Down syndrome cell adhesion molecule

Overview
NameDown syndrome cell adhesion molecule
Smed IDSMED30022101
Length (bp)6411
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Down syndrome cell adhesion molecule (SMED30022101) t-SNE clustered cells

Violin plots show distribution of expression levels for Down syndrome cell adhesion molecule (SMED30022101) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Down syndrome cell adhesion molecule (SMED30022101) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Down syndrome cell adhesion molecule (SMED30022101) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022101

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30022101SMESG000048977.1 SmedASXL_010955SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30022101SMESG000048977.1 dd_Smed_v4_5856_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30022101SMESG000048977.1 dd_Smed_v4_5856_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30022101SMESG000048977.1 dd_Smed_v4_5856_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30022101SMESG000048977.1 dd_Smed_v4_5856_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30022101SMESG000048977.1 dd_Smed_v4_5856_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30022101SMESG000048977.1 dd_Smed_v4_5856_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022101SMESG000048977.1 Contig38783newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022101SMESG000048977.1 Contig38783uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022101SMESG000052241.1 SMESG000048977.1 SMESG000040582.1 Contig40352newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022101SMESG000052241.1 SMESG000048977.1 SMESG000040582.1 Contig40352uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Human
Match: DSCAM (DS cell adhesion molecule [Source:HGNC Symbol;Acc:HGNC:3039])

HSP 1 Score: 307.76 bits (787), Expect = 1.916e-83
Identity = 431/1767 (24.39%), Postives = 705/1767 (39.90%), Query Frame = 3
Query:   93 LCHFITFKNVNSFDHKSFFFFLNRHKRYAEERNLEPPKLINVQKSFVTTMTDHSRVYCTATGNPSPKIKWYYETTQRNVFTEVND-PDRFVVGTNGDMDIF----------IQANIEVIYCKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRNIYTDIDVKSHDWISPKRLEDNSKIDFTSICQNIEVR-VIKGSTLELPWCSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTV----VNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLN-NLKISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQISIDNLVFKESP-----PLDYSIVLGQSFALNCSAKPTNIQLKTNWFXXXXXXXXXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKEDGNWDSLPVKRIKEKSKVSRFFVKFESVTDSLF-------------GEYKCVASNEHRKNGVERIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWKLVTENWFINATTKET-----SITIEDLRPFKEYDIAIVAENSVGYGEEAT-IIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSP-AKYVAIRTLEDKPEGTP--IQVLC-SPKANFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNVKETH--LKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIKAYFYQNCLK-VSWTPPIKANGHIREYIIVFSFEPNNMITVSSRENDKPYYSWELCSEQICSNCNVSVLAVTTM-KGPRK---TVNVLSNKMG-ILSFXXXXXXXXXXXXXLYCE-VAFPDENIYYLWTHNDK----DIYG-QGVQSNGSLVINSMAESDQGIYKCKV----KSEEITYNVSTKSISLVPQTPYIEITKVSTNHIALLW--RSNGSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSN-PAISQAQTRGSIPEIPDTSNIVTEIGPHSMCFNLRAFRPGRGCPANKYILKLWPSSEGNHQESGVSVWKVVNDSDLNQIPCFNVTDLHPNTDYVYSIEASNMVGSQKAKAHNKTRQI-VSTAPPNI 5192
            L  F +F NV S D  S  +F+N                    +  V   T  + V C A G P   ++WY  T +     E+ D P    V  NG + IF          I  N    YC A+N  G +RS+ + + K +  +   VR E ++      AV  C++  ++ AYI  V  WE     D+  ++    +  RF + +      L+I++V   D      RCI R+ YT    +S+   S +    +      SI    + R  + G  +ELP C    + +  + W          + LSG   K ++     LLI+NI  ++ G Y        SN Y T  V   + V   +K T+    V +     V L C  TG     L W  NG   N  K+    T  +  + I   +     G YQC        ++++ ++D   V V++ +  P +I          S  +  + +      + C     P  T+ W LDD  I      +   ++R+   + +   + +S +     + + GG YR    N  G       I V     IR   +IT   G +  + C VI     +I+W++++      LP  H Q   E+     +  V K +  G+Y CN  +   L  S++  VT+  PP +                         QP       +EF        V       +   DL I I +QK         +G  +P G         +  + + I     +H    +C+ +N A  +    Q     L+ +  P     P D   + G++  LNCSA+   +      F+  +         +  RI  L NG+L++K++   D   ++C +   VG D +SK + + +K+PA I + P+     +  +  ++CT HG+  + V+W  KED         RI    +++R+ V  + V + +              G + C A N + ++    II L V + P    I  E     +R+I + W     DG  PIT Y +  K  +++W     TK+      S TI D+ P   Y I + A+N +G  E +  + I     AP+GP   +    +S   +++ W++P + L NGI + YQ+   E     N      +  +  DS    +D  N                        FT+Y   V   N  G  P ++ +   TLED P   P  +Q +  SP++  + + W+   +   NG++ G+ V Y+++    E  ++ KN+  T   L+L  L   + Y IQ+      G G  SE I   T E  P PP  +KA      +  VSW PP+K NG IR+Y  VF   P   + +S  E     +S+ + +       +V V+AVT+  +G      TV  L+     IL+FS ++       +VL C+ V  P   + ++   N       I G + + SNGS +I ++   D G Y C       S+EI  N+    + + P  P + ++K +++ I L W    NG       I  +++     N        +S + RS  + NL+CGT Y   L A+N  GP     I +A+T G  P+      +   I    +  NL  +  G GCP   + L+  P         G +VW     + L++   + + DL   T Y   +   N  G  + +A+  T     ST PP I
Sbjct:    6 LSLFQSFANVFSEDLHSSLYFVNAS-----------------LQEVVFASTTGTLVPCPAAGIPPVTLRWYLATGE-----EIYDVPGIRHVHPNGTLQIFPFPPSSFSTLIHDN--TYYCTAENPSGKIRSQDVHI-KAVLREPYTVRVEDQKTMRGNVAVFKCIIPSSVEAYITVVS-WE----KDTVSLV----SGSRFLITSTGA---LYIKDVQNED-GLYNYRCITRHRYTGETRQSN---SARLFVSDPANSAPSILDGFDHRKAMAGQRVELP-CKALGHPEPDYRWLK----DNMPLELSGRFQKTVT----GLLIENIRPSDSGSYVCEV----SNRYGTAKVIGRLYVKQPLKATISPRKVKSSVGSQVSLSCSVTGTEDQELSWYRNGEILNPGKNVRI-TGINHENLIMDHMVKSDGGAYQCFVR-----KDKLSAQDY--VQVVLEDGTPKII----------SAFSEKVVSPAEPVSLMCNVKGTPLPTITWTLDDDPI------LKGGSHRISQMITSEGNV-VSYLNISSSQVRDGGVYRCTANNSAGVVLYQARINVRGPASIRPMKNITAIAGRDTYIHCRVIGYPYYSIKWYKNSN----LLPFNHRQVAFENNGTLKLSDVQKEVDEGEYTCNVLVQPQLSTSQSVHVTVKVPPFI-------------------------QP-------FEFPRFSIGQRV--FIPCVVVSGDLPITITWQK---------DGRPIP-GSLGVTIDNIDFTSSLRISNLSLMHNGNYTCIARNEAAAVEHQSQ-----LIVRVPPKFVVQPRDQDGIYGKAVILNCSAEGYPVPTIVWKFSKGAGVPQFQPIALNGRIQVLSNGSLLIKHVVEEDSGYYLCKVSNDVGAD-VSKSMYLTVKIPAMITSYPNTTLATQGQKKEMSCTAHGEKPIIVRW-EKED---------RIINP-EMARYLVSTKEVGEEVISTLQILPTVREDSGFFSCHAINSYGED--RGIIQLTVQEPPDPPEI--EIKDVKARTITLRWT-MGFDGNSPITGYDIECKNKSDSWDSAQRTKDVSPQLNSATIIDIHPSSTYSIRMYAKNRIGKSEPSNELTITADEAAPDGPPQEVHLEPISSQSIRVTWKAPKKHLQNGIIRGYQIGYREYSTGGNFQFNIISVDTSGDSEVYTLDNLNK-----------------------FTQYGLVVQACNRAGTGPSSQEIITTTLEDVPSYPPENVQAIATSPES--ISISWSTLSKEALNGILQGFRVIYWANLMDGELGEI-KNITTTQPSLELDGLEKYTNYSIQVLAFTRAGDGVRSEQIFTRTKEDVPGPPAGVKAAAASASMVFVSWLPPLKLNGIIRKY-TVFCSHPYPTV-ISEFEASPDSFSYRIPNLSRNRQYSVWVVAVTSAGRGNSSEIITVEPLAKAPARILTFSGTVTTPWMKDIVLPCKAVGDPSPAVKWMKDSNGTPSLVTIDGRRSIFSNGSFIIRTVKAEDSGYYSCIANNNWGSDEIILNL---QVQVPPDQPRLTVSKTTSSSITLSWLPGDNGGSS----IRGYILQYSEDNSEQWGSFPISPSERSYRLENLKCGTWYKFTLTAQNGVGPGRISEIIEAKTLGKEPQFSKEQELFASINTTRVRLNLIGWNDG-GCPITSFTLEYRP--------FGTTVWTTAQRTSLSK--SYILYDLQEATWYELQMRVCNSAGCAEKQANFATLNYDGSTIPPLI 1577          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Human
Match: DSCAML1 (DS cell adhesion molecule like 1 [Source:HGNC Symbol;Acc:HGNC:14656])

HSP 1 Score: 285.804 bits (730), Expect = 1.356e-76
Identity = 412/1712 (24.07%), Postives = 676/1712 (39.49%), Query Frame = 3
Query:  258 VYCTATGNPSPKIKWYYETTQRNVFTEVND-PDRFVVGTNGDMDI----------FIQANIEVIYCKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRNIYTDIDVKSHDWISPKRLEDNSKIDFTSICQNIEV--------RVIKGSTLELPWCSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRL-PYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLN-NLKISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQISIDNLVFKESP-----PLDYSIVLGQSFALNCSAK---PTNIQLKTNWFXXXXXXXXXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKEDGNWDSLPVKRIKEKSK------VSRFFVKFESVTDSLFGEYKCVASNEHRKNGVERIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWKLVTENWFINATTKETSITIE-----DLRPFKEYDIAIVAENSVGYGEEAT-IIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSPAKY-VAIRTLEDKPEGTPIQVLC-SPKANFLFLEWNPPPQNVTNGVISGYEVTYFS---DDKHEEPDKLMKNVKET--HLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIK-AYFYQNCLKVSWTPPIKANGHIREYIIVFSFEPNNMITVSSRENDKPYYSWELCSEQICSNCNVSVLAVTTMKGPRKTVNVLSNKMG-----ILSFXXXXXXXXXXXXXLYCEVAFPDENIYYLWTHNDKD----IYGQG---VQSNGSLVINSMAESDQGIYKCKVKSEEITYNVSTKSISLV----PQTPYIEITKVSTNHIALLW--RSNGSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSN-PAISQAQTRGSIPEIPDTSNIVTEIGPHSMCFNLRAFRPGRGCPANKYILKLWPSSEGNHQESGVSVWKVVNDSDLNQIPCFNVTDLHPNTDYVYSIEASNMVGSQKAKAHNKTRQI-VSTAPP 5186
            V C A G+PS  ++WY  T       ++ D P    V  NG + +          FI  N    +C A+N  G +RS  I V K +  +   VR E +       AV  CL+  ++  Y+  V  WE     D+  ++     E RF +        L+I +V K D +    RCI +          H +    R  + +++  T   ++I           V  G T+ELP C+       A  W   +   R L   + S++   ++    L I ++   + G Y         +   T  + V+  + V + P  +       V L C  TG P  ++ W  N  E        +    S  + +        +G YQC A  +        ++D    F IIA     L   +P +  S+S     +   G  F + C     P  TV W LDD+ I      + + ++R   YT+     I  S M     + + GG YR    N  G A     I V     IR   +IT   G +  + C VI     +I+W++DA    + LP+ H Q V E+G L + + V K +  G+Y+C+  +   L IS++  V +  PP++                         QP       +EF  A       L     ++  D+ I I ++K     +   +G+ +      F+     +I+ + +K+N        +C+  N A T+ +  Q     L+ +  P     P +   + G++  LNCS     P  +  K        +        +  RI  LPN +L+++++   D   ++C     VG D ISK + + +K+PA I + P+     + +   LNCT  G+  + ++W  K D   D   V R    +K      VS   +K     DS+F  + C A N + ++    +I L V + P    +  E     +RS+ + W     DG   IT + + +K  +++W    +T+  S TI      DL P   Y I + + N +G  E +  + I T+  AP+GP +++    V+   +++ W++P + L NG+ + YQ+   E     N         +  DS                        V T+  L  F +Y   V   N  G  P+   +   TLED P   P  V   S  ++   + W+ PP++  NGV+ GY V ++S   D +  E    M+N+  T   ++L  +   + Y +Q+      G G  S  +   T E  P PP  IK      + + VSW PP K NG IR+Y I  S   +     S  E       + +          + V AVT+      +  V     G     I+SF  ++       V L C  +  D      WT + +D    +   G   + +NG+L++ ++   D G Y C   +   T    T  ++L+    P  P + ++K S + I L W    NG       I  F++     N    +++ +SS+ RS  + +L+CGT Y V L AKN  G      I +A+T G  P      ++ T I       NL+ +  G GCP    +L+  P         G   W+ +  +   ++    +T+L   T Y   + A N  G     A   T     ST PP
Sbjct:   45 VPCPAAGSPSAALRWYLATGD-----DIYDVPHIRHVHANGTLQLYPFSPSAFNSFIHDND--YFCTAENAAGKIRSPNIRV-KAVFREPYTVRVEDQRSMRGNVAVFKCLIPSSVQEYVSVVS-WE----KDTVSIIP----EHRFFITYHGG---LYISDVQKED-ALSTYRCITK----------HKYSGETRQSNGARLSVTDPAESIPTILDGFHSQEVWAGHTVELP-CTASGYPIPAIRW---LKDGRPLP--ADSRW---TKRITGLTISDLRTEDSGTYICEVTNTFGSAEATGILMVIDPLHVTLTPKKLKTGIGSTVILSCALTGSPEFTIRWYRN-TELVLPDEAISIRGLSNETLLITSAQKSHSGAYQCFATRKAQT-----AQD----FAIIA-----LEDGTPRIVSSFSEK---VVNPGEQFSLMCAAKGAPPPTVTWALDDEPI------VRDGSHRTNQYTMSDGTTI--SHMNVTGPQIRDGGVYRCTARNLVGSAEYQARINVRGPPSIRAMRNITAVAGRDTLINCRVIGYPYYSIKWYKDA----LLLPDNHRQVVFENGTLKLTD-VQKGMDEGEYLCSVLIQPQLSISQSVHVAVKVPPLI-------------------------QP-------FEFPPASIGQL--LYIPCVVSSGDMPIRITWRK---DGQVIISGSGVTIESKEFM--SSLQISSVSLKHN-----GNYTCIASNAAATVSRERQ-----LIVRVPPRFVVQPNNQDGIYGKAGVLNCSVDGYPPPKVMWKHA--KGSGNPQQYHPVPLTGRIQILPNSSLLIRHVLEEDIGYYLCQASNGVGTD-ISKSMFLTVKIPAMITSHPNTTIAIKGHAKELNCTARGERPIIIRW-EKGDTVIDPDRVMRYAIATKDNGDEVVSTLKLKPADRGDSVF--FSCHAINSYGED--RGLIQLTVQEPPDPPEL--EIREVKARSMNLRWTQ-RFDGNSIITGFDIEYKNKSDSWDFKQSTRNISPTINQANIVDLHPASVYSIRMYSFNKIGRSEPSKELTISTEEAAPDGPPMDVTLQPVTSQSIQVTWKAPKKELQNGVIRGYQIGYRENSPGSNGQYSIVEMKATGDSE-----------------------VYTLDNLKKFAQYGVVVQAFNRAGTGPSSSEINATTLEDVPSQPPENVRALSITSDVAVISWSEPPRSTLNGVLKGYRVIFWSLYVDGEWGE----MQNITTTRERVELRGMEKFTNYSVQVLAYTQAGDGVRSSVLYIQTKEDVPGPPAGIKAVPSSASSVVVSWLPPTKPNGVIRKYTIFCSSPGSGQPAPSEYETSPEQLFYRIAHLNRGQQYLLWVAAVTSAGRGNSSEKVTIEPAGKAPAKIISFGGTVTTPWMKDVRLPCN-SVGDPAPAVKWTKDSEDSAIPVSMDGHRLIHTNGTLLLRAVKAEDSGYYTCTATN---TGGFDTIIVNLLVQVPPDQPRLTVSKTSASSITLTWIPGDNGGSS----IRGFVLQYSVDNSEEWKDVFISSSERSFKLDSLKCGTWYKVKLAAKNSVGSGRISEIIEAKTHGREPSFSKDQHLFTHINSTHARLNLQGWNNG-GCPITAIVLEYRP--------KGTWAWQGLRANSSGEV---FLTELREATWYELRMRACNSAGCGNETAQFATLDYDGSTIPP 1578          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Human
Match: DSCAML1 (DS cell adhesion molecule like 1 [Source:HGNC Symbol;Acc:HGNC:14656])

HSP 1 Score: 285.804 bits (730), Expect = 1.389e-76
Identity = 412/1712 (24.07%), Postives = 676/1712 (39.49%), Query Frame = 3
Query:  258 VYCTATGNPSPKIKWYYETTQRNVFTEVND-PDRFVVGTNGDMDI----------FIQANIEVIYCKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRNIYTDIDVKSHDWISPKRLEDNSKIDFTSICQNIEV--------RVIKGSTLELPWCSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRL-PYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLN-NLKISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQISIDNLVFKESP-----PLDYSIVLGQSFALNCSAK---PTNIQLKTNWFXXXXXXXXXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKEDGNWDSLPVKRIKEKSK------VSRFFVKFESVTDSLFGEYKCVASNEHRKNGVERIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWKLVTENWFINATTKETSITIE-----DLRPFKEYDIAIVAENSVGYGEEAT-IIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSPAKY-VAIRTLEDKPEGTPIQVLC-SPKANFLFLEWNPPPQNVTNGVISGYEVTYFS---DDKHEEPDKLMKNVKET--HLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIK-AYFYQNCLKVSWTPPIKANGHIREYIIVFSFEPNNMITVSSRENDKPYYSWELCSEQICSNCNVSVLAVTTMKGPRKTVNVLSNKMG-----ILSFXXXXXXXXXXXXXLYCEVAFPDENIYYLWTHNDKD----IYGQG---VQSNGSLVINSMAESDQGIYKCKVKSEEITYNVSTKSISLV----PQTPYIEITKVSTNHIALLW--RSNGSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSN-PAISQAQTRGSIPEIPDTSNIVTEIGPHSMCFNLRAFRPGRGCPANKYILKLWPSSEGNHQESGVSVWKVVNDSDLNQIPCFNVTDLHPNTDYVYSIEASNMVGSQKAKAHNKTRQI-VSTAPP 5186
            V C A G+PS  ++WY  T       ++ D P    V  NG + +          FI  N    +C A+N  G +RS  I V K +  +   VR E +       AV  CL+  ++  Y+  V  WE     D+  ++     E RF +        L+I +V K D +    RCI +          H +    R  + +++  T   ++I           V  G T+ELP C+       A  W   +   R L   + S++   ++    L I ++   + G Y         +   T  + V+  + V + P  +       V L C  TG P  ++ W  N  E        +    S  + +        +G YQC A  +        ++D    F IIA     L   +P +  S+S     +   G  F + C     P  TV W LDD+ I      + + ++R   YT+     I  S M     + + GG YR    N  G A     I V     IR   +IT   G +  + C VI     +I+W++DA    + LP+ H Q V E+G L + + V K +  G+Y+C+  +   L IS++  V +  PP++                         QP       +EF  A       L     ++  D+ I I ++K     +   +G+ +      F+     +I+ + +K+N        +C+  N A T+ +  Q     L+ +  P     P +   + G++  LNCS     P  +  K        +        +  RI  LPN +L+++++   D   ++C     VG D ISK + + +K+PA I + P+     + +   LNCT  G+  + ++W  K D   D   V R    +K      VS   +K     DS+F  + C A N + ++    +I L V + P    +  E     +RS+ + W     DG   IT + + +K  +++W    +T+  S TI      DL P   Y I + + N +G  E +  + I T+  AP+GP +++    V+   +++ W++P + L NG+ + YQ+   E     N         +  DS                        V T+  L  F +Y   V   N  G  P+   +   TLED P   P  V   S  ++   + W+ PP++  NGV+ GY V ++S   D +  E    M+N+  T   ++L  +   + Y +Q+      G G  S  +   T E  P PP  IK      + + VSW PP K NG IR+Y I  S   +     S  E       + +          + V AVT+      +  V     G     I+SF  ++       V L C  +  D      WT + +D    +   G   + +NG+L++ ++   D G Y C   +   T    T  ++L+    P  P + ++K S + I L W    NG       I  F++     N    +++ +SS+ RS  + +L+CGT Y V L AKN  G      I +A+T G  P      ++ T I       NL+ +  G GCP    +L+  P         G   W+ +  +   ++    +T+L   T Y   + A N  G     A   T     ST PP
Sbjct:  105 VPCPAAGSPSAALRWYLATGD-----DIYDVPHIRHVHANGTLQLYPFSPSAFNSFIHDND--YFCTAENAAGKIRSPNIRV-KAVFREPYTVRVEDQRSMRGNVAVFKCLIPSSVQEYVSVVS-WE----KDTVSIIP----EHRFFITYHGG---LYISDVQKED-ALSTYRCITK----------HKYSGETRQSNGARLSVTDPAESIPTILDGFHSQEVWAGHTVELP-CTASGYPIPAIRW---LKDGRPLP--ADSRW---TKRITGLTISDLRTEDSGTYICEVTNTFGSAEATGILMVIDPLHVTLTPKKLKTGIGSTVILSCALTGSPEFTIRWYRN-TELVLPDEAISIRGLSNETLLITSAQKSHSGAYQCFATRKAQT-----AQD----FAIIA-----LEDGTPRIVSSFSEK---VVNPGEQFSLMCAAKGAPPPTVTWALDDEPI------VRDGSHRTNQYTMSDGTTI--SHMNVTGPQIRDGGVYRCTARNLVGSAEYQARINVRGPPSIRAMRNITAVAGRDTLINCRVIGYPYYSIKWYKDA----LLLPDNHRQVVFENGTLKLTD-VQKGMDEGEYLCSVLIQPQLSISQSVHVAVKVPPLI-------------------------QP-------FEFPPASIGQL--LYIPCVVSSGDMPIRITWRK---DGQVIISGSGVTIESKEFM--SSLQISSVSLKHN-----GNYTCIASNAAATVSRERQ-----LIVRVPPRFVVQPNNQDGIYGKAGVLNCSVDGYPPPKVMWKHA--KGSGNPQQYHPVPLTGRIQILPNSSLLIRHVLEEDIGYYLCQASNGVGTD-ISKSMFLTVKIPAMITSHPNTTIAIKGHAKELNCTARGERPIIIRW-EKGDTVIDPDRVMRYAIATKDNGDEVVSTLKLKPADRGDSVF--FSCHAINSYGED--RGLIQLTVQEPPDPPEL--EIREVKARSMNLRWTQ-RFDGNSIITGFDIEYKNKSDSWDFKQSTRNISPTINQANIVDLHPASVYSIRMYSFNKIGRSEPSKELTISTEEAAPDGPPMDVTLQPVTSQSIQVTWKAPKKELQNGVIRGYQIGYRENSPGSNGQYSIVEMKATGDSE-----------------------VYTLDNLKKFAQYGVVVQAFNRAGTGPSSSEINATTLEDVPSQPPENVRALSITSDVAVISWSEPPRSTLNGVLKGYRVIFWSLYVDGEWGE----MQNITTTRERVELRGMEKFTNYSVQVLAYTQAGDGVRSSVLYIQTKEDVPGPPAGIKAVPSSASSVVVSWLPPTKPNGVIRKYTIFCSSPGSGQPAPSEYETSPEQLFYRIAHLNRGQQYLLWVAAVTSAGRGNSSEKVTIEPAGKAPAKIISFGGTVTTPWMKDVRLPCN-SVGDPAPAVKWTKDSEDSAIPVSMDGHRLIHTNGTLLLRAVKAEDSGYYTCTATN---TGGFDTIIVNLLVQVPPDQPRLTVSKTSASSITLTWIPGDNGGSS----IRGFVLQYSVDNSEEWKDVFISSSERSFKLDSLKCGTWYKVKLAAKNSVGSGRISEIIEAKTHGREPSFSKDQHLFTHINSTHARLNLQGWNNG-GCPITAIVLEYRP--------KGTWAWQGLRANSSGEV---FLTELREATWYELRMRACNSAGCGNETAQFATLDYDGSTIPP 1638          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Human
Match: DSCAML1 (DS cell adhesion molecule like 1 [Source:HGNC Symbol;Acc:HGNC:14656])

