]
scyl31.960e-2225.06SCY1 like pseudokinase 3 [Source:NCBI gene;Acc:103... [more]
si:ch211-244b2.11.506e-723.28SCY1 like pseudokinase 2 [Source:NCBI gene;Acc:103... [more]
si:ch211-244b2.11.641e-723.28SCY1 like pseudokinase 2 [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of N terminal kinase protein like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000003368.12.335e-1220.43pep scaffold:Pmarinus_7.0:GL479057:9948:36045:-1 g... [more]
back to top
BLAST of N terminal kinase protein like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SCY14.323e-723.17Putative kinase; suppressor of GTPase mutant; simi... [more]
back to top
BLAST of N terminal kinase protein like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO335686.026e-10838.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343765.058e-1328.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494204.244e-728.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of N terminal kinase protein like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SCYL11.793e-10938.54SCY1 like pseudokinase 1 [Source:NCBI gene;Acc:101... [more]
SCYL15.961e-10838.54SCY1 like pseudokinase 1 [Source:NCBI gene;Acc:101... [more]
scyl31.029e-1431.01SCY1 like pseudokinase 3 [Source:NCBI gene;Acc:101... [more]
si:ch211-244b2.16.597e-1221.52SCY1 like pseudokinase 2 [Source:NCBI gene;Acc:101... [more]
si:ch211-244b2.19.275e-1221.33SCY1 like pseudokinase 2 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of N terminal kinase protein like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000008254.10.000e+099.28SMESG000008254.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022102 ID=SMED30022102|Name=N terminal kinase protein like|organism=Schmidtea mediterranea sexual|type=transcript|length=2212bp
ATTTTGTCGCGTGTAAATATTTTATGAAATCTTATGGTATTTTATAATTT
TAATAATTAAGTTACTCATTAGATTTTATTAAGTTGAAATATCTAAAACG
AAATTATATATGTGGCTTTTTTCTAAAGATTCTTCTGTGAATTTTCCCTA
TAGTCGATCATGTGAGAATGAAATTAAATTACTTAATGGTTGGATTTTAA
GTAATGCAGTAAATAAGAAAGGAGAAGAGTTTTCTGTTTTTCTACGTGAC
ATATCAAGTATAGATAATTTGTCAAAAGGAACAATTCAGAATGCCTTAAA
AAAGATGAAAACTCTAAAACACCCAGATTTAATAAGCTATGTTGATAGTA
ATGAATCAATAAAAGAAGTACAGATAGTCACTGAAAAAGTTGTACCACTA
GAAAAATATCTCAGAGAAAAAAGTGACAGTTCAAATTTTTCCTTTGTAGC
ATCCTGGGGTTTATTTCAAATTTTACGCGGGCTAGTCTTTTTAAGTTCGA
CTTGTAAAATTCAGCACAATCAAATTAGGCTAACTTCAATTTTTGTAAAC
AAATCTGGAGATTGGAAAGTTGGAGCATTTGATTTTGTTACTAACATTGG
AGATGATTTACCATCTTCAGTGGTACAAACTGATCTCTATTGGCCAATGG
ATAAAAGTAAAATAGATAGTTACGGATTTGGTTGCTTAATTTGGGAGACT
TTTAATCAAAATTTATCTCGAAAGTCGGATTTAAAAGAAACTTCAAAATT
ACCCGGCCAATTAGTGAAATTGTTTCAGAGATTAACTCATCCAAAACCTA
ATATGAGGCTGAATTTAGATAATGCATTAAAGGAAATGAGTGGGCCTGCT
GGCTTTGCCGATAATTTCTATGTGAAAACACTTCTATTTTTAGAAGAAAT
TCAAATTAAAGAACAAGAGGATAAACAACAATTTATGGCTAGTCTTACCG
ATTTGGTTGATAGTTTTCCCGACGACATAGCAAAATATAAAATATTACCT
CACCTGTTGATGTGTCATCAGTTCGGAGGGGCGGGAATTGAAGTTTTATT
ACCTTTAGTGAAATTAGGTAAACTTCTTGAAGCATCTGAATTCGAAACGA
GTGTAGTCCCTCGTCTCGTGGCAATGTTCAGAAGTAGTAATAGAACGACT
CGGGTTAGATTGCTGGAACAGTTACCAACATTTGTCGATGTTCTCCCGTT
TAAAGTTGTCGATATGGATATTTTCCCTGCCGTTGTTCTCGGATTAGCAG