HSP 1 Score: 285.804 bits (730), Expect = 1.389e-76
Identity = 412/1712 (24.07%), Postives = 676/1712 (39.49%), Query Frame = 3
Query:  258 VYCTATGNPSPKIKWYYETTQRNVFTEVND-PDRFVVGTNGDMDI----------FIQANIEVIYCKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRNIYTDIDVKSHDWISPKRLEDNSKIDFTSICQNIEV--------RVIKGSTLELPWCSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRL-PYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLN-NLKISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQISIDNLVFKESP-----PLDYSIVLGQSFALNCSAK---PTNIQLKTNWFXXXXXXXXXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKEDGNWDSLPVKRIKEKSK------VSRFFVKFESVTDSLFGEYKCVASNEHRKNGVERIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWKLVTENWFINATTKETSITIE-----DLRPFKEYDIAIVAENSVGYGEEAT-IIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSPAKY-VAIRTLEDKPEGTPIQVLC-SPKANFLFLEWNPPPQNVTNGVISGYEVTYFS---DDKHEEPDKLMKNVKET--HLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIK-AYFYQNCLKVSWTPPIKANGHIREYIIVFSFEPNNMITVSSRENDKPYYSWELCSEQICSNCNVSVLAVTTMKGPRKTVNVLSNKMG-----ILSFXXXXXXXXXXXXXLYCEVAFPDENIYYLWTHNDKD----IYGQG---VQSNGSLVINSMAESDQGIYKCKVKSEEITYNVSTKSISLV----PQTPYIEITKVSTNHIALLW--RSNGSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSN-PAISQAQTRGSIPEIPDTSNIVTEIGPHSMCFNLRAFRPGRGCPANKYILKLWPSSEGNHQESGVSVWKVVNDSDLNQIPCFNVTDLHPNTDYVYSIEASNMVGSQKAKAHNKTRQI-VSTAPP 5186
            V C A G+PS  ++WY  T       ++ D P    V  NG + +          FI  N    +C A+N  G +RS  I V K +  +   VR E +       AV  CL+  ++  Y+  V  WE     D+  ++     E RF +        L+I +V K D +    RCI +          H +    R  + +++  T   ++I           V  G T+ELP C+       A  W   +   R L   + S++   ++    L I ++   + G Y         +   T  + V+  + V + P  +       V L C  TG P  ++ W  N  E        +    S  + +        +G YQC A  +        ++D    F IIA     L   +P +  S+S     +   G  F + C     P  TV W LDD+ I      + + ++R   YT+     I  S M     + + GG YR    N  G A     I V     IR   +IT   G +  + C VI     +I+W++DA    + LP+ H Q V E+G L + + V K +  G+Y+C+  +   L IS++  V +  PP++                         QP       +EF  A       L     ++  D+ I I ++K     +   +G+ +      F+     +I+ + +K+N        +C+  N A T+ +  Q     L+ +  P     P +   + G++  LNCS     P  +  K        +        +  RI  LPN +L+++++   D   ++C     VG D ISK + + +K+PA I + P+     + +   LNCT  G+  + ++W  K D   D   V R    +K      VS   +K     DS+F  + C A N + ++    +I L V + P    +  E     +RS+ + W     DG   IT + + +K  +++W    +T+  S TI      DL P   Y I + + N +G  E +  + I T+  AP+GP +++    V+   +++ W++P + L NG+ + YQ+   E     N         +  DS                        V T+  L  F +Y   V   N  G  P+   +   TLED P   P  V   S  ++   + W+ PP++  NGV+ GY V ++S   D +  E    M+N+  T   ++L  +   + Y +Q+      G G  S  +   T E  P PP  IK      + + VSW PP K NG IR+Y I  S   +     S  E       + +          + V AVT+      +  V     G     I+SF  ++       V L C  +  D      WT + +D    +   G   + +NG+L++ ++   D G Y C   +   T    T  ++L+    P  P + ++K S + I L W    NG       I  F++     N    +++ +SS+ RS  + +L+CGT Y V L AKN  G      I +A+T G  P      ++ T I       NL+ +  G GCP    +L+  P         G   W+ +  +   ++    +T+L   T Y   + A N  G     A   T     ST PP
Sbjct:  105 VPCPAAGSPSAALRWYLATGD-----DIYDVPHIRHVHANGTLQLYPFSPSAFNSFIHDND--YFCTAENAAGKIRSPNIRV-KAVFREPYTVRVEDQRSMRGNVAVFKCLIPSSVQEYVSVVS-WE----KDTVSIIP----EHRFFITYHGG---LYISDVQKED-ALSTYRCITK----------HKYSGETRQSNGARLSVTDPAESIPTILDGFHSQEVWAGHTVELP-CTASGYPIPAIRW---LKDGRPLP--ADSRW---TKRITGLTISDLRTEDSGTYICEVTNTFGSAEATGILMVIDPLHVTLTPKKLKTGIGSTVILSCALTGSPEFTIRWYRN-TELVLPDEAISIRGLSNETLLITSAQKSHSGAYQCFATRKAQT-----AQD----FAIIA-----LEDGTPRIVSSFSEK---VVNPGEQFSLMCAAKGAPPPTVTWALDDEPI------VRDGSHRTNQYTMSDGTTI--SHMNVTGPQIRDGGVYRCTARNLVGSAEYQARINVRGPPSIRAMRNITAVAGRDTLINCRVIGYPYYSIKWYKDA----LLLPDNHRQVVFENGTLKLTD-VQKGMDEGEYLCSVLIQPQLSISQSVHVAVKVPPLI-------------------------QP-------FEFPPASIGQL--LYIPCVVSSGDMPIRITWRK---DGQVIISGSGVTIESKEFM--SSLQISSVSLKHN-----GNYTCIASNAAATVSRERQ-----LIVRVPPRFVVQPNNQDGIYGKAGVLNCSVDGYPPPKVMWKHA--KGSGNPQQYHPVPLTGRIQILPNSSLLIRHVLEEDIGYYLCQASNGVGTD-ISKSMFLTVKIPAMITSHPNTTIAIKGHAKELNCTARGERPIIIRW-EKGDTVIDPDRVMRYAIATKDNGDEVVSTLKLKPADRGDSVF--FSCHAINSYGED--RGLIQLTVQEPPDPPEL--EIREVKARSMNLRWTQ-RFDGNSIITGFDIEYKNKSDSWDFKQSTRNISPTINQANIVDLHPASVYSIRMYSFNKIGRSEPSKELTISTEEAAPDGPPMDVTLQPVTSQSIQVTWKAPKKELQNGVIRGYQIGYRENSPGSNGQYSIVEMKATGDSE-----------------------VYTLDNLKKFAQYGVVVQAFNRAGTGPSSSEINATTLEDVPSQPPENVRALSITSDVAVISWSEPPRSTLNGVLKGYRVIFWSLYVDGEWGE----MQNITTTRERVELRGMEKFTNYSVQVLAYTQAGDGVRSSVLYIQTKEDVPGPPAGIKAVPSSASSVVVSWLPPTKPNGVIRKYTIFCSSPGSGQPAPSEYETSPEQLFYRIAHLNRGQQYLLWVAAVTSAGRGNSSEKVTIEPAGKAPAKIISFGGTVTTPWMKDVRLPCN-SVGDPAPAVKWTKDSEDSAIPVSMDGHRLIHTNGTLLLRAVKAEDSGYYTCTATN---TGGFDTIIVNLLVQVPPDQPRLTVSKTSASSITLTWIPGDNGGSS----IRGFVLQYSVDNSEEWKDVFISSSERSFKLDSLKCGTWYKVKLAAKNSVGSGRISEIIEAKTHGREPSFSKDQHLFTHINSTHARLNLQGWNNG-GCPITAIVLEYRP--------KGTWAWQGLRANSSGEV---FLTELREATWYELRMRACNSAGCGNETAQFATLDYDGSTIPP 1638          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Human
Match: DSCAM (DS cell adhesion molecule [Source:HGNC Symbol;Acc:HGNC:3039])

HSP 1 Score: 276.559 bits (706), Expect = 6.845e-74
Identity = 378/1555 (24.31%), Postives = 623/1555 (40.06%), Query Frame = 3
Query:  696 LHIRNVTKADFSDMEVRCIMRNIYTDIDVKSHDWISPKRLEDNSKIDFTSICQNIEVR-VIKGSTLELPWCSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTV----VNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLN-NLKISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQISIDNLVFKESP-----PLDYSIVLGQSFALNCSAKPTNIQLKTNWFXXXXXXXXXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKEDGNWDSLPVKRIKEKSKVSRFFVKFESVTDSLF-------------GEYKCVASNEHRKNGVERIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWKLVTENWFINATTKET-----SITIEDLRPFKEYDIAIVAENSVGYGEEAT-IIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSP-AKYVAIRTLEDKPEGTP--IQVLC-SPKANFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNVKETH--LKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIKAYFYQNCLK-VSWTPPIKANGHIREYIIVFSFEPNNMITVSSRENDKPYYSWELCSEQICSNCNVSVLAVTTM-KGPRK---TVNVLSNKMG-ILSFXXXXXXXXXXXXXLYCE-VAFPDENIYYLWTHNDK----DIYG-QGVQSNGSLVINSMAESDQGIYKCKV----KSEEITYNVSTKSISLVPQTPYIEITKVSTNHIALLW--RSNGSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSN-PAISQAQTRGSIPEIPDTSNIVTEIGPHSMCFNLRAFRPGRGCPANKYILKLWPSSEGNHQESGVSVWKVVNDSDLNQIPCFNVTDLHPNTDYVYSIEASNMVGSQKAKAHNKTRQI-VSTAPPNI 5192
            L+I++V   D      RCI R+ YT    +S+   S +    +      SI    + R  + G  +ELP C    + +  + W          + LSG   K ++     LLI+NI  ++ G Y        SN Y T  V   + V   +K T+    V +     V L C  TG     L W  NG   N  K+    T  +  + I   +     G YQC        ++++ ++D   V V++ +  P +I          S  +  + +      + C     P  T+ W LDD  I      +   ++R+   + +   + +S +     + + GG YR    N  G       I V     IR   +IT   G +  + C VI     +I+W++++      LP  H Q   E+     +  V K +  G+Y CN  +   L  S++  VT+  PP +                         QP       +EF        V       +   DL I I +QK         +G  +P G         +  + + I     +H    +C+ +N A  +    Q     L+ +  P     P D   + G++  LNCSA+   +      F+  +         +  RI  L NG+L++K++   D   ++C +   VG D +SK + + +K+PA I + P+     +  +  ++CT HG+  + V+W  KED         RI    +++R+ V  + V + +              G + C A N + ++    II L V + P    I  E     +R+I + W     DG  PIT Y +  K  +++W     TK+      S TI D+ P   Y I + A+N +G  E +  + I     AP+GP   +    +S   +++ W++P + L NGI + YQ+   E     N      +  +  DS    +D  N                        FT+Y   V   N  G  P ++ +   TLED P   P  +Q +  SP++  + + W+   +   NG++ G+ V Y+++    E  ++ KN+  T   L+L  L   + Y IQ+      G G  SE I   T E  P PP  +KA      +  VSW PP+K NG IR+Y  VF   P   + +S  E     +S+ + +       +V V+AVT+  +G      TV  L+     IL+FS ++       +VL C+ V  P   + ++   N       I G + + SNGS +I ++   D G Y C       S+EI  N+    + + P  P + ++K +++ I L W    NG       I  +++     N        +S + RS  + NL+CGT Y   L A+N  GP     I +A+T G  P+      +   I    +  NL  +  G GCP   + L+  P         G +VW     + L++   + + DL   T Y   +   N  G  + +A+  T     ST PP I
Sbjct:   16 LYIKDVQNED-GLYNYRCITRHRYTGETRQSN---SARLFVSDPANSAPSILDGFDHRKAMAGQRVELP-CKALGHPEPDYRWLK----DNMPLELSGRFQKTVT----GLLIENIRPSDSGSYVCEV----SNRYGTAKVIGRLYVKQPLKATISPRKVKSSVGSQVSLSCSVTGTEDQELSWYRNGEILNPGKNVRI-TGINHENLIMDHMVKSDGGAYQCFVR-----KDKLSAQDY--VQVVLEDGTPKII----------SAFSEKVVSPAEPVSLMCNVKGTPLPTITWTLDDDPI------LKGGSHRISQMITSEGNV-VSYLNISSSQVRDGGVYRCTANNSAGVVLYQARINVRGPASIRPMKNITAIAGRDTYIHCRVIGYPYYSIKWYKNSN----LLPFNHRQVAFENNGTLKLSDVQKEVDEGEYTCNVLVQPQLSTSQSVHVTVKVPPFI-------------------------QP-------FEFPRFSIGQRV--FIPCVVVSGDLPITITWQK---------DGRPIP-GSLGVTIDNIDFTSSLRISNLSLMHNGNYTCIARNEAAAVEHQSQ-----LIVRVPPKFVVQPRDQDGIYGKAVILNCSAEGYPVPTIVWKFSKGAGVPQFQPIALNGRIQVLSNGSLLIKHVVEEDSGYYLCKVSNDVGAD-VSKSMYLTVKIPAMITSYPNTTLATQGQKKEMSCTAHGEKPIIVRW-EKED---------RIINP-EMARYLVSTKEVGEEVISTLQILPTVREDSGFFSCHAINSYGED--RGIIQLTVQEPPDPPEI--EIKDVKARTITLRWT-MGFDGNSPITGYDIECKNKSDSWDSAQRTKDVSPQLNSATIIDIHPSSTYSIRMYAKNRIGKSEPSNELTITADEAAPDGPPQEVHLEPISSQSIRVTWKAPKKHLQNGIIRGYQIGYREYSTGGNFQFNIISVDTSGDSEVYTLDNLNK-----------------------FTQYGLVVQACNRAGTGPSSQEIITTTLEDVPSYPPENVQAIATSPES--ISISWSTLSKEALNGILQGFRVIYWANLMDGELGEI-KNITTTQPSLELDGLEKYTNYSIQVLAFTRAGDGVRSEQIFTRTKEDVPGPPAGVKAAAASASMVFVSWLPPLKLNGIIRKY-TVFCSHPYPTV-ISEFEASPDSFSYRIPNLSRNRQYSVWVVAVTSAGRGNSSEIITVEPLAKAPARILTFSGTVTTPWMKDIVLPCKAVGDPSPAVKWMKDSNGTPSLVTIDGRRSIFSNGSFIIRTVKAEDSGYYSCIANNNWGSDEIILNL---QVQVPPDQPRLTVSKTTSSSITLSWLPGDNGGSS----IRGYILQYSEDNSEQWGSFPISPSERSYRLENLKCGTWYKFTLTAQNGVGPGRISEIIEAKTLGKEPQFSKEQELFASINTTRVRLNLIGWNDG-GCPITSFTLEYRP--------FGTTVWTTAQRTSLSK--SYILYDLQEATWYELQMRVCNSAGCAEKQANFATLNYDGSTIPPLI 1412          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Celegans
Match: rig-4 (pep chromosome:WBcel235:IV:7991410:8004136:-1 gene:WBGene00004371.1 transcript:Y42H9B.2.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:rig-4)

HSP 1 Score: 105.531 bits (262), Expect = 3.725e-22
Identity = 98/356 (27.53%), Postives = 153/356 (42.98%), Query Frame = 3
Query: 3138 PNSDGKKPITRYLVSWKLVTENWFIN----ATTKETSITIEDLRPFKEYDIAIVAENSVGYG--EEATIIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFS-PAKYVAIRTLEDKPEGTPIQVLCSPKAN-FLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPD--KLMKNVKETHL--KLYNLSANSKYIIQIRVKNNIGLGPP-SEPINCTTNEAAPDPPNEIK-AYFYQNCLKVSWTPPIKANGHIREYIIVF--SFEPNNM 4157
            P  DG   I +++V  K+   + F +    +  K  SIT+  LRPF +Y + ++AEN  G G   E +   +T    P+ P   L A  VS   + + W        NG  K Y +   EI D   + +   A  S          +H                  TVT+L  FT Y   V   N  G S P   V  RT E  P G+P  ++ + + +    ++WNP  +  TNG + GY++    + +    D  K++    ++ L  K+ +L   + Y + +     +G GP  S PI+  T E  P PP   + +Y  +  +++ W PP   NG I  YII +  S EP +M
Sbjct: 1079 PGFDGHTAIRQWVVEGKMADSSVFAHVFNVSAPKARSITVTGLRPFTQYQLRLIAENVKGRGAPSEPSRSFETLQTNPDTPSQRLFAEPVSATSISVSWTPLLATHWNGQPKGYLIVYREIDDENWKEVRTPALRS---------SEH------------------TVTDLRPFTSYEVNVFSENGFGRSLPTDSVKARTYESVPSGSPRNIVVTAEGSKAAIIKWNPVAELSTNGDVIGYKLRVVPERESLMADETKVIDIPGQSTLMAKVSDLRPFTSYHVYMSAYTIVGNGPENSTPISFETMEDVPAPPESFQCSYISEQEVRMKWLPPGSPNGKITNYIISYWKSHEPRSM 1407          

HSP 2 Score: 64.6994 bits (156), Expect = 1.115e-9
Identity = 99/414 (23.91%), Postives = 166/414 (40.10%), Query Frame = 3
Query: 2985 GEYKCVASNEHRKNGVERIILLNVVDVPG-----KVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWKLVT-----ENW--FINATTKETS-----ITIEDLRPFKEYDIAIVAENSVGYGEEA--TIIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQV-CSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSP-AKYVAIRTLEDKPEGTP----IQVLCSPKANFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNV------KETHLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIK-AYFYQNCLKVSWTPPIKANGHIREYII 4130
            GEY+C  + + R+       +L +++ P      +  + NE++ +  R     WN    DG +PI ++ +  + +       +W   I+   KE         IEDLRP    +  +VA N  G G+ +  +  +      P     N+ A++ S   V ++W+ P E L +G    Y V   +  Y S         W   N +T    D  N             TL   V EL+T+ EY  +V   N  G    ++ + + T E +P   P    ++VL S     + +E+  P Q    GV  GY+V ++  +   E  +L K V      ++    +  L     Y +        G GP S  +   T E  P+  +E+  A    N   ++W  P+K NG + +Y I
Sbjct:  618 GEYRCRVTVDGREENAS--AMLQIIEKPAMPERVRAELHNETMPAKVRVR---WNE-GFDGNEPIIKHAIEMRTMGPTGLWSDWTTAIDNIPKEEGKPCCWTDIEDLRPSSTAEFRVVASNKHGPGKPSLPSYSVTMPQQPPSAAPRNVAASARSPHSVMVQWQQPKEELDSGDVLGYVVRYRLAGYSS-------LTWNEKNLTTK---DARN-------------TL---VDELITWREYEIQVAAYNKRGLGVFSESIEVTTSEGRPTQAPKNVRVKVLNS---TAVAIEFTAPEQQRIPGVNLGYKVQFWKGEP--EKGELYKQVILDPDRRQLTTVVNELEKFGHYNLTTLCFTTPGDGPRSNVVKVVTEEDTPESVDELSIAEVMYNGAVITWNSPLKQNGIVTKYTI 994          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Celegans
Match: rig-4 (pep chromosome:WBcel235:IV:7991410:8004119:-1 gene:WBGene00004371.1 transcript:Y42H9B.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:rig-4)

HSP 1 Score: 105.531 bits (262), Expect = 3.725e-22
Identity = 98/356 (27.53%), Postives = 153/356 (42.98%), Query Frame = 3
Query: 3138 PNSDGKKPITRYLVSWKLVTENWFIN----ATTKETSITIEDLRPFKEYDIAIVAENSVGYG--EEATIIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFS-PAKYVAIRTLEDKPEGTPIQVLCSPKAN-FLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPD--KLMKNVKETHL--KLYNLSANSKYIIQIRVKNNIGLGPP-SEPINCTTNEAAPDPPNEIK-AYFYQNCLKVSWTPPIKANGHIREYIIVF--SFEPNNM 4157
            P  DG   I +++V  K+   + F +    +  K  SIT+  LRPF +Y + ++AEN  G G   E +   +T    P+ P   L A  VS   + + W        NG  K Y +   EI D   + +   A  S          +H                  TVT+L  FT Y   V   N  G S P   V  RT E  P G+P  ++ + + +    ++WNP  +  TNG + GY++    + +    D  K++    ++ L  K+ +L   + Y + +     +G GP  S PI+  T E  P PP   + +Y  +  +++ W PP   NG I  YII +  S EP +M
Sbjct: 1079 PGFDGHTAIRQWVVEGKMADSSVFAHVFNVSAPKARSITVTGLRPFTQYQLRLIAENVKGRGAPSEPSRSFETLQTNPDTPSQRLFAEPVSATSISVSWTPLLATHWNGQPKGYLIVYREIDDENWKEVRTPALRS---------SEH------------------TVTDLRPFTSYEVNVFSENGFGRSLPTDSVKARTYESVPSGSPRNIVVTAEGSKAAIIKWNPVAELSTNGDVIGYKLRVVPERESLMADETKVIDIPGQSTLMAKVSDLRPFTSYHVYMSAYTIVGNGPENSTPISFETMEDVPAPPESFQCSYISEQEVRMKWLPPGSPNGKITNYIISYWKSHEPRSM 1407          

HSP 2 Score: 64.6994 bits (156), Expect = 1.115e-9
Identity = 99/414 (23.91%), Postives = 166/414 (40.10%), Query Frame = 3
Query: 2985 GEYKCVASNEHRKNGVERIILLNVVDVPG-----KVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWKLVT-----ENW--FINATTKETS-----ITIEDLRPFKEYDIAIVAENSVGYGEEA--TIIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQV-CSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSP-AKYVAIRTLEDKPEGTP----IQVLCSPKANFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNV------KETHLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIK-AYFYQNCLKVSWTPPIKANGHIREYII 4130
            GEY+C  + + R+       +L +++ P      +  + NE++ +  R     WN    DG +PI ++ +  + +       +W   I+   KE         IEDLRP    +  +VA N  G G+ +  +  +      P     N+ A++ S   V ++W+ P E L +G    Y V   +  Y S         W   N +T    D  N             TL   V EL+T+ EY  +V   N  G    ++ + + T E +P   P    ++VL S     + +E+  P Q    GV  GY+V ++  +   E  +L K V      ++    +  L     Y +        G GP S  +   T E  P+  +E+  A    N   ++W  P+K NG + +Y I
Sbjct:  618 GEYRCRVTVDGREENAS--AMLQIIEKPAMPERVRAELHNETMPAKVRVR---WNE-GFDGNEPIIKHAIEMRTMGPTGLWSDWTTAIDNIPKEEGKPCCWTDIEDLRPSSTAEFRVVASNKHGPGKPSLPSYSVTMPQQPPSAAPRNVAASARSPHSVMVQWQQPKEELDSGDVLGYVVRYRLAGYSS-------LTWNEKNLTTK---DARN-------------TL---VDELITWREYEIQVAAYNKRGLGVFSESIEVTTSEGRPTQAPKNVRVKVLNS---TAVAIEFTAPEQQRIPGVNLGYKVQFWKGEP--EKGELYKQVILDPDRRQLTTVVNELEKFGHYNLTTLCFTTPGDGPRSNVVKVVTEEDTPESVDELSIAEVMYNGAVITWNSPLKQNGIVTKYTI 994          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Celegans
Match: him-4 (High Incidence of Males (Increased X chromosome loss) [Source:UniProtKB/TrEMBL;Acc:A4UVK0])

HSP 1 Score: 83.1889 bits (204), Expect = 2.742e-15
Identity = 224/1047 (21.39%), Postives = 395/1047 (37.73%), Query Frame = 3
Query:  192 LEPPKLINVQKSFVTTMTDHSRVYCTATGNPSPKIKWYYETTQRNVFTEVNDPDRFVVGTNGDMDIFIQANI---EVIY-CKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRNIYT-DIDVKSHDWISPKRLEDNSKIDFTSICQNIEVRVIKGSTLELPWCSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTVVNARYNEIV------QLKCVAT-GYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRV-NADTAGVYQCLAESRDNAENRILSED----QKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKT-----DGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIR-DYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLNNLKISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAK-SNHSVP--LLSNSYLNKHDLKIE-----------------IKYQKITVSEK----------------YTDNGAALPKGVPNFVR---------------YQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQISIDNLVFKESPPL-------DYSIVLGQSFALNC---SAKPTNIQLKTNWFXXXXXXXXXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVI---DMKRNYENSLNCTVHGDDELDVKWYRKEDGNWDSLPV-KRIKEKSKVSRFFVKFESVTDSLFGEYKCVASNEHRKNG----VERIILLNV 3056
            +EPP +    +     M +   + C A G+P P++ WY++   R++  +     ++ VG +    ++I+      E  Y C+A ++ G  R  T  +        V++      V    +    C         I    + +IR+  + K ++K       +  IN+ Q   LHI      D       C+  N+   D+ V +   +S  R+    +   T     + V + +  TL+     +P  + I W   + +     L  L+  ++  +++  GNLLI +  I ++G +      +  N Y   +    + V+  + P + +    E +       L CV   G P+ S++W+ +        + + +   S    + +R  N    G Y C+A S   A N  L  +    +K  FV   E     I   P +         V+ +     DG  F I C  +  P   + WYLD + I       PN+     +TV A    D + ++   +K  Y G Y  + TN  G     T I + +  MI        +       + C V    KP I W  D K      P T    V+EDG L  I  V++  H G + C++       ++T ++T+   P + ++    I+L   +D   L C  +  P  P    W ++  K  +  +P  +  +  L   ++K+E                 + Y  +TV EK                +T        GVP  +R               +  + +  + I   +K  +   +CVV N AGT + T  + +      + PP+       + + V+G    L C   ++ P ++     WF    +        V        +GTLV+++  + D   + C      GK E +  V +   + +  +  PDV+    +K ++  SL C V  +    + WY  +    D     K   +K K+  F  K   +TDS  G YKCVA N   +      VE I+ LN+
Sbjct:  608 MEPPSVKVTPQDVYFNMREGVNLSCEAMGDPKPEVHWYFK--GRHLLNDY----KYQVGQDSKF-LYIRDATHHDEGTYECRAMSQAGQARDTTDLM--LATPPKVEIIQNKMMVGRGDRVSFEC-------KTIRGKPHPKIRWFKNGKDLIK----PDDYIKINEGQ---LHIMGAKDEDAG--AYSCVGENMAGKDVQVAN---LSVGRVPTIIESPHT-----VRVNIERQVTLQCLAVGIPPPE-IEWQKGNVL-----LATLNNPRYTQLAD--GNLLITDAQIEDQGQFTC----IARNTYGQQSQSTTLMVTGLVSPVLGHVPPEEQLIEGQDLTLSCVVVLGTPKPSIVWIKDDKPVEEGPTIKIEGGGSL---LRLRGGNPKDEGKYTCIAVSP--AGNSTLHINVQLIKKPEFVYKPEGG---IVFKPTISGMDEKHVAVVNSTHDVLDGEGFAIPCVVSGTPPPIITWYLDGRPI------TPNSR---DFTVTA----DNTLIVRKADK-SYSGVYTCQATNSAGDNEQKTTIRIMNTPMISPGQSSFNMVVDDLFTIPCDVYGDPKPVITWLLDDK------PFTE-GVVNEDGSL-TIPNVNEA-HRGTFTCHAQNAAGNDTRTVTLTVHTTPTINAENQEKIAL--QNDDIVLECPAKALP--PPVRLWTYEGEKIDSQLIPHTIREDGALVLQNVKLENTGVFVCQVSNLAGEDSLSY-TLTVHEKPKIISEVPGVVDVVKGFTIEIPCRATGVPEVIRTWNKNGIDLKMDEKKFSVDNLGTLRIYEADKNDIGNYNCVVTNEAGTSQMTTHVDV------QEPPIILPSTQTNNTAVVGDRVELKCYVEASPPASV----TWFRRGIAIGTDTKGYVVES-----DGTLVIQSASVEDATIYTCKASNPAGKAEANLQVTV---IASPDIKDPDVVTQESIKESHPFSLYCPVFSNPLPQISWYLNDKPLIDDKTSWKTSDDKRKLHVFKAK---ITDS--GVYKCVARNAAGEGSKSFQVEVIVPLNL 1550          

HSP 2 Score: 72.4034 bits (176), Expect = 4.442e-12
Identity = 155/725 (21.38%), Postives = 268/725 (36.97%), Query Frame = 3
Query: 1188 LKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITI-RVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDI----TLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLNNLKISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQ-ISIDNLVFKESPPLDYSIVLGQSFALNCSAKPTNIQLKTNWFXXXXXXXXXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAI--KVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRK--EDGNWDSLPVKRIKEKSKVSRFFVKFESVTDSLFGEYKCVASNEHRKNGVERIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDG-KKPITRYLVSWKLVTENWFINATTKETSITIEDLRPFKEYDIAIVAENSVGYGEEATII 3329
            L C A G P  ++ WL +GN    +  +     F     + I +      G Y C+A       N + S+D ++   +I           PPV         V   +G S ++ C  N      V W  D   I   + L  ++  ++P +           M  +  +    G Y   V N  G+A       V D   I D        T+     + + C V     P + W  D K      P++    ++ +G    I +  +V H+G Y C +  N  K  K F V +  PP    +    ++  +  DT  LTC                    +  SVP LS+ Y + HD  +    Q   ++ KY  N   L     N    Q +         +E  +     C   N AG  +K  + I I+   F +   L Y I+LG+   L+CSA  T     T  F  D       +         +   TLV+ N +     ++ CI +   G+ E   +V++ +  K+    +N    ++++     +L C +     + + W R+  +DG  D     R +  S  S+ ++   +  D+    Y C+A N+    G E +  +  V+ P K +  +    +   +      P  ++G   P   + +  K + E   +     + S+ I++++P +E     VAEN  G  E+ T +
Sbjct: 2498 LHCPAKGSPSPTITWLKDGNAIEPNDRY---VFFDAGRQLQISKTEGSDQGRYTCIAT------NSVGSDDLENTLEVII----------PPVIDGERR-EAVAVIEGFSSELFCDSNST-GVDVEWQKDGLTINQ-DTLRGDSFIQIPSSG--------KKMSFLSARKSDSGRYTCIVRNPAGEARKLFDFAVNDPPSISDELSSANIQTIVPYYPVEINCVVSGSPHPKVYWLFDDK---PLEPDSAAYELTNNGETLKIVR-SQVEHAGTYTCEAQNNVGKARKDFLVRVTAPPHFEKEREEVVA--RVGDTMLLTC-------------------NAESSVP-LSSVYWHAHDESV----QNGVITSKYAANEKTL-----NVTNIQLD---------DEGFYY----CTAVNEAGITKKFFKLIVIETPYFLDQQKL-YPIILGKRLTLDCSA--TGTPPPTILFMKDGKRLNESDEV------DIIGSTLVIDNPQKEVEGRYTCIAENKAGRSEKDMMVEVLLPPKLSKEWIN----VEVQAGDPLTLECPIEDTSGVHITWSRQFGKDGQLD----MRAQSSSDKSKLYIMQATPEDA--DSYSCIAVND--AGGAEAVFQV-TVNTPPK-IFGDSFSTTEIVADTTLEIPCRTEGIPPPEISWFLDGKPILEMPGVTYKQGDLSLRIDNIKPNQEGRYTCVAENKAGRAEQDTYV 3121          

HSP 3 Score: 60.8474 bits (146), Expect = 1.492e-8
Identity = 151/725 (20.83%), Postives = 253/725 (34.90%), Query Frame = 3
Query: 1125 INVSVDIKP--------TVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIP---MVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPD--ITLTHGSELRLKCYVIS--GLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLNNLKISKTFSVTIANPP--IMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHS---VPLLSNSYLNKHDLKI-EIKYQKITVSEKYT---DNGAA------------LPK----GVPNFVRYQHNKIAQI-------------WIKYN---------------EKLHL--------SQISCVVQNHAGTIRKTIQISIDNLVFKESPPLDYSIVL--GQSFALNCSAKPTNIQLKTNWFXXXXXXXXXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKR--------NYENSLNCTVHGDDELDVKWYRKEDG---NWDSLPVKRIKEKSKVSRFFVKFESVTDSLFGEYKCVASN---EHRK 3023
            INV V  KP        + +       + L+C       + + W  NG  F +           R  HI +    D  G Y C   +      +         F +  ++ P ++ +          G      + +S  + C+    PN  V W  D + +     V VL     +++ +  IA                 + G Y     N  G A  +  + +    MI+      +T   G  L  KC +      K  I W R+ +   +   +     +S D RL I+   +     G+Y C    +  + S  F  T+  PP  IML       ++  ++ T S     + +PD+ W     FK+ ++ H      ++ N  LN + LKI  IK      + KYT   DN A             +PK    G+P+    Q N+   I             W+K                 +KL+L        S+ +C+  N AGT ++  ++S+      + P +   I +  G    L+C AK +     T W    ++              QL      +   E +D  ++ CI    VG D++   +++ I         P VID +R         + + L C  +    +DV+W  ++DG   N D+L      +     +  + F S   S  G Y C+  N   E RK
Sbjct: 1997 INVHVRTKPRFESGLTESELTVNLTRSITLECDVDDAIGVGISWTVNGKPFLAETDGVQTLAGGRFLHI-VSAKTDDHGSYACTVTNEAGVATK--------TFNLFVQVPPTIVNE----------GGEYTVIENNSLVLPCEVTGKPNPVVTWTKDGRPVGDLKSVQVLSEGQQFKIVHAEIA-----------------HKGSYICMAKNDVGTAEISFDVDIITRPMIQKGIKNIVTAIKGGALPFKCPIDDDKNFKGQIIWLRNYQPIDLEAEDARITRLSNDRRLTILNVTEN--DEGQYSCRVKNDAGENSFDFKATVLVPPTIIMLDKDKNKTAVEHSTVTLSCPATGKPEPDITW-----FKDGEAIHIENIADIIPNGELNGNQLKITRIKEGD---AGKYTCEADNSAGSVEQDVNVNVITIPKIEKDGIPSDYESQQNERVVISCPVYARPPAKITWLKAGKPLQSDKFVKTSANGQKLYLFKLRETDSSKYTCIATNEAGTDKRDFKVSMLVAPSFDEPNIVRRITVNSGNPSTLHCPAKGSPSPTIT-WLKDGNAIEPNDRYVFFDAGRQLQ-----ISKTEGSDQGRYTCIATNSVGSDDLENTLEVII---------PPVIDGERREAVAVIEGFSSELFCDSNSTG-VDVEW--QKDGLTINQDTLRGDSFIQIPSSGK-KMSFLSARKSDSGRYTCIVRNPAGEARK 2656          

HSP 4 Score: 56.9954 bits (136), Expect = 2.375e-7
Identity = 140/624 (22.44%), Postives = 228/624 (36.54%), Query Frame = 3
Query:  198 PPKLINVQKSFVTTMTDHS-RVYCTATGNPSPKIKWYYETTQRNVFTEVNDPDRFVVGTNGDMDIFI---QANIEVIY-CKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRN------IYTDIDVKSHDWISPKRLEDNSKIDFTSICQNIEVRVIKGSTLELPWCSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLL-IKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINV----SVDIKPTVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSK---SFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNST 2012
            PPK+     S    + D +  + C   G P P+I W+ +        E+      V    GD+ + I   + N E  Y C A+N+ G  R++  T  +  +   V +  E   V   ++  I C ++      + +++  E  Y SD    L  + T+  +          LH+R  T AD       CI  N        TD++V     + P R+ED             E RV++G             ++   Y      + R +  ++  +     E F  +L I+N   A+EG Y      + SN   T     +I+V    + +   T  N    E  +++C   G+P+ ++ WL  G  FN      S   DT       + ++      G+Y C+A +         SE    V V         I Q+P                G    ++C     P  TV W   D  +P  +       Y L    + T      + +++ E       Y AEV  K      T +    ++Y + +   IT        + C V S   P+I WFR    K V L + +  ++S DG    I K  K+   GKYIC ++
Sbjct: 3034 PPKIFGDSFSTTEIVADTTLEIPCRTEGIPPPEISWFLDGKP---ILEMPG----VTYKQGDLSLRIDNIKPNQEGRYTCVAENKAG--RAEQDTYVEISEPPRVVMASEVMRVVEGRQTTIRCEVFGNPEPVVNWLKDGE-PYTSD----LLQFSTKLSY----------LHLRETTLADGGTY--TCIATNKAGESQTTTDVEV-----LVPPRIED-------------EERVLQG-------------KEGNTYMVHCQVTGRPVPYVTWKRNGKEIEQFNPVLHIRNATRADEGKYSC----IASNEAGTAVADFLIDVFTKPTFETHETTFNIVEGESAKIECKIDGHPKPTISWLKGGRPFNMDNIILSPRGDT------LMILKAQRFDGGLYTCVATNSYGD-----SEQDFKVNVYTKPYIDETIDQTPKA------------VAGGEIILKCPVLGNPTPTVTWKRGDDAVPNDSRHTIVNNYDLKINSVTTEDAGQYSCIAVNEAGNLTTHYAAEVIGKP-----TFVRKGGNLYEVIENDTIT--------MDCGVTSRPLPSISWFR--GDKPVYLYDRY--SISPDGSHITINKA-KLSDGGKYICRAS 3555          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Celegans
Match: him-4 (High Incidence of Males (Increased X chromosome loss) [Source:UniProtKB/TrEMBL;Acc:A4UVK0])

HSP 1 Score: 83.1889 bits (204), Expect = 2.882e-15
Identity = 224/1047 (21.39%), Postives = 395/1047 (37.73%), Query Frame = 3
Query:  192 LEPPKLINVQKSFVTTMTDHSRVYCTATGNPSPKIKWYYETTQRNVFTEVNDPDRFVVGTNGDMDIFIQANI---EVIY-CKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRNIYT-DIDVKSHDWISPKRLEDNSKIDFTSICQNIEVRVIKGSTLELPWCSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTVVNARYNEIV------QLKCVAT-GYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRV-NADTAGVYQCLAESRDNAENRILSED----QKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKT-----DGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIR-DYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLNNLKISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAK-SNHSVP--LLSNSYLNKHDLKIE-----------------IKYQKITVSEK----------------YTDNGAALPKGVPNFVR---------------YQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQISIDNLVFKESPPL-------DYSIVLGQSFALNC---SAKPTNIQLKTNWFXXXXXXXXXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVI---DMKRNYENSLNCTVHGDDELDVKWYRKEDGNWDSLPV-KRIKEKSKVSRFFVKFESVTDSLFGEYKCVASNEHRKNG----VERIILLNV 3056
            +EPP +    +     M +   + C A G+P P++ WY++   R++  +     ++ VG +    ++I+      E  Y C+A ++ G  R  T  +        V++      V    +    C         I    + +IR+  + K ++K       +  IN+ Q   LHI      D       C+  N+   D+ V +   +S  R+    +   T     + V + +  TL+     +P  + I W   + +     L  L+  ++  +++  GNLLI +  I ++G +      +  N Y   +    + V+  + P + +    E +       L CV   G P+ S++W+ +        + + +   S    + +R  N    G Y C+A S   A N  L  +    +K  FV   E     I   P +         V+ +     DG  F I C  +  P   + WYLD + I       PN+     +TV A    D + ++   +K  Y G Y  + TN  G     T I + +  MI        +       + C V    KP I W  D K      P T    V+EDG L  I  V++  H G + C++       ++T ++T+   P + ++    I+L   +D   L C  +  P  P    W ++  K  +  +P  +  +  L   ++K+E                 + Y  +TV EK                +T        GVP  +R               +  + +  + I   +K  +   +CVV N AGT + T  + +      + PP+       + + V+G    L C   ++ P ++     WF    +        V        +GTLV+++  + D   + C      GK E +  V +   + +  +  PDV+    +K ++  SL C V  +    + WY  +    D     K   +K K+  F  K   +TDS  G YKCVA N   +      VE I+ LN+
Sbjct:  608 MEPPSVKVTPQDVYFNMREGVNLSCEAMGDPKPEVHWYFK--GRHLLNDY----KYQVGQDSKF-LYIRDATHHDEGTYECRAMSQAGQARDTTDLM--LATPPKVEIIQNKMMVGRGDRVSFEC-------KTIRGKPHPKIRWFKNGKDLIK----PDDYIKINEGQ---LHIMGAKDEDAG--AYSCVGENMAGKDVQVAN---LSVGRVPTIIESPHT-----VRVNIERQVTLQCLAVGIPPPE-IEWQKGNVL-----LATLNNPRYTQLAD--GNLLITDAQIEDQGQFTC----IARNTYGQQSQSTTLMVTGLVSPVLGHVPPEEQLIEGQDLTLSCVVVLGTPKPSIVWIKDDKPVEEGPTIKIEGGGSL---LRLRGGNPKDEGKYTCIAVSP--AGNSTLHINVQLIKKPEFVYKPEGG---IVFKPTISGMDEKHVAVVNSTHDVLDGEGFAIPCVVSGTPPPIITWYLDGRPI------TPNSR---DFTVTA----DNTLIVRKADK-SYSGVYTCQATNSAGDNEQKTTIRIMNTPMISPGQSSFNMVVDDLFTIPCDVYGDPKPVITWLLDDK------PFTE-GVVNEDGSL-TIPNVNEA-HRGTFTCHAQNAAGNDTRTVTLTVHTTPTINAENQEKIAL--QNDDIVLECPAKALP--PPVRLWTYEGEKIDSQLIPHTIREDGALVLQNVKLENTGVFVCQVSNLAGEDSLSY-TLTVHEKPKIISEVPGVVDVVKGFTIEIPCRATGVPEVIRTWNKNGIDLKMDEKKFSVDNLGTLRIYEADKNDIGNYNCVVTNEAGTSQMTTHVDV------QEPPIILPSTQTNNTAVVGDRVELKCYVEASPPASV----TWFRRGIAIGTDTKGYVVES-----DGTLVIQSASVEDATIYTCKASNPAGKAEANLQVTV---IASPDIKDPDVVTQESIKESHPFSLYCPVFSNPLPQISWYLNDKPLIDDKTSWKTSDDKRKLHVFKAK---ITDS--GVYKCVARNAAGEGSKSFQVEVIVPLNL 1550          

HSP 2 Score: 72.4034 bits (176), Expect = 5.340e-12
Identity = 155/725 (21.38%), Postives = 268/725 (36.97%), Query Frame = 3
Query: 1188 LKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITI-RVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDI----TLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLNNLKISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQ-ISIDNLVFKESPPLDYSIVLGQSFALNCSAKPTNIQLKTNWFXXXXXXXXXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAI--KVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRK--EDGNWDSLPVKRIKEKSKVSRFFVKFESVTDSLFGEYKCVASNEHRKNGVERIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDG-KKPITRYLVSWKLVTENWFINATTKETSITIEDLRPFKEYDIAIVAENSVGYGEEATII 3329
            L C A G P  ++ WL +GN    +  +     F     + I +      G Y C+A       N + S+D ++   +I           PPV         V   +G S ++ C  N      V W  D   I   + L  ++  ++P +           M  +  +    G Y   V N  G+A       V D   I D        T+     + + C V     P + W  D K      P++    ++ +G    I +  +V H+G Y C +  N  K  K F V +  PP    +    ++  +  DT  LTC                    +  SVP LS+ Y + HD  +    Q   ++ KY  N   L     N    Q +         +E  +     C   N AG  +K  + I I+   F +   L Y I+LG+   L+CSA  T     T  F  D       +         +   TLV+ N +     ++ CI +   G+ E   +V++ +  K+    +N    ++++     +L C +     + + W R+  +DG  D     R +  S  S+ ++   +  D+    Y C+A N+    G E +  +  V+ P K +  +    +   +      P  ++G   P   + +  K + E   +     + S+ I++++P +E     VAEN  G  E+ T +
Sbjct: 2498 LHCPAKGSPSPTITWLKDGNAIEPNDRY---VFFDAGRQLQISKTEGSDQGRYTCIAT------NSVGSDDLENTLEVII----------PPVIDGERR-EAVAVIEGFSSELFCDSNST-GVDVEWQKDGLTINQ-DTLRGDSFIQIPSSG--------KKMSFLSARKSDSGRYTCIVRNPAGEARKLFDFAVNDPPSISDELSSANIQTIVPYYPVEINCVVSGSPHPKVYWLFDDK---PLEPDSAAYELTNNGETLKIVR-SQVEHAGTYTCEAQNNVGKARKDFLVRVTAPPHFEKEREEVVA--RVGDTMLLTC-------------------NAESSVP-LSSVYWHAHDESV----QNGVITSKYAANEKTL-----NVTNIQLD---------DEGFYY----CTAVNEAGITKKFFKLIVIETPYFLDQQKL-YPIILGKRLTLDCSA--TGTPPPTILFMKDGKRLNESDEV------DIIGSTLVIDNPQKEVEGRYTCIAENKAGRSEKDMMVEVLLPPKLSKEWIN----VEVQAGDPLTLECPIEDTSGVHITWSRQFGKDGQLD----MRAQSSSDKSKLYIMQATPEDA--DSYSCIAVND--AGGAEAVFQV-TVNTPPK-IFGDSFSTTEIVADTTLEIPCRTEGIPPPEISWFLDGKPILEMPGVTYKQGDLSLRIDNIKPNQEGRYTCVAENKAGRAEQDTYV 3121          

HSP 3 Score: 60.8474 bits (146), Expect = 1.649e-8
Identity = 151/725 (20.83%), Postives = 253/725 (34.90%), Query Frame = 3
Query: 1125 INVSVDIKP--------TVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIP---MVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPD--ITLTHGSELRLKCYVIS--GLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLNNLKISKTFSVTIANPP--IMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHS---VPLLSNSYLNKHDLKI-EIKYQKITVSEKYT---DNGAA------------LPK----GVPNFVRYQHNKIAQI-------------WIKYN---------------EKLHL--------SQISCVVQNHAGTIRKTIQISIDNLVFKESPPLDYSIVL--GQSFALNCSAKPTNIQLKTNWFXXXXXXXXXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKR--------NYENSLNCTVHGDDELDVKWYRKEDG---NWDSLPVKRIKEKSKVSRFFVKFESVTDSLFGEYKCVASN---EHRK 3023
            INV V  KP        + +       + L+C       + + W  NG  F +           R  HI +    D  G Y C   +      +         F +  ++ P ++ +          G      + +S  + C+    PN  V W  D + +     V VL     +++ +  IA                 + G Y     N  G A  +  + +    MI+      +T   G  L  KC +      K  I W R+ +   +   +     +S D RL I+   +     G+Y C    +  + S  F  T+  PP  IML       ++  ++ T S     + +PD+ W     FK+ ++ H      ++ N  LN + LKI  IK      + KYT   DN A             +PK    G+P+    Q N+   I             W+K                 +KL+L        S+ +C+  N AGT ++  ++S+      + P +   I +  G    L+C AK +     T W    ++              QL      +   E +D  ++ CI    VG D++   +++ I         P VID +R         + + L C  +    +DV+W  ++DG   N D+L      +     +  + F S   S  G Y C+  N   E RK
Sbjct: 1997 INVHVRTKPRFESGLTESELTVNLTRSITLECDVDDAIGVGISWTVNGKPFLAETDGVQTLAGGRFLHI-VSAKTDDHGSYACTVTNEAGVATK--------TFNLFVQVPPTIVNE----------GGEYTVIENNSLVLPCEVTGKPNPVVTWTKDGRPVGDLKSVQVLSEGQQFKIVHAEIA-----------------HKGSYICMAKNDVGTAEISFDVDIITRPMIQKGIKNIVTAIKGGALPFKCPIDDDKNFKGQIIWLRNYQPIDLEAEDARITRLSNDRRLTILNVTEN--DEGQYSCRVKNDAGENSFDFKATVLVPPTIIMLDKDKNKTAVEHSTVTLSCPATGKPEPDITW-----FKDGEAIHIENIADIIPNGELNGNQLKITRIKEGD---AGKYTCEADNSAGSVEQDVNVNVITIPKIEKDGIPSDYESQQNERVVISCPVYARPPAKITWLKAGKPLQSDKFVKTSANGQKLYLFKLRETDSSKYTCIATNEAGTDKRDFKVSMLVAPSFDEPNIVRRITVNSGNPSTLHCPAKGSPSPTIT-WLKDGNAIEPNDRYVFFDAGRQLQ-----ISKTEGSDQGRYTCIATNSVGSDDLENTLEVII---------PPVIDGERREAVAVIEGFSSELFCDSNSTG-VDVEW--QKDGLTINQDTLRGDSFIQIPSSGK-KMSFLSARKSDSGRYTCIVRNPAGEARK 2656          

HSP 4 Score: 56.6102 bits (135), Expect = 2.604e-7
Identity = 140/624 (22.44%), Postives = 228/624 (36.54%), Query Frame = 3
Query:  198 PPKLINVQKSFVTTMTDHS-RVYCTATGNPSPKIKWYYETTQRNVFTEVNDPDRFVVGTNGDMDIFI---QANIEVIY-CKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRN------IYTDIDVKSHDWISPKRLEDNSKIDFTSICQNIEVRVIKGSTLELPWCSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLL-IKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINV----SVDIKPTVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSK---SFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNST 2012
            PPK+     S    + D +  + C   G P P+I W+ +        E+      V    GD+ + I   + N E  Y C A+N+ G  R++  T  +  +   V +  E   V   ++  I C ++      + +++  E  Y SD    L  + T+  +          LH+R  T AD       CI  N        TD++V     + P R+ED             E RV++G             ++   Y      + R +  ++  +     E F  +L I+N   A+EG Y      + SN   T     +I+V    + +   T  N    E  +++C   G+P+ ++ WL  G  FN      S   DT       + ++      G+Y C+A +         SE    V V         I Q+P                G    ++C     P  TV W   D  +P  +       Y L    + T      + +++ E       Y AEV  K      T +    ++Y + +   IT        + C V S   P+I WFR    K V L + +  ++S DG    I K  K+   GKYIC ++
Sbjct: 3034 PPKIFGDSFSTTEIVADTTLEIPCRTEGIPPPEISWFLDGKP---ILEMPG----VTYKQGDLSLRIDNIKPNQEGRYTCVAENKAG--RAEQDTYVEISEPPRVVMASEVMRVVEGRQTTIRCEVFGNPEPVVNWLKDGE-PYTSD----LLQFSTKLSY----------LHLRETTLADGGTY--TCIATNKAGESQTTTDVEV-----LVPPRIED-------------EERVLQG-------------KEGNTYMVHCQVTGRPVPYVTWKRNGKEIEQFNPVLHIRNATRADEGKYSC----IASNEAGTAVADFLIDVFTKPTFETHETTFNIVEGESAKIECKIDGHPKPTISWLKGGRPFNMDNIILSPRGDT------LMILKAQRFDGGLYTCVATNSYGD-----SEQDFKVNVYTKPYIDETIDQTPKA------------VAGGEIILKCPVLGNPTPTVTWKRGDDAVPNDSRHTIVNNYDLKINSVTTEDAGQYSCIAVNEAGNLTTHYAAEVIGKP-----TFVRKGGNLYEVIENDTIT--------MDCGVTSRPLPSISWFR--GDKPVYLYDRY--SISPDGSHITINKA-KLSDGGKYICRAS 3555          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Celegans
Match: him-4 (High Incidence of Males (Increased X chromosome loss) [Source:UniProtKB/TrEMBL;Acc:A4UVK0])

HSP 1 Score: 82.8037 bits (203), Expect = 3.555e-15
Identity = 227/1047 (21.68%), Postives = 397/1047 (37.92%), Query Frame = 3
Query:  192 LEPPKLINVQKSFVTTMTDHSRVYCTATGNPSPKIKWYYETTQRNVFTEVNDPDRFVVGTNGDMDIFIQANI---EVIY-CKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRNIYT-DIDVKSHDWISPKRLEDNSKIDFTSICQNIEVRVIKGSTLELPWCSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTVVNARYNEIV------QLKCVAT-GYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRV-NADTAGVYQCLAESRDNAENRILSED----QKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKT-----DGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIR-DYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLNNLKISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAK-SNHSVP--LLSNSYLNKHDLKIE-----------------IKYQKITVSEK----------------YTDNGAALPKGVPNFVR---------------YQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQISIDNLVFKESPPL-------DYSIVLGQSFALNC---SAKPTNIQLKTNWFXXXXXXXXXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVI---DMKRNYENSLNCTVHGDDELDVKWYRKEDGNWDSLPV-KRIKEKSKVSRFFVKFESVTDSLFGEYKCVASNEHRKNG----VERIILLNV 3056
            +EPP +    +     M +   + C A G+P P++ WY++   R++  +     ++ VG +    ++I+      E  Y C+A ++ G  R  T  +        V++      V    +    C         I    + +IR+  + K ++K       +  IN+ Q   LHI      D       C+  N+   D+ V +   +S  R+    +   T +  NIE +V    TL+     +P  + I W   + +     L  L+  ++  +++  GNLLI +  I ++G +      +  N Y   +    + V+  + P + +    E +       L CV   G P+ S++W+ +        + + +   S    + +R  N    G Y C+A S   A N  L  +    +K  FV   E     I   P +         V+ +     DG  F I C  +  P   + WYLD + I       PN+     +TV A    D + ++   +K  Y G Y  + TN  G     T I + +  MI        +       + C V    KP I W  D K      P T    V+EDG L  I  V++  H G + C++       ++T ++T+   P + ++    I+L   +D   L C  +  P  P    W ++  K  +  +P  +  +  L   ++K+E                 + Y  +TV EK                +T        GVP  +R               +  + +  + I   +K  +   +CVV N AGT + T  + +      + PP+       + + V+G    L C   ++ P ++     WF    +        V        +GTLV+++  + D   + C      GK E +  V +   + +  +  PDV+    +K ++  SL C V  +    + WY  +    D     K   +K K+  F  K   +TDS  G YKCVA N   +      VE I+ LN+
Sbjct:  608 MEPPSVKVTPQDVYFNMREGVNLSCEAMGDPKPEVHWYFK--GRHLLNDY----KYQVGQDSKF-LYIRDATHHDEGTYECRAMSQAGQARDTTDLM--LATPPKVEIIQNKMMVGRGDRVSFEC-------KTIRGKPHPKIRWFKNGKDLIK----PDDYIKINEGQ---LHIMGAKDEDAG--AYSCVGENMAGKDVQVAN---LSVGRVPTIIESPHT-VRVNIERQV----TLQCLAVGIPPPE-IEWQKGNVL-----LATLNNPRYTQLAD--GNLLITDAQIEDQGQFTC----IARNTYGQQSQSTTLMVTGLVSPVLGHVPPEEQLIEGQDLTLSCVVVLGTPKPSIVWIKDDKPVEEGPTIKIEGGGSL---LRLRGGNPKDEGKYTCIAVSP--AGNSTLHINVQLIKKPEFVYKPEGG---IVFKPTISGMDEKHVAVVNSTHDVLDGEGFAIPCVVSGTPPPIITWYLDGRPI------TPNSR---DFTVTA----DNTLIVRKADK-SYSGVYTCQATNSAGDNEQKTTIRIMNTPMISPGQSSFNMVVDDLFTIPCDVYGDPKPVITWLLDDK------PFTE-GVVNEDGSL-TIPNVNEA-HRGTFTCHAQNAAGNDTRTVTLTVHTTPTINAENQEKIAL--QNDDIVLECPAKALP--PPVRLWTYEGEKIDSQLIPHTIREDGALVLQNVKLENTGVFVCQVSNLAGEDSLSY-TLTVHEKPKIISEVPGVVDVVKGFTIEIPCRATGVPEVIRTWNKNGIDLKMDEKKFSVDNLGTLRIYEADKNDIGNYNCVVTNEAGTSQMTTHVDV------QEPPIILPSTQTNNTAVVGDRVELKCYVEASPPASV----TWFRRGIAIGTDTKGYVVES-----DGTLVIQSASVEDATIYTCKASNPAGKAEANLQVTV---IASPDIKDPDVVTQESIKESHPFSLYCPVFSNPLPQISWYLNDKPLIDDKTSWKTSDDKRKLHVFKAK---ITDS--GVYKCVARNAAGEGSKSFQVEVIVPLNL 1550          