ACACAAATCCAATCGTTCGAGAGGCAACCATTCGTGCAGTTGTCCACTTA
GCTCCGAAATTGAGTCATAAAAATCTCAATGAAATCCTAATCAACCATTT
AATGAATCTTCAACTAAAAGATGAACAAGGTGGAATCAGAACAAATGCAA
CAGTATGTTTAGCTAAAATTGCTCATTTATTGGCCACTCAAATTCGTCAA
ACTAGTCTACTGAATGTGCTTCTAAAGTGCACAAGAGATCCATTCGTACC
AGCAAAATTAAGTGCTGTATCTGCACTCGTTGCTTCACAACATCTCTTCT
TAGTTAATGACGTAGCTACTAAATTATTGCCATGTCTTTCTTTCTTAACA
GTAGATCCAGAAAAAGAAGTTCGAGAACAGACGTTTAAAGCTTTGGATTT
TGCTCTTTCTCGTCTTAAAGAAGCATCTCAGAATCCAGAAAACAATAAAA
TAGAGCCCCTTGAAAATAAAGAAGCCCAAAAATTGATCGGTTGGAAAAAT
TGGGCTGTAAGTTTCATTAAAAAAAATGAAACGACAACTTCTAAAAACAA
TACAACAACACTAACCAATCATTCGTCGGAACCAGCTCGCGAAACGAACA
TCACAAAAACCCTCTCACCAGAGTCAATGAAAATTGCCAATCCTGACAAG
ATTGTAGTTCGCCAACAAATAATAGATCACAACGAGGAAGAAAATGACGA
CGACAATGAATGGGCACCATTGGAAGACATTGGATTTGATTCTCAGCCCA
CCGTCAGGAGCATCGAGACAACATGGGATAGCAATCCCGATGATTTCTTC
GATAATATCATTAAAGAATCGGCACCTGTGAAACCTCAAAGCAAATTGCA
ATTAAAGAAGACAATCGAGGTCAAGAAACACGTTTCCAATAATAAAAAGT
CACCCACATCAAATGAAGACGGCTGGGGAGATGTTGATTGGTAGTTTTAT
TTTTGGTGCTAG
back to top

protein sequence of SMED30022102-orf-1

>SMED30022102-orf-1 ID=SMED30022102-orf-1|Name=SMED30022102-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=695bp
MWLFSKDSSVNFPYSRSCENEIKLLNGWILSNAVNKKGEEFSVFLRDISS
IDNLSKGTIQNALKKMKTLKHPDLISYVDSNESIKEVQIVTEKVVPLEKY
LREKSDSSNFSFVASWGLFQILRGLVFLSSTCKIQHNQIRLTSIFVNKSG
DWKVGAFDFVTNIGDDLPSSVVQTDLYWPMDKSKIDSYGFGCLIWETFNQ
NLSRKSDLKETSKLPGQLVKLFQRLTHPKPNMRLNLDNALKEMSGPAGFA
DNFYVKTLLFLEEIQIKEQEDKQQFMASLTDLVDSFPDDIAKYKILPHLL
MCHQFGGAGIEVLLPLVKLGKLLEASEFETSVVPRLVAMFRSSNRTTRVR
LLEQLPTFVDVLPFKVVDMDIFPAVVLGLADTNPIVREATIRAVVHLAPK
LSHKNLNEILINHLMNLQLKDEQGGIRTNATVCLAKIAHLLATQIRQTSL
LNVLLKCTRDPFVPAKLSAVSALVASQHLFLVNDVATKLLPCLSFLTVDP
EKEVREQTFKALDFALSRLKEASQNPENNKIEPLENKEAQKLIGWKNWAV
SFIKKNETTTSKNNTTTLTNHSSEPARETNITKTLSPESMKIANPDKIVV
RQQIIDHNEEENDDDNEWAPLEDIGFDSQPTVRSIETTWDSNPDDFFDNI
IKESAPVKPQSKLQLKKTIEVKKHVSNNKKSPTSNEDGWGDVDW*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000099neuron
PLANA:0000101muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR021133HEAT_type_2
IPR016024ARM-type_fold
IPR011009Kinase-like_dom_sf
IPR000719Prot_kinase_dom
IPR011989ARM-like
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0005488binding
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 94..227
e-value: 8.2E-23
score: 82.9
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 2..93
e-value: 4.8E-13
score: 50.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 673..694
NoneNo IPR availablePANTHERPTHR12984:SF3N-TERMINAL KINASE-LIKE PROTEINcoord: 5..630
NoneNo IPR availablePANTHERPTHR12984SCY1-RELATED S/T PROTEIN KINASE-LIKEcoord: 5..630
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 249..528
e-value: 8.3E-73
score: 247.4
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 50..222
e-value: 1.0E-8
score: 34.9
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 1..254
score: 10.535
IPR021133HEAT, type 2PROSITEPS50077HEAT_REPEATcoord: 371..408
score: 9.112
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 50..241
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 260..522