HSP 2 Score: 72.0182 bits (175), Expect = 6.265e-12
Identity = 155/725 (21.38%), Postives = 268/725 (36.97%), Query Frame = 3
Query: 1188 LKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITI-RVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDI----TLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLNNLKISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQ-ISIDNLVFKESPPLDYSIVLGQSFALNCSAKPTNIQLKTNWFXXXXXXXXXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAI--KVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRK--EDGNWDSLPVKRIKEKSKVSRFFVKFESVTDSLFGEYKCVASNEHRKNGVERIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDG-KKPITRYLVSWKLVTENWFINATTKETSITIEDLRPFKEYDIAIVAENSVGYGEEATII 3329
            L C A G P  ++ WL +GN    +  +     F     + I +      G Y C+A       N + S+D ++   +I           PPV         V   +G S ++ C  N      V W  D   I   + L  ++  ++P +           M  +  +    G Y   V N  G+A       V D   I D        T+     + + C V     P + W  D K      P++    ++ +G    I +  +V H+G Y C +  N  K  K F V +  PP    +    ++  +  DT  LTC                    +  SVP LS+ Y + HD  +    Q   ++ KY  N   L     N    Q +         +E  +     C   N AG  +K  + I I+   F +   L Y I+LG+   L+CSA  T     T  F  D       +         +   TLV+ N +     ++ CI +   G+ E   +V++ +  K+    +N    ++++     +L C +     + + W R+  +DG  D     R +  S  S+ ++   +  D+    Y C+A N+    G E +  +  V+ P K +  +    +   +      P  ++G   P   + +  K + E   +     + S+ I++++P +E     VAEN  G  E+ T +
Sbjct: 2498 LHCPAKGSPSPTITWLKDGNAIEPNDRY---VFFDAGRQLQISKTEGSDQGRYTCIAT------NSVGSDDLENTLEVII----------PPVIDGERR-EAVAVIEGFSSELFCDSNST-GVDVEWQKDGLTINQ-DTLRGDSFIQIPSSG--------KKMSFLSARKSDSGRYTCIVRNPAGEARKLFDFAVNDPPSISDELSSANIQTIVPYYPVEINCVVSGSPHPKVYWLFDDK---PLEPDSAAYELTNNGETLKIVR-SQVEHAGTYTCEAQNNVGKARKDFLVRVTAPPHFEKEREEVVA--RVGDTMLLTC-------------------NAESSVP-LSSVYWHAHDESV----QNGVITSKYAANEKTL-----NVTNIQLD---------DEGFYY----CTAVNEAGITKKFFKLIVIETPYFLDQQKL-YPIILGKRLTLDCSA--TGTPPPTILFMKDGKRLNESDEV------DIIGSTLVIDNPQKEVEGRYTCIAENKAGRSEKDMMVEVLLPPKLSKEWIN----VEVQAGDPLTLECPIEDTSGVHITWSRQFGKDGQLD----MRAQSSSDKSKLYIMQATPEDA--DSYSCIAVND--AGGAEAVFQV-TVNTPPK-IFGDSFSTTEIVADTTLEIPCRTEGIPPPEISWFLDGKPILEMPGVTYKQGDLSLRIDNIKPNQEGRYTCVAENKAGRAEQDTYV 3121          

HSP 3 Score: 60.4622 bits (145), Expect = 1.902e-8
Identity = 151/725 (20.83%), Postives = 253/725 (34.90%), Query Frame = 3
Query: 1125 INVSVDIKP--------TVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIP---MVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPD--ITLTHGSELRLKCYVIS--GLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLNNLKISKTFSVTIANPP--IMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHS---VPLLSNSYLNKHDLKI-EIKYQKITVSEKYT---DNGAA------------LPK----GVPNFVRYQHNKIAQI-------------WIKYN---------------EKLHL--------SQISCVVQNHAGTIRKTIQISIDNLVFKESPPLDYSIVL--GQSFALNCSAKPTNIQLKTNWFXXXXXXXXXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKR--------NYENSLNCTVHGDDELDVKWYRKEDG---NWDSLPVKRIKEKSKVSRFFVKFESVTDSLFGEYKCVASN---EHRK 3023
            INV V  KP        + +       + L+C       + + W  NG  F +           R  HI +    D  G Y C   +      +         F +  ++ P ++ +          G      + +S  + C+    PN  V W  D + +     V VL     +++ +  IA                 + G Y     N  G A  +  + +    MI+      +T   G  L  KC +      K  I W R+ +   +   +     +S D RL I+   +     G+Y C    +  + S  F  T+  PP  IML       ++  ++ T S     + +PD+ W     FK+ ++ H      ++ N  LN + LKI  IK      + KYT   DN A             +PK    G+P+    Q N+   I             W+K                 +KL+L        S+ +C+  N AGT ++  ++S+      + P +   I +  G    L+C AK +     T W    ++              QL      +   E +D  ++ CI    VG D++   +++ I         P VID +R         + + L C  +    +DV+W  ++DG   N D+L      +     +  + F S   S  G Y C+  N   E RK
Sbjct: 1997 INVHVRTKPRFESGLTESELTVNLTRSITLECDVDDAIGVGISWTVNGKPFLAETDGVQTLAGGRFLHI-VSAKTDDHGSYACTVTNEAGVATK--------TFNLFVQVPPTIVNE----------GGEYTVIENNSLVLPCEVTGKPNPVVTWTKDGRPVGDLKSVQVLSEGQQFKIVHAEIA-----------------HKGSYICMAKNDVGTAEISFDVDIITRPMIQKGIKNIVTAIKGGALPFKCPIDDDKNFKGQIIWLRNYQPIDLEAEDARITRLSNDRRLTILNVTEN--DEGQYSCRVKNDAGENSFDFKATVLVPPTIIMLDKDKNKTAVEHSTVTLSCPATGKPEPDITW-----FKDGEAIHIENIADIIPNGELNGNQLKITRIKEGD---AGKYTCEADNSAGSVEQDVNVNVITIPKIEKDGIPSDYESQQNERVVISCPVYARPPAKITWLKAGKPLQSDKFVKTSANGQKLYLFKLRETDSSKYTCIATNEAGTDKRDFKVSMLVAPSFDEPNIVRRITVNSGNPSTLHCPAKGSPSPTIT-WLKDGNAIEPNDRYVFFDAGRQLQ-----ISKTEGSDQGRYTCIATNSVGSDDLENTLEVII---------PPVIDGERREAVAVIEGFSSELFCDSNSTG-VDVEW--QKDGLTINQDTLRGDSFIQIPSSGK-KMSFLSARKSDSGRYTCIVRNPAGEARK 2656          

HSP 4 Score: 56.6102 bits (135), Expect = 2.954e-7
Identity = 140/624 (22.44%), Postives = 228/624 (36.54%), Query Frame = 3
Query:  198 PPKLINVQKSFVTTMTDHS-RVYCTATGNPSPKIKWYYETTQRNVFTEVNDPDRFVVGTNGDMDIFI---QANIEVIY-CKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRN------IYTDIDVKSHDWISPKRLEDNSKIDFTSICQNIEVRVIKGSTLELPWCSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLL-IKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINV----SVDIKPTVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSK---SFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNST 2012
            PPK+     S    + D +  + C   G P P+I W+ +        E+      V    GD+ + I   + N E  Y C A+N+ G  R++  T  +  +   V +  E   V   ++  I C ++      + +++  E  Y SD    L  + T+  +          LH+R  T AD       CI  N        TD++V     + P R+ED             E RV++G             ++   Y      + R +  ++  +     E F  +L I+N   A+EG Y      + SN   T     +I+V    + +   T  N    E  +++C   G+P+ ++ WL  G  FN      S   DT       + ++      G+Y C+A +         SE    V V         I Q+P                G    ++C     P  TV W   D  +P  +       Y L    + T      + +++ E       Y AEV  K      T +    ++Y + +   IT        + C V S   P+I WFR    K V L + +  ++S DG    I K  K+   GKYIC ++
Sbjct: 3034 PPKIFGDSFSTTEIVADTTLEIPCRTEGIPPPEISWFLDGKP---ILEMPG----VTYKQGDLSLRIDNIKPNQEGRYTCVAENKAG--RAEQDTYVEISEPPRVVMASEVMRVVEGRQTTIRCEVFGNPEPVVNWLKDGE-PYTSD----LLQFSTKLSY----------LHLRETTLADGGTY--TCIATNKAGESQTTTDVEV-----LVPPRIED-------------EERVLQG-------------KEGNTYMVHCQVTGRPVPYVTWKRNGKEIEQFNPVLHIRNATRADEGKYSC----IASNEAGTAVADFLIDVFTKPTFETHETTFNIVEGESAKIECKIDGHPKPTISWLKGGRPFNMDNIILSPRGDT------LMILKAQRFDGGLYTCVATNSYGD-----SEQDFKVNVYTKPYIDETIDQTPKA------------VAGGEIILKCPVLGNPTPTVTWKRGDDAVPNDSRHTIVNNYDLKINSVTTEDAGQYSCIAVNEAGNLTTHYAAEVIGKP-----TFVRKGGNLYEVIENDTIT--------MDCGVTSRPLPSISWFR--GDKPVYLYDRY--SISPDGSHITINKA-KLSDGGKYICRAS 3555          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Fly
Match: Dscam4 (gene:FBgn0263219 transcript:FBtr0333589)

HSP 1 Score: 275.789 bits (704), Expect = 6.665e-74
Identity = 385/1634 (23.56%), Postives = 655/1634 (40.09%), Query Frame = 3
Query:  420 CKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKAD-FSDMEVRCIMRNIYTDIDVKSHDWISPKRLEDNSKIDFTSICQNIEVR-----VIKGSTLELPWCSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAP-LLIWQSPP-VQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEE-KWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLNNLKISK-TFSVTIANPPIMLSDLPVSISLN--KNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQISIDNLVFKESPPLDYSIVLGQSFALNC--SAKPTNIQLKTNWFXXXXXXXXXXXXXXXXRIHQL-PNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKEDGNWDSLPVKRIKEKSKVSRFFVKFESVTDSLFGE-------------YKCVASNEHRKNGVE-RIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWKLVTENW----FINATTKETSITIEDLRPFKEYDIAIVAENSVGYGEEATII-IKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQV---CSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSP-AKYVAIRTLEDKPEGTPIQVLCSP-KANFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNVKETHLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIKAYFYQNC-LKVSWTPPIKANGHIREYIIVFSFEPNNMITVSSRENDKPYYSW-ELCSEQICSNCNVSVLAVTTMKGPRKTVNVL---SNKM--GILSFXXXXXXXXXXXXXLYC-EVAFPDE-NIYYLWTHNDKDIYGQGVQSNGSLVINSMAESDQGIYKCKVKS----EEITYNVSTKSISLVPQTPYIEITKVSTNHIALLWRSN---GSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSNPA-ISQAQTRGSIPEIPDTSNIVTEIGPHSMCFNLRAFRPGRGCPANKYILKLWPSSEGNHQESGVSVWKVVNDSDLNQIP----CFNVTDLHPNTDYVYSIEASNMVGSQKA 5141
            CK +N +GTV S+ + V+  ++ K   V+   + V     AV+ C + P+ ++    V  W    +     +       G+++V++  +   L+I N    D +     R + R +  ++ + ++    P R+             N+E       V+ G T  LP C    +    + W    + +   + LS  +  ++S   G L I    + + G Y            +  ++ V   ++  ++P V     ++  Q +C+ +G+P   + WL +G         E  T+  R   I  +V  +  G+YQC   +          + Q +  + + + +P LL W S   +QP            G +  ++C     P     W LD   IP         + R       T+  D+ + ++I   K + GGEY     N  GK   +  + +  +  IR+ P IT   GS+L +KC V       I W RD +     LP    Q    +G L IIE++ ++  +G Y C +     + S+    + +  PP ++   P+    N  +     +++C                                        +I    + VS ++  NG  L        R      A + I++    H    +C+  N AGT R T+ ++++        P D S   G    L+C  S  PT       W              +     QL PNGT+  K I       F+C  K  +G   +SKV+ + + VPA        I + +  +  + C V GD+ +D KW  +          ++  ++S  SR+ ++ + + D +  E             Y C ASN   ++ +  ++I+  V + P  + I ++  RS   +    W+ P + G  PI  Y + +K +++ W     +     +T I I+ LRP K Y I + AEN +G  E + ++ + T  + P GP L + A   S  ++ + W++P     NGI   Y V    S+   D +    + F++        + V+  +H   ++ +             L  FT+Y   V    + G  P +K +A++T+ED P   P    C    +  +++ W+PP  +  NG I GY+V Y S D+  E D  +      ++ + NL   + Y + +     +G G  ++P  C T+E  P  P  IKA    +  + +SW PP   NG I  Y    S         + +    P+    E    Q  +     + A T M    KT  V    +NK+   I+SFSQ IV      + L C +V  P    I+    HN +    + +  NG+L +     SD G Y C V++    +EI YN+  K   + P+ P + +    T+ + L W  N   GSP   Y IN      +  NG    EL+V S   S ++ NL CGT Y +Y+ A N  G   P  I  + T+G+ P  P  S ++T       C+ L ++  G GC    ++++         +  G S W VV+    N IP     + V+DL P T Y   + A N  GS  A
Sbjct:  105 CKLRNLVGTVLSREVHVRGVVNQK-YAVQVHDEYVMTGNTAVLKCQV-PSYMSEFVLVTAW---VQDTGMHLYPNTDIGGKYTVLSNGE---LYINNAGPNDAYKSYTCRTVNR-LTGEVQISTY----PGRIIVTEPKGMVQPRINVEKHSMRHVVLNGQTT-LP-CIAQGHPVPTYRWFKEENEQLLPLQLS-ERITIVSA--GLLKITKARLEDSGKYLCWVNNTAGEETIQVSLTVTAPLTAHLQPQVQTVDVDKDAQFQCIVSGHPVHDVNWLHDGKPILRDNRVEILTDPPRL--IIKKVQKEDPGMYQCFVSNE-------WEQIQSTAELQLGDASPELLYWFSEQTLQP------------GPTVSLKCVATGNPLPQFTWSLDGFPIP--------DSSRFLVGQYVTIHDDVISHVNISNVKEEDGGEYTCTAQNAIGKVSHSAKVNIYGLPYIREMPKITGISGSDLIVKCPVAGYPIDKIHWERDGQ----TLPINRRQRAYNNGTL-IIEQLQRLEDAGTYTCMAQNKQKQTSRRNVEIQVLVPPKIM---PIQAMTNMLREGMRAAISC----------------------------------------QILEGDLPVSFRWERNGKPLIGTGNEVFRRLDEYSASLVIEHISSDHSGNYTCIASNVAGTERFTVPLTVNVPPKWILEPKDSSAQAGADVLLHCQSSGYPTPT---ITWKKAIGPTPGEYKDFLYEPTVQLFPNGTIFFKKISKESQGHFLCEAKNNIGSG-VSKVIFLKVNVPAHFQTKTKQISVAKGKQVHVQCNVQGDNPIDFKWKIQA--------TQQYLDESLDSRYTIRDQVLDDGMVSELGISHTYRQDTGIYICQASNAFGQDEMSIQLIVQEVPEQPKNLRINSQQSRSLQLT----WSQPFA-GNSPIEEYHIYYKQISDIWQNAEHLTIAGAQTVINIQQLRPAKAYHIRMSAENKLGASEFSEVVQVTTLEEVPSGPPLAVRAEPKSSTEIFVTWDAPERDHWNGILLGYYVGYQMSLTPEDKEVNPTQGFSF--------KTVEVRSHFGGETVL-----------ANLNKFTQYHVIVQAYTSQGSGPPSKEIAVQTMEDVPSSPPESPQCDVLGSTSIYITWSPPDIDGQNGKIKGYKVFYISVDELYETDPEVVKSTNQYVTIENLRKYTNYTVWVLAYTKVGDGMKTKPFYCRTHEDVPSAPQAIKAIPASSSKIIISWLPPDLPNGDITGYTFYMSMLEGGREEGTHKRLLGPFVEMHETVRTQESATYQFWLTASTKMGEGEKTQVVTVPPNNKVPARIVSFSQRIVTPWKEHLELPCRKVGAPAPVTIWRQDGHNMETSARKTIAKNGTLYMKECQASDAGNYTCSVENTWGKDEIVYNIVVK---VPPEAPNLTVINAYTDSLLLEWMDNSHGGSPILGYVIN-----YKRDNG-DWEELQVDSKTTSHLLTNLWCGTRYQLYITAYNKIGTGLPCDIVNSYTKGNPPVQPKHSQMITNNSTSVTCW-LDSWGDG-GCGILYFMIE--------SRVYGRSSWAVVS----NHIPPTERIYTVSDLVPGTKYQLKVTAHNNAGSTTA 1584          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Fly
Match: Dscam4 (gene:FBgn0263219 transcript:FBtr0333590)

HSP 1 Score: 275.789 bits (704), Expect = 6.665e-74
Identity = 385/1634 (23.56%), Postives = 655/1634 (40.09%), Query Frame = 3
Query:  420 CKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKAD-FSDMEVRCIMRNIYTDIDVKSHDWISPKRLEDNSKIDFTSICQNIEVR-----VIKGSTLELPWCSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAP-LLIWQSPP-VQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEE-KWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLNNLKISK-TFSVTIANPPIMLSDLPVSISLN--KNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQISIDNLVFKESPPLDYSIVLGQSFALNC--SAKPTNIQLKTNWFXXXXXXXXXXXXXXXXRIHQL-PNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKEDGNWDSLPVKRIKEKSKVSRFFVKFESVTDSLFGE-------------YKCVASNEHRKNGVE-RIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWKLVTENW----FINATTKETSITIEDLRPFKEYDIAIVAENSVGYGEEATII-IKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQV---CSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSP-AKYVAIRTLEDKPEGTPIQVLCSP-KANFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNVKETHLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIKAYFYQNC-LKVSWTPPIKANGHIREYIIVFSFEPNNMITVSSRENDKPYYSW-ELCSEQICSNCNVSVLAVTTMKGPRKTVNVL---SNKM--GILSFXXXXXXXXXXXXXLYC-EVAFPDE-NIYYLWTHNDKDIYGQGVQSNGSLVINSMAESDQGIYKCKVKS----EEITYNVSTKSISLVPQTPYIEITKVSTNHIALLWRSN---GSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSNPA-ISQAQTRGSIPEIPDTSNIVTEIGPHSMCFNLRAFRPGRGCPANKYILKLWPSSEGNHQESGVSVWKVVNDSDLNQIP----CFNVTDLHPNTDYVYSIEASNMVGSQKA 5141
            CK +N +GTV S+ + V+  ++ K   V+   + V     AV+ C + P+ ++    V  W    +     +       G+++V++  +   L+I N    D +     R + R +  ++ + ++    P R+             N+E       V+ G T  LP C    +    + W    + +   + LS  +  ++S   G L I    + + G Y            +  ++ V   ++  ++P V     ++  Q +C+ +G+P   + WL +G         E  T+  R   I  +V  +  G+YQC   +          + Q +  + + + +P LL W S   +QP            G +  ++C     P     W LD   IP         + R       T+  D+ + ++I   K + GGEY     N  GK   +  + +  +  IR+ P IT   GS+L +KC V       I W RD +     LP    Q    +G L IIE++ ++  +G Y C +     + S+    + +  PP ++   P+    N  +     +++C                                        +I    + VS ++  NG  L        R      A + I++    H    +C+  N AGT R T+ ++++        P D S   G    L+C  S  PT       W              +     QL PNGT+  K I       F+C  K  +G   +SKV+ + + VPA        I + +  +  + C V GD+ +D KW  +          ++  ++S  SR+ ++ + + D +  E             Y C ASN   ++ +  ++I+  V + P  + I ++  RS   +    W+ P + G  PI  Y + +K +++ W     +     +T I I+ LRP K Y I + AEN +G  E + ++ + T  + P GP L + A   S  ++ + W++P     NGI   Y V    S+   D +    + F++        + V+  +H   ++ +             L  FT+Y   V    + G  P +K +A++T+ED P   P    C    +  +++ W+PP  +  NG I GY+V Y S D+  E D  +      ++ + NL   + Y + +     +G G  ++P  C T+E  P  P  IKA    +  + +SW PP   NG I  Y    S         + +    P+    E    Q  +     + A T M    KT  V    +NK+   I+SFSQ IV      + L C +V  P    I+    HN +    + +  NG+L +     SD G Y C V++    +EI YN+  K   + P+ P + +    T+ + L W  N   GSP   Y IN      +  NG    EL+V S   S ++ NL CGT Y +Y+ A N  G   P  I  + T+G+ P  P  S ++T       C+ L ++  G GC    ++++         +  G S W VV+    N IP     + V+DL P T Y   + A N  GS  A
Sbjct:  105 CKLRNLVGTVLSREVHVRGVVNQK-YAVQVHDEYVMTGNTAVLKCQV-PSYMSEFVLVTAW---VQDTGMHLYPNTDIGGKYTVLSNGE---LYINNAGPNDAYKSYTCRTVNR-LTGEVQISTY----PGRIIVTEPKGMVQPRINVEKHSMRHVVLNGQTT-LP-CIAQGHPVPTYRWFKEENEQLLPLQLS-ERITIVSA--GLLKITKARLEDSGKYLCWVNNTAGEETIQVSLTVTAPLTAHLQPQVQTVDVDKDAQFQCIVSGHPVHDVNWLHDGKPILRDNRVEILTDPPRL--IIKKVQKEDPGMYQCFVSNE-------WEQIQSTAELQLGDASPELLYWFSEQTLQP------------GPTVSLKCVATGNPLPQFTWSLDGFPIP--------DSSRFLVGQYVTIHDDVISHVNISNVKEEDGGEYTCTAQNAIGKVSHSAKVNIYGLPYIREMPKITGISGSDLIVKCPVAGYPIDKIHWERDGQ----TLPINRRQRAYNNGTL-IIEQLQRLEDAGTYTCMAQNKQKQTSRRNVEIQVLVPPKIM---PIQAMTNMLREGMRAAISC----------------------------------------QILEGDLPVSFRWERNGKPLIGTGNEVFRRLDEYSASLVIEHISSDHSGNYTCIASNVAGTERFTVPLTVNVPPKWILEPKDSSAQAGADVLLHCQSSGYPTPT---ITWKKAIGPTPGEYKDFLYEPTVQLFPNGTIFFKKISKESQGHFLCEAKNNIGSG-VSKVIFLKVNVPAHFQTKTKQISVAKGKQVHVQCNVQGDNPIDFKWKIQA--------TQQYLDESLDSRYTIRDQVLDDGMVSELGISHTYRQDTGIYICQASNAFGQDEMSIQLIVQEVPEQPKNLRINSQQSRSLQLT----WSQPFA-GNSPIEEYHIYYKQISDIWQNAEHLTIAGAQTVINIQQLRPAKAYHIRMSAENKLGASEFSEVVQVTTLEEVPSGPPLAVRAEPKSSTEIFVTWDAPERDHWNGILLGYYVGYQMSLTPEDKEVNPTQGFSF--------KTVEVRSHFGGETVL-----------ANLNKFTQYHVIVQAYTSQGSGPPSKEIAVQTMEDVPSSPPESPQCDVLGSTSIYITWSPPDIDGQNGKIKGYKVFYISVDELYETDPEVVKSTNQYVTIENLRKYTNYTVWVLAYTKVGDGMKTKPFYCRTHEDVPSAPQAIKAIPASSSKIIISWLPPDLPNGDITGYTFYMSMLEGGREEGTHKRLLGPFVEMHETVRTQESATYQFWLTASTKMGEGEKTQVVTVPPNNKVPARIVSFSQRIVTPWKEHLELPCRKVGAPAPVTIWRQDGHNMETSARKTIAKNGTLYMKECQASDAGNYTCSVENTWGKDEIVYNIVVK---VPPEAPNLTVINAYTDSLLLEWMDNSHGGSPILGYVIN-----YKRDNG-DWEELQVDSKTTSHLLTNLWCGTRYQLYITAYNKIGTGLPCDIVNSYTKGNPPVQPKHSQMITNNSTSVTCW-LDSWGDG-GCGILYFMIE--------SRVYGRSSWAVVS----NHIPPTERIYTVSDLVPGTKYQLKVTAHNNAGSTTA 1584          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Fly
Match: Dscam4 (gene:FBgn0263219 transcript:FBtr0299840)

HSP 1 Score: 270.396 bits (690), Expect = 2.554e-72
Identity = 384/1640 (23.41%), Postives = 655/1640 (39.94%), Query Frame = 3
Query:  420 CKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKAD-FSDMEVRCIMRNIYTDIDVKSHDWISPKRLEDNSKIDFTSICQNIEVR-----VIKGSTLELPWCSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAP-LLIWQSPP-VQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEE-KWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLNNLKISK-TFSVTIANPPIMLSDLPVSISLN--KNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQISIDNLVFKESPPLDYSIVLGQSFALNC--SAKPTNIQLKTNWFXXXXXXXXXXXXXXXXRIHQL-PNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKEDGNWDSLPVKRIKEKSKVSRFFVKFESVTDSLFGE-------------YKCVASNEHRKNGVE-RIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWKLVTENW----------FINATTKETSITIEDLRPFKEYDIAIVAENSVGYGEEATII-IKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQV---CSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSP-AKYVAIRTLEDKPEGTPIQVLCSP-KANFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNVKETHLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIKAYFYQNC-LKVSWTPPIKANGHIREYIIVFSFEPNNMITVSSRENDKPYYSW-ELCSEQICSNCNVSVLAVTTMKGPRKTVNVL---SNKM--GILSFXXXXXXXXXXXXXLYC-EVAFPDE-NIYYLWTHNDKDIYGQGVQSNGSLVINSMAESDQGIYKCKVKS----EEITYNVSTKSISLVPQTPYIEITKVSTNHIALLWRSN---GSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSNPA-ISQAQTRGSIPEIPDTSNIVTEIGPHSMCFNLRAFRPGRGCPANKYILKLWPSSEGNHQESGVSVWKVVNDSDLNQIP----CFNVTDLHPNTDYVYSIEASNMVGSQKA 5141
            CK +N +GTV S+ + V+  ++ K   V+   + V     AV+ C + P+ ++    V  W    +     +       G+++V++  +   L+I N    D +     R + R +  ++ + ++    P R+             N+E       V+ G T  LP C    +    + W    + +   + LS  +  ++S   G L I    + + G Y            +  ++ V   ++  ++P V     ++  Q +C+ +G+P   + WL +G         E  T+  R   I  +V  +  G+YQC   +          + Q +  + + + +P LL W S   +QP            G +  ++C     P     W LD   IP         + R       T+  D+ + ++I   K + GGEY     N  GK   +  + +  +  IR+ P IT   GS+L +KC V       I W RD +     LP    Q    +G L IIE++ ++  +G Y C +     + S+    + +  PP ++   P+    N  +     +++C                                        +I    + VS ++  NG  L        R      A + I++    H    +C+  N AGT R T+ ++++        P D S   G    L+C  S  PT       W              +     QL PNGT+  K I       F+C  K  +G   +SKV+ + + VPA        I + +  +  + C V GD+ +D KW  +          ++  ++S  SR+ ++ + + D +  E             Y C ASN   ++ +  ++I+  V + P  + I ++  RS   +    W+ P + G  PI  Y + +K +++ +           +     +T I I+ LRP K Y I + AEN +G  E + ++ + T  + P GP L + A   S  ++ + W++P     NGI   Y V    S+   D +    + F++        + V+  +H   ++ +             L  FT+Y   V    + G  P +K +A++T+ED P   P    C    +  +++ W+PP  +  NG I GY+V Y S D+  E D  +      ++ + NL   + Y + +     +G G  ++P  C T+E  P  P  IKA    +  + +SW PP   NG I  Y    S         + +    P+    E    Q  +     + A T M    KT  V    +NK+   I+SFSQ IV      + L C +V  P    I+    HN +    + +  NG+L +     SD G Y C V++    +EI YN+  K   + P+ P + +    T+ + L W  N   GSP   Y IN      +  NG    EL+V S   S ++ NL CGT Y +Y+ A N  G   P  I  + T+G+ P  P  S ++T       C+ L ++  G GC    ++++         +  G S W VV+    N IP     + V+DL P T Y   + A N  GS  A
Sbjct:  105 CKLRNLVGTVLSREVHVRGVVNQK-YAVQVHDEYVMTGNTAVLKCQV-PSYMSEFVLVTAW---VQDTGMHLYPNTDIGGKYTVLSNGE---LYINNAGPNDAYKSYTCRTVNR-LTGEVQISTY----PGRIIVTEPKGMVQPRINVEKHSMRHVVLNGQTT-LP-CIAQGHPVPTYRWFKEENEQLLPLQLS-ERITIVSA--GLLKITKARLEDSGKYLCWVNNTAGEETIQVSLTVTAPLTAHLQPQVQTVDVDKDAQFQCIVSGHPVHDVNWLHDGKPILRDNRVEILTDPPRL--IIKKVQKEDPGMYQCFVSNE-------WEQIQSTAELQLGDASPELLYWFSEQTLQP------------GPTVSLKCVATGNPLPQFTWSLDGFPIP--------DSSRFLVGQYVTIHDDVISHVNISNVKEEDGGEYTCTAQNAIGKVSHSAKVNIYGLPYIREMPKITGISGSDLIVKCPVAGYPIDKIHWERDGQ----TLPINRRQRAYNNGTL-IIEQLQRLEDAGTYTCMAQNKQKQTSRRNVEIQVLVPPKIM---PIQAMTNMLREGMRAAISC----------------------------------------QILEGDLPVSFRWERNGKPLIGTGNEVFRRLDEYSASLVIEHISSDHSGNYTCIASNVAGTERFTVPLTVNVPPKWILEPKDSSAQAGADVLLHCQSSGYPTPT---ITWKKAIGPTPGEYKDFLYEPTVQLFPNGTIFFKKISKESQGHFLCEAKNNIGSG-VSKVIFLKVNVPAHFQTKTKQISVAKGKQVHVQCNVQGDNPIDFKWKIQA--------TQQYLDESLDSRYTIRDQVLDDGMVSELGISHTYRQDTGIYICQASNAFGQDEMSIQLIVQEVPEQPKNLRINSQQSRSLQLT----WSQPFA-GNSPIEEYHIYYKQISDFFSPSDIWQNAEHLTIAGAQTVINIQQLRPAKAYHIRMSAENKLGASEFSEVVQVTTLEEVPSGPPLAVRAEPKSSTEIFVTWDAPERDHWNGILLGYYVGYQMSLTPEDKEVNPTQGFSF--------KTVEVRSHFGGETVL-----------ANLNKFTQYHVIVQAYTSQGSGPPSKEIAVQTMEDVPSSPPESPQCDVLGSTSIYITWSPPDIDGQNGKIKGYKVFYISVDELYETDPEVVKSTNQYVTIENLRKYTNYTVWVLAYTKVGDGMKTKPFYCRTHEDVPSAPQAIKAIPASSSKIIISWLPPDLPNGDITGYTFYMSMLEGGREEGTHKRLLGPFVEMHETVRTQESATYQFWLTASTKMGEGEKTQVVTVPPNNKVPARIVSFSQRIVTPWKEHLELPCRKVGAPAPVTIWRQDGHNMETSARKTIAKNGTLYMKECQASDAGNYTCSVENTWGKDEIVYNIVVK---VPPEAPNLTVINAYTDSLLLEWMDNSHGGSPILGYVIN-----YKRDNG-DWEELQVDSKTTSHLLTNLWCGTRYQLYITAYNKIGTGLPCDIVNSYTKGNPPVQPKHSQMITNNSTSVTCW-LDSWGDG-GCGILYFMIE--------SRVYGRSSWAVVS----NHIPPTERIYTVSDLVPGTKYQLKVTAHNNAGSTTA 1590          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Fly
Match: Dscam4 (gene:FBgn0263219 transcript:FBtr0299839)

HSP 1 Score: 270.396 bits (690), Expect = 2.554e-72
Identity = 384/1640 (23.41%), Postives = 655/1640 (39.94%), Query Frame = 3
Query:  420 CKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKAD-FSDMEVRCIMRNIYTDIDVKSHDWISPKRLEDNSKIDFTSICQNIEVR-----VIKGSTLELPWCSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAP-LLIWQSPP-VQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEE-KWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLNNLKISK-TFSVTIANPPIMLSDLPVSISLN--KNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQISIDNLVFKESPPLDYSIVLGQSFALNC--SAKPTNIQLKTNWFXXXXXXXXXXXXXXXXRIHQL-PNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKEDGNWDSLPVKRIKEKSKVSRFFVKFESVTDSLFGE-------------YKCVASNEHRKNGVE-RIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWKLVTENW----------FINATTKETSITIEDLRPFKEYDIAIVAENSVGYGEEATII-IKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQV---CSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSP-AKYVAIRTLEDKPEGTPIQVLCSP-KANFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNVKETHLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIKAYFYQNC-LKVSWTPPIKANGHIREYIIVFSFEPNNMITVSSRENDKPYYSW-ELCSEQICSNCNVSVLAVTTMKGPRKTVNVL---SNKM--GILSFXXXXXXXXXXXXXLYC-EVAFPDE-NIYYLWTHNDKDIYGQGVQSNGSLVINSMAESDQGIYKCKVKS----EEITYNVSTKSISLVPQTPYIEITKVSTNHIALLWRSN---GSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSNPA-ISQAQTRGSIPEIPDTSNIVTEIGPHSMCFNLRAFRPGRGCPANKYILKLWPSSEGNHQESGVSVWKVVNDSDLNQIP----CFNVTDLHPNTDYVYSIEASNMVGSQKA 5141
            CK +N +GTV S+ + V+  ++ K   V+   + V     AV+ C + P+ ++    V  W    +     +       G+++V++  +   L+I N    D +     R + R +  ++ + ++    P R+             N+E       V+ G T  LP C    +    + W    + +   + LS  +  ++S   G L I    + + G Y            +  ++ V   ++  ++P V     ++  Q +C+ +G+P   + WL +G         E  T+  R   I  +V  +  G+YQC   +          + Q +  + + + +P LL W S   +QP            G +  ++C     P     W LD   IP         + R       T+  D+ + ++I   K + GGEY     N  GK   +  + +  +  IR+ P IT   GS+L +KC V       I W RD +     LP    Q    +G L IIE++ ++  +G Y C +     + S+    + +  PP ++   P+    N  +     +++C                                        +I    + VS ++  NG  L        R      A + I++    H    +C+  N AGT R T+ ++++        P D S   G    L+C  S  PT       W              +     QL PNGT+  K I       F+C  K  +G   +SKV+ + + VPA        I + +  +  + C V GD+ +D KW  +          ++  ++S  SR+ ++ + + D +  E             Y C ASN   ++ +  ++I+  V + P  + I ++  RS   +    W+ P + G  PI  Y + +K +++ +           +     +T I I+ LRP K Y I + AEN +G  E + ++ + T  + P GP L + A   S  ++ + W++P     NGI   Y V    S+   D +    + F++        + V+  +H   ++ +             L  FT+Y   V    + G  P +K +A++T+ED P   P    C    +  +++ W+PP  +  NG I GY+V Y S D+  E D  +      ++ + NL   + Y + +     +G G  ++P  C T+E  P  P  IKA    +  + +SW PP   NG I  Y    S         + +    P+    E    Q  +     + A T M    KT  V    +NK+   I+SFSQ IV      + L C +V  P    I+    HN +    + +  NG+L +     SD G Y C V++    +EI YN+  K   + P+ P + +    T+ + L W  N   GSP   Y IN      +  NG    EL+V S   S ++ NL CGT Y +Y+ A N  G   P  I  + T+G+ P  P  S ++T       C+ L ++  G GC    ++++         +  G S W VV+    N IP     + V+DL P T Y   + A N  GS  A
Sbjct:  105 CKLRNLVGTVLSREVHVRGVVNQK-YAVQVHDEYVMTGNTAVLKCQV-PSYMSEFVLVTAW---VQDTGMHLYPNTDIGGKYTVLSNGE---LYINNAGPNDAYKSYTCRTVNR-LTGEVQISTY----PGRIIVTEPKGMVQPRINVEKHSMRHVVLNGQTT-LP-CIAQGHPVPTYRWFKEENEQLLPLQLS-ERITIVSA--GLLKITKARLEDSGKYLCWVNNTAGEETIQVSLTVTAPLTAHLQPQVQTVDVDKDAQFQCIVSGHPVHDVNWLHDGKPILRDNRVEILTDPPRL--IIKKVQKEDPGMYQCFVSNE-------WEQIQSTAELQLGDASPELLYWFSEQTLQP------------GPTVSLKCVATGNPLPQFTWSLDGFPIP--------DSSRFLVGQYVTIHDDVISHVNISNVKEEDGGEYTCTAQNAIGKVSHSAKVNIYGLPYIREMPKITGISGSDLIVKCPVAGYPIDKIHWERDGQ----TLPINRRQRAYNNGTL-IIEQLQRLEDAGTYTCMAQNKQKQTSRRNVEIQVLVPPKIM---PIQAMTNMLREGMRAAISC----------------------------------------QILEGDLPVSFRWERNGKPLIGTGNEVFRRLDEYSASLVIEHISSDHSGNYTCIASNVAGTERFTVPLTVNVPPKWILEPKDSSAQAGADVLLHCQSSGYPTPT---ITWKKAIGPTPGEYKDFLYEPTVQLFPNGTIFFKKISKESQGHFLCEAKNNIGSG-VSKVIFLKVNVPAHFQTKTKQISVAKGKQVHVQCNVQGDNPIDFKWKIQA--------TQQYLDESLDSRYTIRDQVLDDGMVSELGISHTYRQDTGIYICQASNAFGQDEMSIQLIVQEVPEQPKNLRINSQQSRSLQLT----WSQPFA-GNSPIEEYHIYYKQISDFFSPSDIWQNAEHLTIAGAQTVINIQQLRPAKAYHIRMSAENKLGASEFSEVVQVTTLEEVPSGPPLAVRAEPKSSTEIFVTWDAPERDHWNGILLGYYVGYQMSLTPEDKEVNPTQGFSF--------KTVEVRSHFGGETVL-----------ANLNKFTQYHVIVQAYTSQGSGPPSKEIAVQTMEDVPSSPPESPQCDVLGSTSIYITWSPPDIDGQNGKIKGYKVFYISVDELYETDPEVVKSTNQYVTIENLRKYTNYTVWVLAYTKVGDGMKTKPFYCRTHEDVPSAPQAIKAIPASSSKIIISWLPPDLPNGDITGYTFYMSMLEGGREEGTHKRLLGPFVEMHETVRTQESATYQFWLTASTKMGEGEKTQVVTVPPNNKVPARIVSFSQRIVTPWKEHLELPCRKVGAPAPVTIWRQDGHNMETSARKTIAKNGTLYMKECQASDAGNYTCSVENTWGKDEIVYNIVVK---VPPEAPNLTVINAYTDSLLLEWMDNSHGGSPILGYVIN-----YKRDNG-DWEELQVDSKTTSHLLTNLWCGTRYQLYITAYNKIGTGLPCDIVNSYTKGNPPVQPKHSQMITNNSTSVTCW-LDSWGDG-GCGILYFMIE--------SRVYGRSSWAVVS----NHIPPTERIYTVSDLVPGTKYQLKVTAHNNAGSTTA 1590          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Fly
Match: Dscam4 (gene:FBgn0263219 transcript:FBtr0299841)

HSP 1 Score: 269.24 bits (687), Expect = 5.910e-72
Identity = 384/1640 (23.41%), Postives = 655/1640 (39.94%), Query Frame = 3
Query:  420 CKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKAD-FSDMEVRCIMRNIYTDIDVKSHDWISPKRLEDNSKIDFTSICQNIEVR-----VIKGSTLELPWCSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAP-LLIWQSPP-VQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEE-KWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLNNLKISK-TFSVTIANPPIMLSDLPVSISLN--KNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQISIDNLVFKESPPLDYSIVLGQSFALNC--SAKPTNIQLKTNWFXXXXXXXXXXXXXXXXRIHQL-PNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKEDGNWDSLPVKRIKEKSKVSRFFVKFESVTDSLFGE-------------YKCVASNEHRKNGVE-RIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWKLVTENW----------FINATTKETSITIEDLRPFKEYDIAIVAENSVGYGEEATII-IKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQV---CSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSP-AKYVAIRTLEDKPEGTPIQVLCSP-KANFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNVKETHLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIKAYFYQNC-LKVSWTPPIKANGHIREYIIVFSFEPNNMITVSSRENDKPYYSW-ELCSEQICSNCNVSVLAVTTMKGPRKTVNVL---SNKM--GILSFXXXXXXXXXXXXXLYC-EVAFPDE-NIYYLWTHNDKDIYGQGVQSNGSLVINSMAESDQGIYKCKVKS----EEITYNVSTKSISLVPQTPYIEITKVSTNHIALLWRSN---GSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSNPA-ISQAQTRGSIPEIPDTSNIVTEIGPHSMCFNLRAFRPGRGCPANKYILKLWPSSEGNHQESGVSVWKVVNDSDLNQIP----CFNVTDLHPNTDYVYSIEASNMVGSQKA 5141
            CK +N +GTV S+ + V+  ++ K   V+   + V     AV+ C + P+ ++    V  W    +     +       G+++V++  +   L+I N    D +     R + R +  ++ + ++    P R+             N+E       V+ G T  LP C    +    + W    + +   + LS  +  ++S   G L I    + + G Y            +  ++ V   ++  ++P V     ++  Q +C+ +G+P   + WL +G         E  T+  R   I  +V  +  G+YQC   +          + Q +  + + + +P LL W S   +QP            G +  ++C     P     W LD   IP         + R       T+  D+ + ++I   K + GGEY     N  GK   +  + +  +  IR+ P IT   GS+L +KC V       I W RD +     LP    Q    +G L IIE++ ++  +G Y C +     + S+    + +  PP ++   P+    N  +     +++C                                        +I    + VS ++  NG  L        R      A + I++    H    +C+  N AGT R T+ ++++        P D S   G    L+C  S  PT       W              +     QL PNGT+  K I       F+C  K  +G   +SKV+ + + VPA        I + +  +  + C V GD+ +D KW  +          ++  ++S  SR+ ++ + + D +  E             Y C ASN   ++ +  ++I+  V + P  + I ++  RS   +    W+ P + G  PI  Y + +K +++ +           +     +T I I+ LRP K Y I + AEN +G  E + ++ + T  + P GP L + A   S  ++ + W++P     NGI   Y V    S+   D +    + F++        + V+  +H   ++ +             L  FT+Y   V    + G  P +K +A++T+ED P   P    C    +  +++ W+PP  +  NG I GY+V Y S D+  E D  +      ++ + NL   + Y + +     +G G  ++P  C T+E  P  P  IKA    +  + +SW PP   NG I  Y    S         + +    P+    E    Q  +     + A T M    KT  V    +NK+   I+SFSQ IV      + L C +V  P    I+    HN +    + +  NG+L +     SD G Y C V++    +EI YN+  K   + P+ P + +    T+ + L W  N   GSP   Y IN      +  NG    EL+V S   S ++ NL CGT Y +Y+ A N  G   P  I  + T+G+ P  P  S ++T       C+ L ++  G GC    ++++         +  G S W VV+    N IP     + V+DL P T Y   + A N  GS  A
Sbjct:  105 CKLRNLVGTVLSREVHVRGVVNQK-YAVQVHDEYVMTGNTAVLKCQV-PSYMSEFVLVTAW---VQDTGMHLYPNTDIGGKYTVLSNGE---LYINNAGPNDAYKSYTCRTVNR-LTGEVQISTY----PGRIIVTEPKGMVQPRINVEKHSMRHVVLNGQTT-LP-CIAQGHPVPTYRWFKEENEQLLPLQLS-ERITIVSA--GLLKITKARLEDSGKYLCWVNNTAGEETIQVSLTVTAPLTAHLQPQVQTVDVDKDAQFQCIVSGHPVHDVNWLHDGKPILRDNRVEILTDPPRL--IIKKVQKEDPGMYQCFVSNE-------WEQIQSTAELQLGDASPELLYWFSEQTLQP------------GPTVSLKCVATGNPLPQFTWSLDGFPIP--------DSSRFLVGQYVTIHDDVISHVNISNVKEEDGGEYTCTAQNAIGKVSHSAKVNIYGLPYIREMPKITGISGSDLIVKCPVAGYPIDKIHWERDGQ----TLPINRRQRAYNNGTL-IIEQLQRLEDAGTYTCMAQNKQKQTSRRNVEIQVLVPPKIM---PIQAMTNMLREGMRAAISC----------------------------------------QILEGDLPVSFRWERNGKPLIGTGNEVFRRLDEYSASLVIEHISSDHSGNYTCIASNVAGTERFTVPLTVNVPPKWILEPKDSSAQAGADVLLHCQSSGYPTPT---ITWKKAIGPTPGEYKDFLYEPTVQLFPNGTIFFKKISKESQGHFLCEAKNNIGSG-VSKVIFLKVNVPAHFQTKTKQISVAKGKQVHVQCNVQGDNPIDFKWKIQA--------TQQYLDESLDSRYTIRDQVLDDGMVSELGISHTYRQDTGIYICQASNAFGQDEMSIQLIVQEVPEQPKNLRINSQQSRSLQLT----WSQPFA-GNSPIEEYHIYYKQISDFFSPSDIWQNAEHLTIAGAQTVINIQQLRPAKAYHIRMSAENKLGASEFSEVVQVTTLEEVPSGPPLAVRAEPKSSTEIFVTWDAPERDHWNGILLGYYVGYQMSLTPEDKEVNPTQGFSF--------KTVEVRSHFGGETVL-----------ANLNKFTQYHVIVQAYTSQGSGPPSKEIAVQTMEDVPSSPPESPQCDVLGSTSIYITWSPPDIDGQNGKIKGYKVFYISVDELYETDPEVVKSTNQYVTIENLRKYTNYTVWVLAYTKVGDGMKTKPFYCRTHEDVPSAPQAIKAIPASSSKIIISWLPPDLPNGDITGYTFYMSMLEGGREEGTHKRLLGPFVEMHETVRTQESATYQFWLTASTKMGEGEKTQVVTVPPNNKVPARIVSFSQRIVTPWKEHLELPCRKVGAPAPVTIWRQDGHNMETSARKTIAKNGTLYMKECQASDAGNYTCSVENTWGKDEIVYNIVVK---VPPEAPNLTVINAYTDSLLLEWMDNSHGGSPILGYVIN-----YKRDNG-DWEELQVDSKTTSHLLTNLWCGTRYQLYITAYNKIGTGLPCDIVNSYTKGNPPVQPKHSQMITNNSTSVTCW-LDSWGDG-GCGILYFMIE--------SRVYGRSSWAVVS----NHIPPTERIYTVSDLVPGTKYQLKVTAHNNAGSTTA 1590          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Zebrafish
Match: dscamb (Down syndrome cell adhesion molecule b [Source:ZFIN;Acc:ZDB-GENE-031118-67])

HSP 1 Score: 271.552 bits (693), Expect = 1.729e-72
Identity = 397/1673 (23.73%), Postives = 677/1673 (40.47%), Query Frame = 3
Query:  294 IKWYYETTQRNVFTEVND-PDRFVVGTNGDMDI--FIQA------NIEVIYCKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRNIYTDIDVKSHDWISPKRLEDNSKIDFTSICQNIEVR--VIKGSTLELPWCSMPNNQKIAWYW----SSAVSSRRHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLNNLK-ISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQISIDNLVFKESPPLDYSIVLGQSFALNCSAK--PTNIQLKTNWFXXXXXXXXXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKE-----DGNWDSLPVKRIKEKSKVSRFFVKFESVTDSLFGEYKCVASNEHRKN-GVERIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWKLVTENWFINATTKETS-----ITIEDLRPFKEYDIAIVAENSVGYGEEAT-IIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVT--ELLTFTEYAFRVILVNNVGFSP-AKYVAIRTLEDKPEGTPIQVLCSPKA-NFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNVKETH--LKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIKAYF-YQNCLKVSWTPPIKANGHIREYIIVFSFEPNNMITVSSRENDKPYYSWELCSEQICSNCNVSVLAVTTMKGPRKTVNVLSNK------MGILSFXXXXXXXXXXXXXLYCE-VAFPDENIYYLWTHNDK----DIYG-QGVQSNGSLVINSMAESDQGIYKCKVK----SEEITYNVSTKSISLVPQTPYIEITKVSTNHIALLW--RSNGSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSN-PAISQAQTRGSIPEIPDTSNIVTEIGPHSMCFNLRAFRPGRGCPANKYILKLWPSSEGNHQESGVSVWKVVNDSDLNQIPCFNVTDLHPNTDYVYSIEASNMVGSQKAK 5144
            ++WY  T +     E+ D P    V  NG + I  F+ +      N    YC A+N  G +RS+ + + K +  +   VR   + V     AV  C++  ++  Y+  V  WE       K  + +  +  R+ + +      L+I +V   D  ++  RC  R+ YT    +S+      RL  +  +D   +  +   R  V+ G  +ELP C    +    + W    S   S  R+  ++SG            LLI+    ++ G Y         N  +   + V   +   + P  V       V L C  TG     + W  N  +     +    T  +  + +   +     G YQC A       N  +S  Q  V V++ +  P ++          ++   V+  +     + C     P  TV W LDD  +      I ++ +R+   +I T    LS +     +   GG YR    N  G       I V     IR   ++T   G +  + C +I     +I+W++D+      LP  H Q   E+     +  V      G+Y C   ++  K I ++  VT+  PP++      S S+ +      + C+     DLP    W       N S+ +     ++  D    ++   ++                                    ++H    +C+ +N A  +  +IQ+ +      E  P D   + G+S  LNCSAK  P    +  +          P+     SR+  L NG+L++K++   D   ++C +   VG D ISK + + +K+PA I + P+    ++ +   ++CT HG+  + V+W ++      D +   + VK + ++  +S   +      DS F  + C+A N + ++ G+ ++I+ +  D P     + E      R+IA+ W     DG  PIT Y +++K  + +W  +  TK+ S      TI +L P   Y+I + A+N +G    +  + I T    P+G   ++   ++S   +K+ W+ P++ L NG+ + YQVC  E                     T    Q+N       INV  +  + T+T   L  +T+Y  RV   N  G  P ++ + I TLED P   P  V+ +      + L W+  P+   NG++ GY V ++++    E  ++ +N+  T   L+L  L   + Y IQ+      G G  SE I   T E  P PP  +KA     + + VSW PP K NG IR+Y IVF   P   + +S  E     Y   L +       ++ V+AVT   G   T  +++ +        IL+FS ++       +VL C+ V  P   I +L  +N       I G +   +NGS VI ++   D G Y+C       S+EI  N+    + + P  P + +TK +T  I L W    NG       I  +++     N        +S + RS  + NL+CGT Y   L A+N  GP     I +A+T G  P+      + + I    +  NL  +  G GCP + + L+  P           + W +V    L +     + DL   T Y   +   N  G+ + +
Sbjct:   56 LRWYLATGE-----EIYDVPGIRHVHPNGTLQIYGFLPSSFSNLINDNTYYCTAENPSGKIRSQDLHI-KAVFREPYTVRVADQRVMRGNTAVFKCIIPASVEEYVSVVS-WE-------KDTVSLV-SGSRYLITSTGA---LYILDVQSEDAVNI-YRCTTRHRYTGETRQSNS----ARLLLSEPVDSAPVILDGFERKEVMVGHRVELP-CKASGHPPPRYRWLRDNSPLESDSRYHQSVSG------------LLIEATRPSDAGSYVCEVWNSFGNAKVVGRLVVKQPLKAVVSPRKVRGSVGSQVSLFCSVTGSDEFDITWYRNAEKIYQGINVRI-TGINNENLVMEGMAKSDGGAYQCFAR------NGKMST-QDLVQVVLEDGTPKIL---------SAFSEKVVSPN-EPISLVCHVKGTPLPTVTWTLDDDPV------IKDSNHRMDR-IITTEGHVLSYLNVSHTQVSDGGVYRCTCNNSAGSVSYQARINVRGPASIRPMKNVTAIAGRDTYIHCRIIGYPYYSIKWYKDSN----LLPFNHRQRAFENNGTLKLSNVQNS-DEGEYTCYVLVDPEKQIHRSVHVTVKVPPLIQHSDSQSASIGQR---VFIPCV-VISGDLPMSITWHKDGRPINASLGVT----IDNIDFTSSLRISNLS------------------------------------EIHNGSYTCIARNEAAAVEHSIQLIVKVPPHFEVQPKDQDGIYGKSVTLNCSAKGNPIPTIVWNHSKGAGVPQFQPIALNSGSRVQLLENGSLLIKHVLEEDAGFYLCKVSNDVGAD-ISKSMYLTVKIPAMITSYPNTTRAEQGHMTEMSCTAHGEKPIKVRWEKESHIINPDMSRYVVTVKEVGDEV-ISTLQILHTVREDSGF--FSCIAINSYGEDKGIIQLIVQDRPDPP-----EVEIREVKDRTIALRWT-MGFDGNSPITGYDINYKNKSASWASSQMTKDVSPQLNQATIIELHPASTYNIRMFAKNQIGESRPSNELTITTDEAPPDGAPQDVQLEAISSQGIKVTWKPPHKHLQNGLIRSYQVCYREF-------------------GTGGSPQYN------TINVDTTGDIETLTLDNLKKYTQYEVRVQAANRAGMGPTSEEITITTLEDVPSRPPENVVTTATTPETISLSWSALPKEALNGMLLGYRVIFWANLPDGELGEI-RNITTTKPSLELERLEKYTNYSIQVLAFTRAGDGVRSEQIYTRTKEDVPGPPAGVKAAASTSSVVFVSWLPPHKLNGIIRKY-IVFCSNPYPTV-ISEFEAAPDVYFRRLTNLNQNWQYSIWVVAVTA-AGRGNTSEIITVEPQAKAPARILTFSGTVTTPWMRDIVLPCKAVGDPPPTIKWLKGNNGTPAPVSIDGRRSAHNNGSFVIRTVKAEDSGYYRCVASNNWGSDEIMLNL---QVQVPPDQPRLTVTKTTTTSITLFWIPGDNGGSS----IRGYILQYSEDNSEEWGSYSISPSERSYRLENLKCGTWYKFTLTAQNAVGPGRISEIIEAKTHGKEPQFAKDHELFSSINSTRVELNLIGWNNG-GCPIDSFTLEYRPVD--------TTKWTMVKRDSLTK--SHILYDLQEATWYELQMRVGNSAGTAEKR 1561          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Zebrafish
Match: dscama (Down syndrome cell adhesion molecule a [Source:ZFIN;Acc:ZDB-GENE-050310-7])

HSP 1 Score: 264.618 bits (675), Expect = 2.359e-70
Identity = 399/1687 (23.65%), Postives = 678/1687 (40.19%), Query Frame = 3
Query:  294 IKWYYETTQRNVFTEVNDPDRFVVGTNGDMDIF----------IQANIEVIYCKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRNIYTDIDVKSHDWISPKRLEDNSKIDFTSICQNIEVR-VIKGSTLELPWCSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEE-KWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLN-NLKISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQISIDNLVFKESPPLDYSIVLGQSFALNCSA----KPTNIQLKTNWFXXXXXXXXXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKEDGNWDSLPVKRIKEKSKVS----RFFVKFESVTDSLF-------------GEYKCVASNEHRKNGVERIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWKLVTENWFINATTKETS-----ITIEDLRPFKEYDIAIVAENSVGYGEEATIIIKTQADA-PEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPES--TLVITVTELLTFTEYAFRVILVNNVGFSPAKY-VAIRTLEDKPEGTPIQVLCSPKA-NFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNVKE--TH---LKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIKAYFY-QNCLKVSWTPPIKANGHIREYIIV-----------FSFEPNNMI-TVSSRENDKPYYSWELCSEQICSNCNVSVLAVTTM-KGPRKTVNVLSNKMGILSFXXXXXXXXXXXXXLYCE-VAFPDENIYYLWTHNDKD---IYG-QGVQSNGSLVINSMAESDQGIYKCKVK----SEEITYNVSTKSISLVPQTPYIEITKVSTNHIALLWR--SNGSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSN-PAISQAQTRGSIPEIPDTSNIVTEIGPHSMCFNLRAFRPGRGCPANKYILKLWPSSEGNHQESGVSVWKVVNDSDLNQIPCFNVTDLHPNTDYVYSIEASNMVG 5129
            ++WY  T + +     N P    V  NG + IF          I  N    YC A+N  G +RS+ + + K +  +   VR   +       AV  C++  ++  YI  V  WE     D+  ++    +  RF + +      L+I +V K D      RC+ R+ YT    +S+   S +    +      +I    E R V+    +ELP C    +    + W   + + R L   S S+F+   +    LLI+    ++ G Y         N  +   + V   +   + P  V       V L C  TG     L W  NG++ N+  +   +   ++ + +   +     GVYQC +     +        Q  V VI+ +  P ++          ++   V+  +     + C     P   + W LDD+      V+  ++ +R+ +++ A  + ++ + ++I   + +  G YR    N  G       I V     IR   ++T   G ++ + C+VI     +I+WF+++      LP    Q   E+     +  V K +  G+Y C+  +   L  +++  VT+  PP +                         QP       +EF      H V       +   DL I I ++K   S       A+L   + N       +I+ +     +++H    +C+ QN A  ++   Q+ +      +  P D   + G+S  LNCSA    +PT I+ K +          P+      R+  L NG+L++K++   D   ++C +   VG D +SK + + +K+PA I + P+     +  +  ++C  HG+  + V+W ++         V++ K+   ++    R  V  ++V D +              G + C A N +   G +R IL   V  P +   K E      R+IA+ W     DG   IT Y +  K  TE W     T++ S      TI +L P   Y+I + A+N +G  E +  +  T  +A PEGP  ++   +++   +K+ W++P + L NG+ + YQVC  E   S N S  +F                       CI+V  +  T  +++  L  F EY   V   N+ G  PA   V   T+ED P   P +V+ +  +   + L W  P +   NGV+ G+ + Y+++     PD  +  ++   TH   L+L  L   + Y IQ+      G G  S+ I   T E  P PP  +KA     + + VSW PP+K NG IR+Y +            F   P+  +  V +   ++ Y  W +         +  V+ V  + K P K          IL+FS ++       VVL C  V  P   I +L          I G + +  NGS +I ++   D G Y C       ++EI  N+    + + P  P + +TK +T  I + W    NG       I  +++     N      + +S + RS  + NL CGT Y   L A+N  GP     I +A+T G  P+      + T I   S+  NL  +  G GCP   + L+  P            VW     + L++   +N+ DL   T Y   ++  N  G
Sbjct:   68 LRWYLATGEESY----NVPGIRHVHPNGTLQIFHFPPSSFSKVIHDN--TYYCTAENPSGKIRSQDVHI-KAVLREPYTVRVADQTAMRGSVAVFKCIIPSSVENYITVVS-WE----RDTVPLV----SGARFLITSTGA---LYILDVQKED-ELFNYRCMTRHRYTSETRQSN---SARLFVPDPSNSAPAILDGFEKREVMASHRVELP-CKASGHPAPKYRW---LKNNRPLE--SDSRFR---QSVTGLLIERAQPSDTGSYVCEVWNSYGNAEVIGRLTVKEPLKAVVSPRKVKGSVGSQVSLSCSVTGSDEFELSWYRNGDKINTGANIRMN-GINKENLVMDGMAKSDGGVYQCFSRKAKMSA-------QDFVQVILEDGTPKIL---------SAFSEKVVGPN-DFVSLTCHVKGTPQPAITWTLDDE------VVAKDSRHRIVHSITA--EGNVVSYLNISHIQVRDSGVYRCTCNNSAGTVSYQARINVRGSADIRPMKNLTAIAGWDMYIHCHVIGYPYYSIKWFKNSN----LLPFNDRQRAFENNGTLKLLNVQKELDEGEYSCHVQVQPQLFKNQSVHVTVKVPPFI-------------------------QP-------FEFPRYSIGHRV--FVPCVVRSGDLPISITWEKDGKSIN-----ASLGVTIDNIDFTSSLRISNL-----QRVHNGTYTCIAQNDAAVVKYQSQLIVRVPPRFKVQPQDQDGIYGKSVILNCSADGEPRPT-IEWKYS-KGAGVPQFQPIALNSGFRVQLLGNGSLLIKHVLEEDAGYYLCKVSNDVGAD-VSKSMYLNVKIPAMITSYPNNSLATKGEKIEMSCKAHGEKPIMVRWEKE---------VEKEKQSHMINPDMWRHTVTVKNVGDEVVSTLQIYPTMREDSGFFSCHAINSY---GEDRGILQLTVQEPPEPP-KVEIREVKERTIALRWTM-GFDGNSLITGYDIECKNKTETWERARRTRDVSPTLNQATIIELHPSSTYNIRMFAKNHIGDSEPSNELTVTTDEADPEGPPQDVTLEAITSQSIKVTWKAPLKHLQNGVIRGYQVCHRE--HSTNGS-HQFV----------------------CISVEATGETESLSLNNLKKFAEYEVVVQASNSAGPGPASSEVRATTMEDVPSRAPEKVVATAASPESISLSWQTPAREALNGVLQGFRIIYWAN----LPDGELGEIRNVTTHKAPLELEGLEKYTNYSIQVLAFTRAGDGVRSDQIYIRTKEDVPGPPGGVKAAAASSSVVYVSWLPPLKLNGVIRKYTVFCSSTSPTVVSEFEVAPDEFLHRVHNLSRNRKYNIWVMAVTAAGRGNSSDVITVEPLAKAPAK----------ILTFSGTVTTPWMRDVVLPCRAVGDPPPAIKWLKESGSPAPAVIDGRRSIHGNGSFIIKTVKAEDSGYYTCVASNNYGTDEIILNL---QVQVPPDQPRLTVTKTTTTSITVTWTPGDNGGSS----IRGYILQYSEDNSEKWGSISISPSERSYRLENLNCGTWYKFTLTAQNAVGPGRISEIIEAKTHGKEPQFSKEQELFTSINGTSVKLNLIGWNDG-GCPITSFTLEYRPLES--------PVWTKAKRTSLSK--SYNLLDLQEATWYELQMKVYNSAG 1574          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Zebrafish
Match: dscama (Down syndrome cell adhesion molecule a [Source:ZFIN;Acc:ZDB-GENE-050310-7])

HSP 1 Score: 264.233 bits (674), Expect = 2.704e-70
Identity = 399/1687 (23.65%), Postives = 678/1687 (40.19%), Query Frame = 3
Query:  294 IKWYYETTQRNVFTEVNDPDRFVVGTNGDMDIF----------IQANIEVIYCKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRNIYTDIDVKSHDWISPKRLEDNSKIDFTSICQNIEVR-VIKGSTLELPWCSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEE-KWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLN-NLKISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQISIDNLVFKESPPLDYSIVLGQSFALNCSA----KPTNIQLKTNWFXXXXXXXXXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKEDGNWDSLPVKRIKEKSKVS----RFFVKFESVTDSLF-------------GEYKCVASNEHRKNGVERIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWKLVTENWFINATTKETS-----ITIEDLRPFKEYDIAIVAENSVGYGEEATIIIKTQADA-PEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPES--TLVITVTELLTFTEYAFRVILVNNVGFSPAKY-VAIRTLEDKPEGTPIQVLCSPKA-NFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNVKE--TH---LKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIKAYFY-QNCLKVSWTPPIKANGHIREYIIV-----------FSFEPNNMI-TVSSRENDKPYYSWELCSEQICSNCNVSVLAVTTM-KGPRKTVNVLSNKMGILSFXXXXXXXXXXXXXLYCE-VAFPDENIYYLWTHNDKD---IYG-QGVQSNGSLVINSMAESDQGIYKCKVK----SEEITYNVSTKSISLVPQTPYIEITKVSTNHIALLWR--SNGSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSN-PAISQAQTRGSIPEIPDTSNIVTEIGPHSMCFNLRAFRPGRGCPANKYILKLWPSSEGNHQESGVSVWKVVNDSDLNQIPCFNVTDLHPNTDYVYSIEASNMVG 5129
            ++WY  T + +     N P    V  NG + IF          I  N    YC A+N  G +RS+ + + K +  +   VR   +       AV  C++  ++  YI  V  WE     D+  ++    +  RF + +      L+I +V K D      RC+ R+ YT    +S+   S +    +      +I    E R V+    +ELP C    +    + W   + + R L   S S+F+   +    LLI+    ++ G Y         N  +   + V   +   + P  V       V L C  TG     L W  NG++ N+  +   +   ++ + +   +     GVYQC +     +        Q  V VI+ +  P ++          ++   V+  +     + C     P   + W LDD+      V+  ++ +R+ +++ A  + ++ + ++I   + +  G YR    N  G       I V     IR   ++T   G ++ + C+VI     +I+WF+++      LP    Q   E+     +  V K +  G+Y C+  +   L  +++  VT+  PP +                         QP       +EF      H V       +   DL I I ++K   S       A+L   + N       +I+ +     +++H    +C+ QN A  ++   Q+ +      +  P D   + G+S  LNCSA    +PT I+ K +          P+      R+  L NG+L++K++   D   ++C +   VG D +SK + + +K+PA I + P+     +  +  ++C  HG+  + V+W ++         V++ K+   ++    R  V  ++V D +              G + C A N +   G +R IL   V  P +   K E      R+IA+ W     DG   IT Y +  K  TE W     T++ S      TI +L P   Y+I + A+N +G  E +  +  T  +A PEGP  ++   +++   +K+ W++P + L NG+ + YQVC  E   S N S  +F                       CI+V  +  T  +++  L  F EY   V   N+ G  PA   V   T+ED P   P +V+ +  +   + L W  P +   NGV+ G+ + Y+++     PD  +  ++   TH   L+L  L   + Y IQ+      G G  S+ I   T E  P PP  +KA     + + VSW PP+K NG IR+Y +            F   P+  +  V +   ++ Y  W +         +  V+ V  + K P K          IL+FS ++       VVL C  V  P   I +L          I G + +  NGS +I ++   D G Y C       ++EI  N+    + + P  P + +TK +T  I + W    NG       I  +++     N      + +S + RS  + NL CGT Y   L A+N  GP     I +A+T G  P+      + T I   S+  NL  +  G GCP   + L+  P            VW     + L++   +N+ DL   T Y   ++  N  G
Sbjct:   56 LRWYLATGEESY----NVPGIRHVHPNGTLQIFHFPPSSFSKVIHDN--TYYCTAENPSGKIRSQDVHI-KAVLREPYTVRVADQTAMRGSVAVFKCIIPSSVENYITVVS-WE----RDTVPLV----SGARFLITSTGA---LYILDVQKED-ELFNYRCMTRHRYTSETRQSN---SARLFVPDPSNSAPAILDGFEKREVMASHRVELP-CKASGHPAPKYRW---LKNNRPLE--SDSRFR---QSVTGLLIERAQPSDTGSYVCEVWNSYGNAEVIGRLTVKEPLKAVVSPRKVKGSVGSQVSLSCSVTGSDEFELSWYRNGDKINTGANIRMN-GINKENLVMDGMAKSDGGVYQCFSRKAKMSA-------QDFVQVILEDGTPKIL---------SAFSEKVVGPN-DFVSLTCHVKGTPQPAITWTLDDE------VVAKDSRHRIVHSITA--EGNVVSYLNISHIQVRDSGVYRCTCNNSAGTVSYQARINVRGSADIRPMKNLTAIAGWDMYIHCHVIGYPYYSIKWFKNSN----LLPFNDRQRAFENNGTLKLLNVQKELDEGEYSCHVQVQPQLFKNQSVHVTVKVPPFI-------------------------QP-------FEFPRYSIGHRV--FVPCVVRSGDLPISITWEKDGKSIN-----ASLGVTIDNIDFTSSLRISNL-----QRVHNGTYTCIAQNDAAVVKYQSQLIVRVPPRFKVQPQDQDGIYGKSVILNCSADGEPRPT-IEWKYS-KGAGVPQFQPIALNSGFRVQLLGNGSLLIKHVLEEDAGYYLCKVSNDVGAD-VSKSMYLNVKIPAMITSYPNNSLATKGEKIEMSCKAHGEKPIMVRWEKE---------VEKEKQSHMINPDMWRHTVTVKNVGDEVVSTLQIYPTMREDSGFFSCHAINSY---GEDRGILQLTVQEPPEPP-KVEIREVKERTIALRWTM-GFDGNSLITGYDIECKNKTETWERARRTRDVSPTLNQATIIELHPSSTYNIRMFAKNHIGDSEPSNELTVTTDEADPEGPPQDVTLEAITSQSIKVTWKAPLKHLQNGVIRGYQVCHRE--HSTNGS-HQFV----------------------CISVEATGETESLSLNNLKKFAEYEVVVQASNSAGPGPASSEVRATTMEDVPSRAPEKVVATAASPESISLSWQTPAREALNGVLQGFRIIYWAN----LPDGELGEIRNVTTHKAPLELEGLEKYTNYSIQVLAFTRAGDGVRSDQIYIRTKEDVPGPPGGVKAAAASSSVVYVSWLPPLKLNGVIRKYTVFCSSTSPTVVSEFEVAPDEFLHRVHNLSRNRKYNIWVMAVTAAGRGNSSDVITVEPLAKAPAK----------ILTFSGTVTTPWMRDVVLPCRAVGDPPPAIKWLKESGSPAPAVIDGRRSIHGNGSFIIKTVKAEDSGYYTCVASNNYGTDEIILNL---QVQVPPDQPRLTVTKTTTTSITVTWTPGDNGGSS----IRGYILQYSEDNSEKWGSISISPSERSYRLENLNCGTWYKFTLTAQNAVGPGRISEIIEAKTHGKEPQFSKEQELFTSINGTSVKLNLIGWNDG-GCPITSFTLEYRPLES--------PVWTKAKRTSLSK--SYNLLDLQEATWYELQMKVYNSAG 1562          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Zebrafish
Match: dscama (Down syndrome cell adhesion molecule a [Source:ZFIN;Acc:ZDB-GENE-050310-7])

HSP 1 Score: 263.848 bits (673), Expect = 3.946e-70
Identity = 399/1687 (23.65%), Postives = 678/1687 (40.19%), Query Frame = 3
Query:  294 IKWYYETTQRNVFTEVNDPDRFVVGTNGDMDIF----------IQANIEVIYCKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRNIYTDIDVKSHDWISPKRLEDNSKIDFTSICQNIEVR-VIKGSTLELPWCSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEE-KWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLN-NLKISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQISIDNLVFKESPPLDYSIVLGQSFALNCSA----KPTNIQLKTNWFXXXXXXXXXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKEDGNWDSLPVKRIKEKSKVS----RFFVKFESVTDSLF-------------GEYKCVASNEHRKNGVERIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWKLVTENWFINATTKETS-----ITIEDLRPFKEYDIAIVAENSVGYGEEATIIIKTQADA-PEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPES--TLVITVTELLTFTEYAFRVILVNNVGFSPAKY-VAIRTLEDKPEGTPIQVLCSPKA-NFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNVKE--TH---LKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIKAYFY-QNCLKVSWTPPIKANGHIREYIIV-----------FSFEPNNMI-TVSSRENDKPYYSWELCSEQICSNCNVSVLAVTTM-KGPRKTVNVLSNKMGILSFXXXXXXXXXXXXXLYCE-VAFPDENIYYLWTHNDKD---IYG-QGVQSNGSLVINSMAESDQGIYKCKVK----SEEITYNVSTKSISLVPQTPYIEITKVSTNHIALLWR--SNGSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSN-PAISQAQTRGSIPEIPDTSNIVTEIGPHSMCFNLRAFRPGRGCPANKYILKLWPSSEGNHQESGVSVWKVVNDSDLNQIPCFNVTDLHPNTDYVYSIEASNMVG 5129
            ++WY  T + +     N P    V  NG + IF          I  N    YC A+N  G +RS+ + + K +  +   VR   +       AV  C++  ++  YI  V  WE     D+  ++    +  RF + +      L+I +V K D      RC+ R+ YT    +S+   S +    +      +I    E R V+    +ELP C    +    + W   + + R L   S S+F+   +    LLI+    ++ G Y         N  +   + V   +   + P  V       V L C  TG     L W  NG++ N+  +   +   ++ + +   +     GVYQC +     +        Q  V VI+ +  P ++          ++   V+  +     + C     P   + W LDD+      V+  ++ +R+ +++ A  + ++ + ++I   + +  G YR    N  G       I V     IR   ++T   G ++ + C+VI     +I+WF+++      LP    Q   E+     +  V K +  G+Y C+  +   L  +++  VT+  PP +                         QP       +EF      H V       +   DL I I ++K   S       A+L   + N       +I+ +     +++H    +C+ QN A  ++   Q+ +      +  P D   + G+S  LNCSA    +PT I+ K +          P+      R+  L NG+L++K++   D   ++C +   VG D +SK + + +K+PA I + P+     +  +  ++C  HG+  + V+W ++         V++ K+   ++    R  V  ++V D +              G + C A N +   G +R IL   V  P +   K E      R+IA+ W     DG   IT Y +  K  TE W     T++ S      TI +L P   Y+I + A+N +G  E +  +  T  +A PEGP  ++   +++   +K+ W++P + L NG+ + YQVC  E   S N S  +F                       CI+V  +  T  +++  L  F EY   V   N+ G  PA   V   T+ED P   P +V+ +  +   + L W  P +   NGV+ G+ + Y+++     PD  +  ++   TH   L+L  L   + Y IQ+      G G  S+ I   T E  P PP  +KA     + + VSW PP+K NG IR+Y +            F   P+  +  V +   ++ Y  W +         +  V+ V  + K P K          IL+FS ++       VVL C  V  P   I +L          I G + +  NGS +I ++   D G Y C       ++EI  N+    + + P  P + +TK +T  I + W    NG       I  +++     N      + +S + RS  + NL CGT Y   L A+N  GP     I +A+T G  P+      + T I   S+  NL  +  G GCP   + L+  P            VW     + L++   +N+ DL   T Y   ++  N  G
Sbjct:   42 LRWYLATGEESY----NVPGIRHVHPNGTLQIFHFPPSSFSKVIHDN--TYYCTAENPSGKIRSQDVHI-KAVLREPYTVRVADQTAMRGSVAVFKCIIPSSVENYITVVS-WE----RDTVPLV----SGARFLITSTGA---LYILDVQKED-ELFNYRCMTRHRYTSETRQSN---SARLFVPDPSNSAPAILDGFEKREVMASHRVELP-CKASGHPAPKYRW---LKNNRPLE--SDSRFR---QSVTGLLIERAQPSDTGSYVCEVWNSYGNAEVIGRLTVKEPLKAVVSPRKVKGSVGSQVSLSCSVTGSDEFELSWYRNGDKINTGANIRMN-GINKENLVMDGMAKSDGGVYQCFSRKAKMSA-------QDFVQVILEDGTPKIL---------SAFSEKVVGPN-DFVSLTCHVKGTPQPAITWTLDDE------VVAKDSRHRIVHSITA--EGNVVSYLNISHIQVRDSGVYRCTCNNSAGTVSYQARINVRGSADIRPMKNLTAIAGWDMYIHCHVIGYPYYSIKWFKNSN----LLPFNDRQRAFENNGTLKLLNVQKELDEGEYSCHVQVQPQLFKNQSVHVTVKVPPFI-------------------------QP-------FEFPRYSIGHRV--FVPCVVRSGDLPISITWEKDGKSIN-----ASLGVTIDNIDFTSSLRISNL-----QRVHNGTYTCIAQNDAAVVKYQSQLIVRVPPRFKVQPQDQDGIYGKSVILNCSADGEPRPT-IEWKYS-KGAGVPQFQPIALNSGFRVQLLGNGSLLIKHVLEEDAGYYLCKVSNDVGAD-VSKSMYLNVKIPAMITSYPNNSLATKGEKIEMSCKAHGEKPIMVRWEKE---------VEKEKQSHMINPDMWRHTVTVKNVGDEVVSTLQIYPTMREDSGFFSCHAINSY---GEDRGILQLTVQEPPEPP-KVEIREVKERTIALRWTM-GFDGNSLITGYDIECKNKTETWERARRTRDVSPTLNQATIIELHPSSTYNIRMFAKNHIGDSEPSNELTVTTDEADPEGPPQDVTLEAITSQSIKVTWKAPLKHLQNGVIRGYQVCHRE--HSTNGS-HQFV----------------------CISVEATGETESLSLNNLKKFAEYEVVVQASNSAGPGPASSEVRATTMEDVPSRAPEKVVATAASPESISLSWQTPAREALNGVLQGFRIIYWAN----LPDGELGEIRNVTTHKAPLELEGLEKYTNYSIQVLAFTRAGDGVRSDQIYIRTKEDVPGPPGGVKAAAASSSVVYVSWLPPLKLNGVIRKYTVFCSSTSPTVVSEFEVAPDEFLHRVHNLSRNRKYNIWVMAVTAAGRGNSSDVITVEPLAKAPAK----------ILTFSGTVTTPWMRDVVLPCRAVGDPPPAIKWLKESGSPAPAVIDGRRSIHGNGSFIIKTVKAEDSGYYTCVASNNYGTDEIILNL---QVQVPPDQPRLTVTKTTTTSITVTWTPGDNGGSS----IRGYILQYSEDNSEKWGSISISPSERSYRLENLNCGTWYKFTLTAQNAVGPGRISEIIEAKTHGKEPQFSKEQELFTSINGTSVKLNLIGWNDG-GCPITSFTLEYRPLES--------PVWTKAKRTSLSK--SYNLLDLQEATWYELQMKVYNSAG 1548          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Zebrafish
Match: dscama (Down syndrome cell adhesion molecule a [Source:ZFIN;Acc:ZDB-GENE-050310-7])

HSP 1 Score: 263.848 bits (673), Expect = 4.197e-70
Identity = 399/1687 (23.65%), Postives = 678/1687 (40.19%), Query Frame = 3
Query:  294 IKWYYETTQRNVFTEVNDPDRFVVGTNGDMDIF----------IQANIEVIYCKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRNIYTDIDVKSHDWISPKRLEDNSKIDFTSICQNIEVR-VIKGSTLELPWCSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEE-KWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLN-NLKISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQISIDNLVFKESPPLDYSIVLGQSFALNCSA----KPTNIQLKTNWFXXXXXXXXXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKEDGNWDSLPVKRIKEKSKVS----RFFVKFESVTDSLF-------------GEYKCVASNEHRKNGVERIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWKLVTENWFINATTKETS-----ITIEDLRPFKEYDIAIVAENSVGYGEEATIIIKTQADA-PEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPES--TLVITVTELLTFTEYAFRVILVNNVGFSPAKY-VAIRTLEDKPEGTPIQVLCSPKA-NFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNVKE--TH---LKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIKAYFY-QNCLKVSWTPPIKANGHIREYIIV-----------FSFEPNNMI-TVSSRENDKPYYSWELCSEQICSNCNVSVLAVTTM-KGPRKTVNVLSNKMGILSFXXXXXXXXXXXXXLYCE-VAFPDENIYYLWTHNDKD---IYG-QGVQSNGSLVINSMAESDQGIYKCKVK----SEEITYNVSTKSISLVPQTPYIEITKVSTNHIALLWR--SNGSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSN-PAISQAQTRGSIPEIPDTSNIVTEIGPHSMCFNLRAFRPGRGCPANKYILKLWPSSEGNHQESGVSVWKVVNDSDLNQIPCFNVTDLHPNTDYVYSIEASNMVG 5129
            ++WY  T + +     N P    V  NG + IF          I  N    YC A+N  G +RS+ + + K +  +   VR   +       AV  C++  ++  YI  V  WE     D+  ++    +  RF + +      L+I +V K D      RC+ R+ YT    +S+   S +    +      +I    E R V+    +ELP C    +    + W   + + R L   S S+F+   +    LLI+    ++ G Y         N  +   + V   +   + P  V       V L C  TG     L W  NG++ N+  +   +   ++ + +   +     GVYQC +     +        Q  V VI+ +  P ++          ++   V+  +     + C     P   + W LDD+      V+  ++ +R+ +++ A  + ++ + ++I   + +  G YR    N  G       I V     IR   ++T   G ++ + C+VI     +I+WF+++      LP    Q   E+     +  V K +  G+Y C+  +   L  +++  VT+  PP +                         QP       +EF      H V       +   DL I I ++K   S       A+L   + N       +I+ +     +++H    +C+ QN A  ++   Q+ +      +  P D   + G+S  LNCSA    +PT I+ K +          P+      R+  L NG+L++K++   D   ++C +   VG D +SK + + +K+PA I + P+     +  +  ++C  HG+  + V+W ++         V++ K+   ++    R  V  ++V D +              G + C A N +   G +R IL   V  P +   K E      R+IA+ W     DG   IT Y +  K  TE W     T++ S      TI +L P   Y+I + A+N +G  E +  +  T  +A PEGP  ++   +++   +K+ W++P + L NG+ + YQVC  E   S N S  +F                       CI+V  +  T  +++  L  F EY   V   N+ G  PA   V   T+ED P   P +V+ +  +   + L W  P +   NGV+ G+ + Y+++     PD  +  ++   TH   L+L  L   + Y IQ+      G G  S+ I   T E  P PP  +KA     + + VSW PP+K NG IR+Y +            F   P+  +  V +   ++ Y  W +         +  V+ V  + K P K          IL+FS ++       VVL C  V  P   I +L          I G + +  NGS +I ++   D G Y C       ++EI  N+    + + P  P + +TK +T  I + W    NG       I  +++     N      + +S + RS  + NL CGT Y   L A+N  GP     I +A+T G  P+      + T I   S+  NL  +  G GCP   + L+  P            VW     + L++   +N+ DL   T Y   ++  N  G
Sbjct:   56 LRWYLATGEESY----NVPGIRHVHPNGTLQIFHFPPSSFSKVIHDN--TYYCTAENPSGKIRSQDVHI-KAVLREPYTVRVADQTAMRGSVAVFKCIIPSSVENYITVVS-WE----RDTVPLV----SGARFLITSTGA---LYILDVQKED-ELFNYRCMTRHRYTSETRQSN---SARLFVPDPSNSAPAILDGFEKREVMASHRVELP-CKASGHPAPKYRW---LKNNRPLE--SDSRFR---QSVTGLLIERAQPSDTGSYVCEVWNSYGNAEVIGRLTVKEPLKAVVSPRKVKGSVGSQVSLSCSVTGSDEFELSWYRNGDKINTGANIRMN-GINKENLVMDGMAKSDGGVYQCFSRKAKMSA-------QDFVQVILEDGTPKIL---------SAFSEKVVGPN-DFVSLTCHVKGTPQPAITWTLDDE------VVAKDSRHRIVHSITA--EGNVVSYLNISHIQVRDSGVYRCTCNNSAGTVSYQARINVRGSADIRPMKNLTAIAGWDMYIHCHVIGYPYYSIKWFKNSN----LLPFNDRQRAFENNGTLKLLNVQKELDEGEYSCHVQVQPQLFKNQSVHVTVKVPPFI-------------------------QP-------FEFPRYSIGHRV--FVPCVVRSGDLPISITWEKDGKSIN-----ASLGVTIDNIDFTSSLRISNL-----QRVHNGTYTCIAQNDAAVVKYQSQLIVRVPPRFKVQPQDQDGIYGKSVILNCSADGEPRPT-IEWKYS-KGAGVPQFQPIALNSGFRVQLLGNGSLLIKHVLEEDAGYYLCKVSNDVGAD-VSKSMYLNVKIPAMITSYPNNSLATKGEKIEMSCKAHGEKPIMVRWEKE---------VEKEKQSHMINPDMWRHTVTVKNVGDEVVSTLQIYPTMREDSGFFSCHAINSY---GEDRGILQLTVQEPPEPP-KVEIREVKERTIALRWTM-GFDGNSLITGYDIECKNKTETWERARRTRDVSPTLNQATIIELHPSSTYNIRMFAKNHIGDSEPSNELTVTTDEADPEGPPQDVTLEAITSQSIKVTWKAPLKHLQNGVIRGYQVCHRE--HSTNGS-HQFV----------------------CISVEATGETESLSLNNLKKFAEYEVVVQASNSAGPGPASSEVRATTMEDVPSRAPEKVVATAASPESISLSWQTPAREALNGVLQGFRIIYWAN----LPDGELGEIRNVTTHKAPLELEGLEKYTNYSIQVLAFTRAGDGVRSDQIYIRTKEDVPGPPGGVKAAAASSSVVYVSWLPPLKLNGVIRKYTVFCSSTSPTVVSEFEVAPDEFLHRVHNLSRNRKYNIWVMAVTAAGRGNSSDVITVEPLAKAPAK----------ILTFSGTVTTPWMRDVVLPCRAVGDPPPAIKWLKESGSPAPAVIDGRRSIHGNGSFIIKTVKAEDSGYYTCVASNNYGTDEIILNL---QVQVPPDQPRLTVTKTTTTSITVTWTPGDNGGSS----IRGYILQYSEDNSEKWGSISISPSERSYRLENLNCGTWYKFTLTAQNAVGPGRISEIIEAKTHGKEPQFSKEQELFTSINGTSVKLNLIGWNDG-GCPITSFTLEYRPLES--------PVWTKAKRTSLSK--SYNLLDLQEATWYELQMKVYNSAG 1562          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Xenopus
Match: ccdc14 (coiled-coil domain containing 14 [Source:Xenbase;Acc:XB-GENE-6449725])

HSP 1 Score: 303.908 bits (777), Expect = 2.751e-82
Identity = 410/1789 (22.92%), Postives = 704/1789 (39.35%), Query Frame = 3
Query:   48 FLTTMRFFILILFNILCHFITFKNV---NSFDHKSFFFFLNRHKRYAEERNLEPPKLINVQKSFVTTMTDHSRVYCTATGNPSPKIKWYYETTQRNVFTEVND-PDRFVVGTNGDMDIF----------IQANIEVIYCKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRNIYTDIDVKSHDWISPKRLEDNSKIDFTSICQNIEV-RVIKGSTLELPWCSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLN-NLKISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQISIDNLVFKESP-----PLDYSIVLGQSFALNCSAKPTNIQLKTNWFXXXXXXXXXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKEDGNWDSLPVKRIKEKSKVSRFFVKFESVTDSLF-------------GEYKCVASNEHRKNGVERIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWKLVTENWFINATTKETS-----ITIEDLRPFKEYDIAIVAENSVGYGEEAT-IIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSP-AKYVAIRTLEDKPEGTPIQVLCSPKA-NFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNVKETH--LKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIK-AYFYQNCLKVSWTPPIKANGHIREYIIVFSF-------------EPNNMI-TVSSRENDKPYYSWELCSEQICSNCNVSVLAVT-TMKGPRKTVNVLSNKMGILSFXXXXXXXXXXXXXLYCEVA---------FPDENIYYLWTHNDKDIYGQGVQSNGSLVINSMAESDQGIYKCKV----KSEEITYNVSTKSISLVPQTPYIEITKVSTNHIALLWRSNGSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSNPA-ISQAQTRGSIPEIPDTSNIVTEIGPHSMCFNLRAFRPGRGCPANKYILKLWPSSEGNHQESGVSVWKVVNDSDLNQIPCFNVTDLHPNTDYVYSIEASNMVGSQKAKAHNKTRQIVSTAPPNI 5192
              T+ R +  + F+ L  +ITF  +    + D  +  +F+N                    +  V   T  + V C A G P   ++WY  T +     E+ D P    V  NG + IF          I  N    YC A+N  G +RS+ + + K +  +   VR + ++       V  C++  ++ AY+  V  WE     D+  ++    +  RF + +      L+I +V   D  +   RC  R+ YT    +S+   S +    +      SI    E  + + G  +ELP C    +    + W      + +++    S+F+        LLI+N   ++ G Y         N  +  ++ V   + V+I P  V +     + L C  TG     L W  NG   N+  +    T  +R + I   +    +G YQC          R     Q  V V++ +  P +I          S  +  + + G    + C     P  T+ W LDD  I      I N  +R+   + +   + +S +     + + GG YR    N  G       I V     IR   +IT   G +  + C VI     +I+W++++      LP  H Q   E+     +  V K +  G+Y+CN  +   L  S++  VT+  PP +                         QP         F+  + +    +     +   DL I I +QK         +G  +P  +   +    +  + + I     +H    +C+ +N A  +    Q     L+ +  P     P D   + G++  LNCSA+   +      ++  +         +  RI  L NG+L++K++   D   ++C +   VG D +SK + + +K+PA I + P+     +  +  ++CT HG+  + V+W  KED         R+    ++SR+ V  + V + +              G + C A N   ++    II L V + P    I  E     +RSIA+ W     DG  PIT Y +  K  +++W     TK+ S      TI DL P   Y+I + A+N +G  E +  + I T+  AP+GP   +    +S   +++ W++P + L NGI + Y++   E     N                 ++D          ++    + V T+  L  FT+Y   V   N  G  P ++ +   TLED P  +P  V  S  +   + + W+ P +   NG++ G+ V Y+++    E  ++ KNV  T   L+L NL   + Y IQ+      G G  SE I   T E  P P   +K A    + + VSW PP+K NG IR+Y++  S               P++    + S   ++ Y  W +         +  ++ V    K P +          IL+FS ++       +VL C+             +  + YL     + IY     SNGS +I ++   D G Y C       S+EI  N+    + + P  P + ++K +++ I L W    +  +   I  +++     N        +S + RS  + NL+CGT Y   L A+N  GP   + I +A+T G  P+     ++V       +  NL  +  G GCP   + L+  P         G +VW +   + L++   + + DL     Y   +   N  G  + +A   T     +  P I
Sbjct:   12 LATSARVWGTLHFDWLAQYITFPALLMSQTEDLHASLYFVNAS-----------------LQEVVFASTTGTLVPCPAGGIPPVTLRWYLATGE-----EIYDVPGIRHVHHNGTLQIFPFPPSSFNNLIHDN--TYYCTAENPSGKIRSQDVHI-KAVLREPYTVRVDDQKAMRGNAVVFKCIIPSSVEAYVTVVS-WE----KDTVSLV----SGSRFLITSTGA---LYIADVQNEDGLN-NYRCTTRHKYTGETRQSN---SARLTVSDPANSAPSIIDGFEHHKAMAGERVELP-CKASGHPIPKYRWL-----KNNVLLEPDSRFQ---HTVVGLLIENTRPSDSGSYVCEVWNNYGNAEVIGSLYVKQPLKVNISPRKVKSSVGSQISLACSVTGTDDPDLSWYRNGEIINAGNNVRI-TGVNRETLIMDGMAKSDSGAYQCFVR-------REKMSAQDYVQVVLEDGTPKII----------SAFSEKVVSPGEPVSLMCNVKGTPLPTITWTLDDDPI------IKNGNHRISQLITSEGNV-VSYLNITNTQVRDGGVYRCTANNSAGVVLYQARINVRGPASIRPMKNITAIAGRDTYIHCRVIGYPYYSIKWYKNSN----LLPFNHRQVAFENNGTLKLSDVQKDVDEGEYMCNVLVQPQLSTSQSVHVTVKVPPFI-------------------------QP---------FESQRFSIGQRVFIPCVVVSGDLPITITWQK---------DGRPIPASLGVTID-NIDFTSSLRISNLSLMHNGNYTCIARNDAAAVEHQSQ-----LIVRVPPRFVVQPTDQDGIYGKAVILNCSAEGYPVPTIVWKYSKGAGVPQFQPIALNGRIQLLTNGSLLIKHVLEEDSGYYLCKVSNDVGAD-VSKSMYLTVKIPAMITSYPNTTLATQGQKKEMSCTAHGEKPIIVRW-EKED---------RMINVPEMSRYLVSTKEVGEEVISTLQILPTVREDSGFFSCHAINSFGED--RGIIQLTVQEPPDPPEI--EIREVRARSIALRWT-MGFDGNSPITGYDIECKNKSDSWDSVQRTKDVSPQLNQATIIDLHPASTYNIRMYAKNRIGKSEASNELTITTEEAAPDGPPQEVQLDPISSQSIRVTWKAPKKHLQNGIIRGYKIGFREYSTGGNYQFN-------------IID----------VDTTGDSEVYTLDNLKKFTQYGVVVQACNRAGTGPSSQEIITTTLEDVPSRSPENVQASSTSPETITISWSTPSKEALNGILQGFRVIYWANLMDGELGEI-KNVTTTQPLLELDNLEKYTNYSIQVLAFTRAGDGVRSEQIFTRTKEDVPGPTAGVKAAAASASTVYVSWLPPLKPNGIIRKYMVFCSHPYPTGWPAPSGTAAPDSFFYRIPSLSRNRQYSVWVVAVTAAGRGNSSDIITVEPVAKAPAR----------ILTFSGTVTTPWMRDIVLPCKAVGDPSPTVKWMKESYVPYLMIDGRRSIY-----SNGSFIIRTVKAEDSGYYSCIATNSWGSDEIVLNL---QVQVPPDQPRLTVSKTTSSSITLSWTPGDNGGSS--IRGYILQYSEDNSEQWGSFPISPSERSYRLENLKCGTWYKFTLTAQNGVGPGRISEIIEAKTLGKEPQFSKEQDLVASTNTTRVRLNLIGWNDG-GCPITSFNLEYRP--------FGTTVWTLAQRTSLSK--SYILYDLQEAMWYELQMRVCNSAGCAEKQATFSTLNYDGSKCPGI 1601          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Xenopus
Match: ccdc14 (coiled-coil domain containing 14 [Source:Xenbase;Acc:XB-GENE-6449725])

HSP 1 Score: 303.523 bits (776), Expect = 4.016e-82
Identity = 414/1749 (23.67%), Postives = 706/1749 (40.37%), Query Frame = 3
Query:  135 HKSFFFF---LNRHKRYAEERNLEPP-KLINVQ-KSFVTTMTDHSRVYCTATGNPSPKIKWYYETTQRNVFTEVND-PDRFVVGTNGDMDIF----------IQANIEVIYCKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRNIYTDIDVKSHDWISPKRLEDNSKIDFTSICQNIEV-RVIKGSTLELPWCSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLN-NLKISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQISIDNLVFKESP-----PLDYSIVLGQSFALNCSAKPTNIQLKTNWFXXXXXXXXXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKEDGNWDSLPVKRIKEKSKVSRFFVKFESVTDSLF-------------GEYKCVASNEHRKNGVERIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWKLVTENWFINATTKETS-----ITIEDLRPFKEYDIAIVAENSVGYGEEAT-IIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSP-AKYVAIRTLEDKPEGTPIQVLCSPKA-NFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNVKETH--LKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIK-AYFYQNCLKVSWTPPIKANGHIREYIIVFSFEPNNMITVSSRENDKPYYSWELCSEQICSNCNVSVLAVTTMKGPRKTVNVLSNK------MGILSFXXXXXXXXXXXXXLYCE-VAFPDENIYYLWTHNDKD----IYG-QGVQSNGSLVINSMAESDQGIYKCKV----KSEEITYNVSTKSISLVPQTPYIEITKVSTNHIALLWRSNGSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSN-PAISQAQTRGSIPEIPDTSNIVTEIGPHSMCFNLRAFRPGRGCPANKYILKLWPSSEGNHQESGVSVWKVVNDSDLNQIPCFNVTDLHPNTDYVYSIEASNMVGSQKAKAHNKTRQI-VSTAPP 5186
            H  F FF   L+   ++ +  +L      +N   +  V   T  + V C A G P   ++WY  T +     E+ D P    V  NG + IF          I  N    YC A+N  G +RS+ + + K +  +   VR + ++       V  C++  ++ AY+  V  WE     D+  ++    +  RF + +      L+I +V   D  +   RC  R+ YT    +S+   S +    +      SI    E  + + G  +ELP C    +    + W      + +++    S+F+        LLI+N   ++ G Y         N  +  ++ V   + V+I P  V +     + L C  TG     L W  NG   N+  +    T  +R + I   +    +G YQC          R     Q  V V++ +  P +I          S  +  + + G    + C     P  T+ W LDD  I      I N  +R+   + +   + +S +     + + GG YR    N  G       I V     IR   +IT   G +  + C VI     +I+W++++      LP  H Q   E+     +  V K +  G+Y+CN  +   L  S++  VT+  PP +                         QP         F+  + +    +     +   DL I I +QK         +G  +P  +   +    +  + + I     +H    +C+ +N A  +    Q     L+ +  P     P D   + G++  LNCSA+   +      ++  +         +  RI  L NG+L++K++   D   ++C +   VG D +SK + + +K+PA I + P+     +  +  ++CT HG+  + V+W  KED         R+    ++SR+ V  + V + +              G + C A N   ++    II L V + P    I  E     +RSIA+ W     DG  PIT Y +  K  +++W     TK+ S      TI DL P   Y+I + A+N +G  E +  + I T+  AP+GP   +    +S   +++ W++P + L NGI + Y++   E     N                 ++D          ++    + V T+  L  FT+Y   V   N  G  P ++ +   TLED P  +P  V  S  +   + + W+ P +   NG++ G+ V Y+++    E  ++ KNV  T   L+L NL   + Y IQ+      G G  SE I   T E  P P   +K A    + + VSW PP+K NG IR+Y +VF   P   + +S  E     + + + S       +V V+AVT   G   + ++++ +        IL+FS ++       +VL C+ V  P   + ++   N       I G + + SNGS +I ++   D G Y C       S+EI  N+    + + P  P + ++K +++ I L W    +  +   I  +++     N        +S + RS  + NL+CGT Y   L A+N  GP     I +A+T G  P+     ++V       +  NL  +  G GCP   + L+  P         G +VW +   + L++   + + DL     Y   +   N  G  + +A   T     ST PP
Sbjct:    7 HGIFLFFTPQLSLIYKFVQLEDLHASLYFVNASLQEVVFASTTGTLVPCPAGGIPPVTLRWYLATGE-----EIYDVPGIRHVHHNGTLQIFPFPPSSFNNLIHDN--TYYCTAENPSGKIRSQDVHI-KAVLREPYTVRVDDQKAMRGNAVVFKCIIPSSVEAYVTVVS-WE----KDTVSLV----SGSRFLITSTGA---LYIADVQNEDGLN-NYRCTTRHKYTGETRQSN---SARLTVSDPANSAPSIIDGFEHHKAMAGERVELP-CKASGHPIPKYRWL-----KNNVLLEPDSRFQ---HTVVGLLIENTRPSDSGSYVCEVWNNYGNAEVIGSLYVKQPLKVNISPRKVKSSVGSQISLACSVTGTDDPDLSWYRNGEIINAGNNVRI-TGVNRETLIMDGMAKSDSGAYQCFVR-------REKMSAQDYVQVVLEDGTPKII----------SAFSEKVVSPGEPVSLMCNVKGTPLPTITWTLDDDPI------IKNGNHRISQLITSEGNV-VSYLNITNTQVRDGGVYRCTANNSAGVVLYQARINVRGPASIRPMKNITAIAGRDTYIHCRVIGYPYYSIKWYKNSN----LLPFNHRQVAFENNGTLKLSDVQKDVDEGEYMCNVLVQPQLSTSQSVHVTVKVPPFI-------------------------QP---------FESQRFSIGQRVFIPCVVVSGDLPITITWQK---------DGRPIPASLGVTID-NIDFTSSLRISNLSLMHNGNYTCIARNDAAAVEHQSQ-----LIVRVPPRFVVQPTDQDGIYGKAVILNCSAEGYPVPTIVWKYSKGAGVPQFQPIALNGRIQLLTNGSLLIKHVLEEDSGYYLCKVSNDVGAD-VSKSMYLTVKIPAMITSYPNTTLATQGQKKEMSCTAHGEKPIIVRW-EKED---------RMINVPEMSRYLVSTKEVGEEVISTLQILPTVREDSGFFSCHAINSFGED--RGIIQLTVQEPPDPPEI--EIREVRARSIALRWT-MGFDGNSPITGYDIECKNKSDSWDSVQRTKDVSPQLNQATIIDLHPASTYNIRMYAKNRIGKSEASNELTITTEEAAPDGPPQEVQLDPISSQSIRVTWKAPKKHLQNGIIRGYKIGFREYSTGGNYQFN-------------IID----------VDTTGDSEVYTLDNLKKFTQYGVVVQACNRAGTGPSSQEIITTTLEDVPSRSPENVQASSTSPETITISWSTPSKEALNGILQGFRVIYWANLMDGELGEI-KNVTTTQPLLELDNLEKYTNYSIQVLAFTRAGDGVRSEQIFTRTKEDVPGPTAGVKAAAASASTVYVSWLPPLKPNGIIRKY-MVFCSHPYPTV-ISDFEAAPDSFFYRIPSLSRNRQYSVWVVAVTA-AGRGNSSDIITVEPVAKAPARILTFSGTVTTPWMRDIVLPCKAVGDPSPTVKWMKESNGTPSLVMIDGRRSIYSNGSFIIRTVKAEDSGYYSCIATNSWGSDEIVLNL---QVQVPPDQPRLTVSKTTSSSITLSWTPGDNGGSS--IRGYILQYSEDNSEQWGSFPISPSERSYRLENLKCGTWYKFTLTAQNGVGPGRISEIIEAKTLGKEPQFSKEQDLVASTNTTRVRLNLIGWNDG-GCPITSFNLEYRP--------FGTTVWTLAQRTSLSK--SYILYDLQEAMWYELQMRVCNSAGCAEKQATFSTLNYDGSTIPP 1585          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Xenopus
Match: ccdc14 (coiled-coil domain containing 14 [Source:Xenbase;Acc:XB-GENE-6449725])

HSP 1 Score: 302.753 bits (774), Expect = 7.041e-82
Identity = 407/1715 (23.73%), Postives = 693/1715 (40.41%), Query Frame = 3
Query:  222 KSFVTTMTDHSRVYCTATGNPSPKIKWYYETTQRNVFTEVND-PDRFVVGTNGDMDIF----------IQANIEVIYCKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRNIYTDIDVKSHDWISPKRLEDNSKIDFTSICQNIEV-RVIKGSTLELPWCSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLN-NLKISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQISIDNLVFKESP-----PLDYSIVLGQSFALNCSAKPTNIQLKTNWFXXXXXXXXXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKEDGNWDSLPVKRIKEKSKVSRFFVKFESVTDSLF-------------GEYKCVASNEHRKNGVERIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWKLVTENWFINATTKETS-----ITIEDLRPFKEYDIAIVAENSVGYGEEAT-IIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSP-AKYVAIRTLEDKPEGTPIQVLCSPKA-NFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNVKETH--LKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIK-AYFYQNCLKVSWTPPIKANGHIREYIIVFSFEPNNMITVSSRENDKPYYSWELCSEQICSNCNVSVLAVTTMKGPRKTVNVLSNK------MGILSFXXXXXXXXXXXXXLYCE-VAFPDENIYYLWTHNDKD----IYG-QGVQSNGSLVINSMAESDQGIYKCKV----KSEEITYNVSTKSISLVPQTPYIEITKVSTNHIALLWRSNGSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSN-PAISQAQTRGSIPEIPDTSNIVTEIGPHSMCFNLRAFRPGRGCPANKYILKLWPSSEGNHQESGVSVWKVVNDSDLNQIPCFNVTDLHPNTDYVYSIEASNMVGSQKAKAHNKTRQI-VSTAPP 5186
            +  V   T  + V C A G P   ++WY  T +     E+ D P    V  NG + IF          I  N    YC A+N  G +RS+ + + K +  +   VR + ++       V  C++  ++ AY+  V  WE     D+  ++    +  RF + +      L+I +V   D  +   RC  R+ YT    +S+   S +    +      SI    E  + + G  +ELP C    +    + W      + +++    S+F+        LLI+N   ++ G Y         N  +  ++ V   + V+I P  V +     + L C  TG     L W  NG   N+  +    T  +R + I   +    +G YQC          R     Q  V V++ +  P +I          S  +  + + G    + C     P  T+ W LDD  I      I N  +R+   + +   + +S +     + + GG YR    N  G       I V     IR   +IT   G +  + C VI     +I+W++++      LP  H Q   E+     +  V K +  G+Y+CN  +   L  S++  VT+  PP +                         QP         F+  + +    +     +   DL I I +QK         +G  +P  +   +    +  + + I     +H    +C+ +N A  +    Q     L+ +  P     P D   + G++  LNCSA+   +      ++  +         +  RI  L NG+L++K++   D   ++C +   VG D +SK + + +K+PA I + P+     +  +  ++CT HG+  + V+W  KED         R+    ++SR+ V  + V + +              G + C A N   ++    II L V + P    I  E     +RSIA+ W     DG  PIT Y +  K  +++W     TK+ S      TI DL P   Y+I + A+N +G  E +  + I T+  AP+GP   +    +S   +++ W++P + L NGI + Y++   E     N                 ++D          ++    + V T+  L  FT+Y   V   N  G  P ++ +   TLED P  +P  V  S  +   + + W+ P +   NG++ G+ V Y+++    E  ++ KNV  T   L+L NL   + Y IQ+      G G  SE I   T E  P P   +K A    + + VSW PP+K NG IR+Y +VF   P   + +S  E     + + + S       +V V+AVT   G   + ++++ +        IL+FS ++       +VL C+ V  P   + ++   N       I G + + SNGS +I ++   D G Y C       S+EI  N+    + + P  P + ++K +++ I L W    +  +   I  +++     N        +S + RS  + NL+CGT Y   L A+N  GP     I +A+T G  P+     ++V       +  NL  +  G GCP   + L+  P         G +VW +   + L++   + + DL     Y   +   N  G  + +A   T     ST PP
Sbjct:   33 QEVVFASTTGTLVPCPAGGIPPVTLRWYLATGE-----EIYDVPGIRHVHHNGTLQIFPFPPSSFNNLIHDN--TYYCTAENPSGKIRSQDVHI-KAVLREPYTVRVDDQKAMRGNAVVFKCIIPSSVEAYVTVVS-WE----KDTVSLV----SGSRFLITSTGA---LYIADVQNEDGLN-NYRCTTRHKYTGETRQSN---SARLTVSDPANSAPSIIDGFEHHKAMAGERVELP-CKASGHPIPKYRWL-----KNNVLLEPDSRFQ---HTVVGLLIENTRPSDSGSYVCEVWNNYGNAEVIGSLYVKQPLKVNISPRKVKSSVGSQISLACSVTGTDDPDLSWYRNGEIINAGNNVRI-TGVNRETLIMDGMAKSDSGAYQCFVR-------REKMSAQDYVQVVLEDGTPKII----------SAFSEKVVSPGEPVSLMCNVKGTPLPTITWTLDDDPI------IKNGNHRISQLITSEGNV-VSYLNITNTQVRDGGVYRCTANNSAGVVLYQARINVRGPASIRPMKNITAIAGRDTYIHCRVIGYPYYSIKWYKNSN----LLPFNHRQVAFENNGTLKLSDVQKDVDEGEYMCNVLVQPQLSTSQSVHVTVKVPPFI-------------------------QP---------FESQRFSIGQRVFIPCVVVSGDLPITITWQK---------DGRPIPASLGVTID-NIDFTSSLRISNLSLMHNGNYTCIARNDAAAVEHQSQ-----LIVRVPPRFVVQPTDQDGIYGKAVILNCSAEGYPVPTIVWKYSKGAGVPQFQPIALNGRIQLLTNGSLLIKHVLEEDSGYYLCKVSNDVGAD-VSKSMYLTVKIPAMITSYPNTTLATQGQKKEMSCTAHGEKPIIVRW-EKED---------RMINVPEMSRYLVSTKEVGEEVISTLQILPTVREDSGFFSCHAINSFGED--RGIIQLTVQEPPDPPEI--EIREVRARSIALRWT-MGFDGNSPITGYDIECKNKSDSWDSVQRTKDVSPQLNQATIIDLHPASTYNIRMYAKNRIGKSEASNELTITTEEAAPDGPPQEVQLDPISSQSIRVTWKAPKKHLQNGIIRGYKIGFREYSTGGNYQFN-------------IID----------VDTTGDSEVYTLDNLKKFTQYGVVVQACNRAGTGPSSQEIITTTLEDVPSRSPENVQASSTSPETITISWSTPSKEALNGILQGFRVIYWANLMDGELGEI-KNVTTTQPLLELDNLEKYTNYSIQVLAFTRAGDGVRSEQIFTRTKEDVPGPTAGVKAAAASASTVYVSWLPPLKPNGIIRKY-MVFCSHPYPTV-ISDFEAAPDSFFYRIPSLSRNRQYSVWVVAVTA-AGRGNSSDIITVEPVAKAPARILTFSGTVTTPWMRDIVLPCKAVGDPSPTVKWMKESNGTPSLVMIDGRRSIYSNGSFIIRTVKAEDSGYYSCIATNSWGSDEIVLNL---QVQVPPDQPRLTVSKTTSSSITLSWTPGDNGGSS--IRGYILQYSEDNSEQWGSFPISPSERSYRLENLKCGTWYKFTLTAQNGVGPGRISEIIEAKTLGKEPQFSKEQDLVASTNTTRVRLNLIGWNDG-GCPITSFNLEYRP--------FGTTVWTLAQRTSLSK--SYILYDLQEAMWYELQMRVCNSAGCAEKQATFSTLNYDGSTIPP 1577          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Xenopus
Match: ccdc14 (coiled-coil domain containing 14 [Source:Xenbase;Acc:XB-GENE-6449725])

HSP 1 Score: 302.368 bits (773), Expect = 8.622e-82
Identity = 407/1715 (23.73%), Postives = 693/1715 (40.41%), Query Frame = 3
Query:  222 KSFVTTMTDHSRVYCTATGNPSPKIKWYYETTQRNVFTEVND-PDRFVVGTNGDMDIF----------IQANIEVIYCKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRNIYTDIDVKSHDWISPKRLEDNSKIDFTSICQNIEV-RVIKGSTLELPWCSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLN-NLKISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQISIDNLVFKESP-----PLDYSIVLGQSFALNCSAKPTNIQLKTNWFXXXXXXXXXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKEDGNWDSLPVKRIKEKSKVSRFFVKFESVTDSLF-------------GEYKCVASNEHRKNGVERIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWKLVTENWFINATTKETS-----ITIEDLRPFKEYDIAIVAENSVGYGEEAT-IIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSP-AKYVAIRTLEDKPEGTPIQVLCSPKA-NFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNVKETH--LKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIK-AYFYQNCLKVSWTPPIKANGHIREYIIVFSFEPNNMITVSSRENDKPYYSWELCSEQICSNCNVSVLAVTTMKGPRKTVNVLSNK------MGILSFXXXXXXXXXXXXXLYCE-VAFPDENIYYLWTHNDKD----IYG-QGVQSNGSLVINSMAESDQGIYKCKV----KSEEITYNVSTKSISLVPQTPYIEITKVSTNHIALLWRSNGSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSN-PAISQAQTRGSIPEIPDTSNIVTEIGPHSMCFNLRAFRPGRGCPANKYILKLWPSSEGNHQESGVSVWKVVNDSDLNQIPCFNVTDLHPNTDYVYSIEASNMVGSQKAKAHNKTRQI-VSTAPP 5186
            +  V   T  + V C A G P   ++WY  T +     E+ D P    V  NG + IF          I  N    YC A+N  G +RS+ + + K +  +   VR + ++       V  C++  ++ AY+  V  WE     D+  ++    +  RF + +      L+I +V   D  +   RC  R+ YT    +S+   S +    +      SI    E  + + G  +ELP C    +    + W      + +++    S+F+        LLI+N   ++ G Y         N  +  ++ V   + V+I P  V +     + L C  TG     L W  NG   N+  +    T  +R + I   +    +G YQC          R     Q  V V++ +  P +I          S  +  + + G    + C     P  T+ W LDD  I      I N  +R+   + +   + +S +     + + GG YR    N  G       I V     IR   +IT   G +  + C VI     +I+W++++      LP  H Q   E+     +  V K +  G+Y+CN  +   L  S++  VT+  PP +                         QP         F+  + +    +     +   DL I I +QK         +G  +P  +   +    +  + + I     +H    +C+ +N A  +    Q     L+ +  P     P D   + G++  LNCSA+   +      ++  +         +  RI  L NG+L++K++   D   ++C +   VG D +SK + + +K+PA I + P+     +  +  ++CT HG+  + V+W  KED         R+    ++SR+ V  + V + +              G + C A N   ++    II L V + P    I  E     +RSIA+ W     DG  PIT Y +  K  +++W     TK+ S      TI DL P   Y+I + A+N +G  E +  + I T+  AP+GP   +    +S   +++ W++P + L NGI + Y++   E     N                 ++D          ++    + V T+  L  FT+Y   V   N  G  P ++ +   TLED P  +P  V  S  +   + + W+ P +   NG++ G+ V Y+++    E  ++ KNV  T   L+L NL   + Y IQ+      G G  SE I   T E  P P   +K A    + + VSW PP+K NG IR+Y +VF   P   + +S  E     + + + S       +V V+AVT   G   + ++++ +        IL+FS ++       +VL C+ V  P   + ++   N       I G + + SNGS +I ++   D G Y C       S+EI  N+    + + P  P + ++K +++ I L W    +  +   I  +++     N        +S + RS  + NL+CGT Y   L A+N  GP     I +A+T G  P+     ++V       +  NL  +  G GCP   + L+  P         G +VW +   + L++   + + DL     Y   +   N  G  + +A   T     ST PP
Sbjct:   39 QEVVFASTTGTLVPCPAGGIPPVTLRWYLATGE-----EIYDVPGIRHVHHNGTLQIFPFPPSSFNNLIHDN--TYYCTAENPSGKIRSQDVHI-KAVLREPYTVRVDDQKAMRGNAVVFKCIIPSSVEAYVTVVS-WE----KDTVSLV----SGSRFLITSTGA---LYIADVQNEDGLN-NYRCTTRHKYTGETRQSN---SARLTVSDPANSAPSIIDGFEHHKAMAGERVELP-CKASGHPIPKYRWL-----KNNVLLEPDSRFQ---HTVVGLLIENTRPSDSGSYVCEVWNNYGNAEVIGSLYVKQPLKVNISPRKVKSSVGSQISLACSVTGTDDPDLSWYRNGEIINAGNNVRI-TGVNRETLIMDGMAKSDSGAYQCFVR-------REKMSAQDYVQVVLEDGTPKII----------SAFSEKVVSPGEPVSLMCNVKGTPLPTITWTLDDDPI------IKNGNHRISQLITSEGNV-VSYLNITNTQVRDGGVYRCTANNSAGVVLYQARINVRGPASIRPMKNITAIAGRDTYIHCRVIGYPYYSIKWYKNSN----LLPFNHRQVAFENNGTLKLSDVQKDVDEGEYMCNVLVQPQLSTSQSVHVTVKVPPFI-------------------------QP---------FESQRFSIGQRVFIPCVVVSGDLPITITWQK---------DGRPIPASLGVTID-NIDFTSSLRISNLSLMHNGNYTCIARNDAAAVEHQSQ-----LIVRVPPRFVVQPTDQDGIYGKAVILNCSAEGYPVPTIVWKYSKGAGVPQFQPIALNGRIQLLTNGSLLIKHVLEEDSGYYLCKVSNDVGAD-VSKSMYLTVKIPAMITSYPNTTLATQGQKKEMSCTAHGEKPIIVRW-EKED---------RMINVPEMSRYLVSTKEVGEEVISTLQILPTVREDSGFFSCHAINSFGED--RGIIQLTVQEPPDPPEI--EIREVRARSIALRWT-MGFDGNSPITGYDIECKNKSDSWDSVQRTKDVSPQLNQATIIDLHPASTYNIRMYAKNRIGKSEASNELTITTEEAAPDGPPQEVQLDPISSQSIRVTWKAPKKHLQNGIIRGYKIGFREYSTGGNYQFN-------------IID----------VDTTGDSEVYTLDNLKKFTQYGVVVQACNRAGTGPSSQEIITTTLEDVPSRSPENVQASSTSPETITISWSTPSKEALNGILQGFRVIYWANLMDGELGEI-KNVTTTQPLLELDNLEKYTNYSIQVLAFTRAGDGVRSEQIFTRTKEDVPGPTAGVKAAAASASTVYVSWLPPLKPNGIIRKY-MVFCSHPYPTV-ISDFEAAPDSFFYRIPSLSRNRQYSVWVVAVTA-AGRGNSSDIITVEPVAKAPARILTFSGTVTTPWMRDIVLPCKAVGDPSPTVKWMKESNGTPSLVMIDGRRSIYSNGSFIIRTVKAEDSGYYSCIATNSWGSDEIVLNL---QVQVPPDQPRLTVSKTTSSSITLSWTPGDNGGSS--IRGYILQYSEDNSEQWGSFPISPSERSYRLENLKCGTWYKFTLTAQNGVGPGRISEIIEAKTLGKEPQFSKEQDLVASTNTTRVRLNLIGWNDG-GCPITSFNLEYRP--------FGTTVWTLAQRTSLSK--SYILYDLQEAMWYELQMRVCNSAGCAEKQATFSTLNYDGSTIPP 1583          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Xenopus
Match: ccdc14 (coiled-coil domain containing 14 [Source:Xenbase;Acc:XB-GENE-6449725])

HSP 1 Score: 301.597 bits (771), Expect = 1.580e-81
Identity = 400/1728 (23.15%), Postives = 684/1728 (39.58%), Query Frame = 3
Query:  222 KSFVTTMTDHSRVYCTATGNPSPKIKWYYETTQRNVFTEVND-PDRFVVGTNGDMDIF----------IQANIEVIYCKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRNIYTDIDVKSHDWISPKRLEDNSKIDFTSICQNIEV-RVIKGSTLELPWCSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLN-NLKISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQISIDNLVFKESP-----PLDYSIVLGQSFALNCSAKPTNIQLKTNWFXXXXXXXXXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKEDGNWDSLPVKRIKEKSKVSRFFVKFESVTDSLF-------------GEYKCVASNEHRKNGVERIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWKLVTENWFINATTKETS-----ITIEDLRPFKEYDIAIVAENSVGYGEEAT-IIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSP-AKYVAIRTLEDKPEGTPIQVLCSPKA-NFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNVKETH--LKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIK-AYFYQNCLKVSWTPPIKANGHIREYIIVFSF-------------EPNNMI-TVSSRENDKPYYSWELCSEQICSNCNVSVLAVT-TMKGPRKTVNVLSNKMGILSFXXXXXXXXXXXXXLYCEVA---------FPDENIYYLWTHNDKDIYGQGVQSNGSLVINSMAESDQGIYKCKV----KSEEITYNVSTKSISLVPQTPYIEITKVSTNHIALLWRSNGSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSNPA-ISQAQTRGSIPEIPDTSNIVTEIGPHSMCFNLRAFRPGRGCPANKYILKLWPSSEGNHQESGVSVWKVVNDSDLNQIPCFNVTDLHPNTDYVYSIEASNMVGSQKAKAHNKTRQIVSTAPPNI 5192
            +  V   T  + V C A G P   ++WY  T +     E+ D P    V  NG + IF          I  N    YC A+N  G +RS+ + + K +  +   VR + ++       V  C++  ++ AY+  V  WE     D+  ++    +  RF + +      L+I +V   D  +   RC  R+ YT    +S+   S +    +      SI    E  + + G  +ELP C    +    + W      + +++    S+F+        LLI+N   ++ G Y         N  +  ++ V   + V+I P  V +     + L C  TG     L W  NG   N+  +    T  +R + I   +    +G YQC          R     Q  V V++ +  P +I          S  +  + + G    + C     P  T+ W LDD  I      I N  +R+   + +   + +S +     + + GG YR    N  G       I V     IR   +IT   G +  + C VI     +I+W++++      LP  H Q   E+     +  V K +  G+Y+CN  +   L  S++  VT+  PP +                         QP         F+  + +    +     +   DL I I +QK         +G  +P  +   +    +  + + I     +H    +C+ +N A  +    Q     L+ +  P     P D   + G++  LNCSA+   +      ++  +         +  RI  L NG+L++K++   D   ++C +   VG D +SK + + +K+PA I + P+     +  +  ++CT HG+  + V+W  KED         R+    ++SR+ V  + V + +              G + C A N   ++    II L V + P    I  E     +RSIA+ W     DG  PIT Y +  K  +++W     TK+ S      TI DL P   Y+I + A+N +G  E +  + I T+  AP+GP   +    +S   +++ W++P + L NGI + Y++   E     N                 ++D          ++    + V T+  L  FT+Y   V   N  G  P ++ +   TLED P  +P  V  S  +   + + W+ P +   NG++ G+ V Y+++    E  ++ KNV  T   L+L NL   + Y IQ+      G G  SE I   T E  P P   +K A    + + VSW PP+K NG IR+Y++  S               P++    + S   ++ Y  W +         +  ++ V    K P +          IL+FS ++       +VL C+             +  + YL     + IY     SNGS +I ++   D G Y C       S+EI  N+    + + P  P + ++K +++ I L W    +  +   I  +++     N        +S + RS  + NL+CGT Y   L A+N  GP   + I +A+T G  P+     ++V       +  NL  +  G GCP   + L+  P         G +VW +   + L++   + + DL     Y   +   N  G  + +A   T     +  P I
Sbjct:   36 QEVVFASTTGTLVPCPAGGIPPVTLRWYLATGE-----EIYDVPGIRHVHHNGTLQIFPFPPSSFNNLIHDN--TYYCTAENPSGKIRSQDVHI-KAVLREPYTVRVDDQKAMRGNAVVFKCIIPSSVEAYVTVVS-WE----KDTVSLV----SGSRFLITSTGA---LYIADVQNEDGLN-NYRCTTRHKYTGETRQSN---SARLTVSDPANSAPSIIDGFEHHKAMAGERVELP-CKASGHPIPKYRWL-----KNNVLLEPDSRFQ---HTVVGLLIENTRPSDSGSYVCEVWNNYGNAEVIGSLYVKQPLKVNISPRKVKSSVGSQISLACSVTGTDDPDLSWYRNGEIINAGNNVRI-TGVNRETLIMDGMAKSDSGAYQCFVR-------REKMSAQDYVQVVLEDGTPKII----------SAFSEKVVSPGEPVSLMCNVKGTPLPTITWTLDDDPI------IKNGNHRISQLITSEGNV-VSYLNITNTQVRDGGVYRCTANNSAGVVLYQARINVRGPASIRPMKNITAIAGRDTYIHCRVIGYPYYSIKWYKNSN----LLPFNHRQVAFENNGTLKLSDVQKDVDEGEYMCNVLVQPQLSTSQSVHVTVKVPPFI-------------------------QP---------FESQRFSIGQRVFIPCVVVSGDLPITITWQK---------DGRPIPASLGVTID-NIDFTSSLRISNLSLMHNGNYTCIARNDAAAVEHQSQ-----LIVRVPPRFVVQPTDQDGIYGKAVILNCSAEGYPVPTIVWKYSKGAGVPQFQPIALNGRIQLLTNGSLLIKHVLEEDSGYYLCKVSNDVGAD-VSKSMYLTVKIPAMITSYPNTTLATQGQKKEMSCTAHGEKPIIVRW-EKED---------RMINVPEMSRYLVSTKEVGEEVISTLQILPTVREDSGFFSCHAINSFGED--RGIIQLTVQEPPDPPEI--EIREVRARSIALRWT-MGFDGNSPITGYDIECKNKSDSWDSVQRTKDVSPQLNQATIIDLHPASTYNIRMYAKNRIGKSEASNELTITTEEAAPDGPPQEVQLDPISSQSIRVTWKAPKKHLQNGIIRGYKIGFREYSTGGNYQFN-------------IID----------VDTTGDSEVYTLDNLKKFTQYGVVVQACNRAGTGPSSQEIITTTLEDVPSRSPENVQASSTSPETITISWSTPSKEALNGILQGFRVIYWANLMDGELGEI-KNVTTTQPLLELDNLEKYTNYSIQVLAFTRAGDGVRSEQIFTRTKEDVPGPTAGVKAAAASASTVYVSWLPPLKPNGIIRKYMVFCSHPYPTGWPAPSGTAAPDSFFYRIPSLSRNRQYSVWVVAVTAAGRGNSSDIITVEPVAKAPAR----------ILTFSGTVTTPWMRDIVLPCKAVGDPSPTVKWMKESYVPYLMIDGRRSIY-----SNGSFIIRTVKAEDSGYYSCIATNSWGSDEIVLNL---QVQVPPDQPRLTVSKTTSSSITLSWTPGDNGGSS--IRGYILQYSEDNSEQWGSFPISPSERSYRLENLKCGTWYKFTLTAQNGVGPGRISEIIEAKTLGKEPQFSKEQDLVASTNTTRVRLNLIGWNDG-GCPITSFNLEYRP--------FGTTVWTLAQRTSLSK--SYILYDLQEAMWYELQMRVCNSAGCAEKQATFSTLNYDGSKCPGI 1581          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Mouse
Match: Dscam (DS cell adhesion molecule [Source:MGI Symbol;Acc:MGI:1196281])

HSP 1 Score: 304.679 bits (779), Expect = 1.292e-82
Identity = 431/1767 (24.39%), Postives = 703/1767 (39.78%), Query Frame = 3
Query:   93 LCHFITFKNVNSFDHKSFFFFLNRHKRYAEERNLEPPKLINVQKSFVTTMTDHSRVYCTATGNPSPKIKWYYETTQRNVFTEVND-PDRFVVGTNGDMDIF----------IQANIEVIYCKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRNIYTDIDVKSHDWISPKRLEDNSKIDFTSICQNIEVR-VIKGSTLELPWCSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTV----VNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLN-NLKISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQISIDNLVFKESP-----PLDYSIVLGQSFALNCSAKPTNIQLKTNWFXXXXXXXXXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKEDGNWDSLPVKRIKEKSKVSRFFVKFESVTDSLF-------------GEYKCVASNEHRKNGVERIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWKLVTENWFINATTKET-----SITIEDLRPFKEYDIAIVAENSVGYGEEAT-IIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSP-AKYVAIRTLEDKPEGTP--IQVLC-SPKANFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNVKETH--LKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIKAYFYQNCLK-VSWTPPIKANGHIREYIIVFSFEPNNMITVSSRENDKPYYSWELCSEQICSNCNVSVLAVTTM-KGPRK---TVNVLSNKMG-ILSFXXXXXXXXXXXXXLYCE-VAFPDENIYYLWTHNDK----DIYG-QGVQSNGSLVINSMAESDQGIYKCKV----KSEEITYNVSTKSISLVPQTPYIEITKVSTNHIALLW--RSNGSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSN-PAISQAQTRGSIPEIPDTSNIVTEIGPHSMCFNLRAFRPGRGCPANKYILKLWPSSEGNHQESGVSVWKVVNDSDLNQIPCFNVTDLHPNTDYVYSIEASNMVGSQKAKAHNKTRQI-VSTAPPNI 5192
            L  F +F NV S +  S  +F+N                    +  V   T  + V C A G P   ++WY  T +     E+ D P    V  NG + IF          I  N    YC A+N  G +RS+ + + K +  +   VR E ++      AV  C++  ++ AY+  V  WE     D+  ++    +  RF + +      L+I++V   D      RCI R+ YT    +S+   S +    +      SI    + R  + G  +ELP C    + +  + W          + LSG   K ++     LLI+N   ++ G Y        SN Y T  V   + V   +K T+    V +     V L C  TG     L W  NG   N  K+    T  +  + I   +     G YQC        ++++ ++D   V V++ +  P +I          S  +  + +      + C     P  TV W LDD  I      +  + +R+   + +   + +S +     + + GG YR    N  G       I V     IR   +IT   G +  + C VI     +I+W+++A      LP  H Q   E+     +  V K +  G+Y CN  +   L  S++  VT+  PP +                         QP       +EF        V       +   DL I I +QK         +G  +P  +   +    +  + + I     +H    +C+ +N A  +    Q     L+ +  P     P D   + G++  LNCSA+   +      F+  +         +  RI  L NG+L++K++   D   ++C +   VG D +SK + + +K+PA I + P+     +     ++CT HG+  + V+W  KED         RI    +++R+ V  + V + +              G + C A N + ++    II L V + P    I  E     +R+I + W     DG  PIT Y +  K  +++W     TK+      S TI D+ P   Y I + A+N +G  E +  I I     AP+GP   +     S   +++ W++P + L NGI + YQ+   E     N      +  +  DS    +D  N                        FT+Y   V   N  G  P ++ +   TLED P   P  +Q +  SP++  + + W+   +   NG++ G+ V Y+++    E  ++ KNV  T   L+L  L   + Y IQ+      G G  SE I   T E  P PP  +KA      +  VSW PP+K NG IR+Y  VF   P   + +S  E     +S+ + +       +V V+AVT+  +G      TV  L+     IL+FS ++       +VL C+ V  P   + ++   N       I G + + SNGS +I ++   D G Y C       S+EI  N+    + + P  P + ++K +++ I L W    NG       I  +++     N        +S + RS  + NL+CGT Y   L A+N  GP     I +A+T G  P+      +   I    +  NL  +  G GCP   + L+  P         G +VW     + L++   + + DL   T Y   +   N  G  + +A+  T     ST PP I
Sbjct:    6 LSLFQSFANVFSEEPHSSLYFVNAS-----------------LQEVVFASTSGTLVPCPAAGIPPVTLRWYLATGE-----EIYDVPGIRHVHPNGTLQIFPFPPSSFSTLIHDN--TYYCTAENPSGKIRSQDVHI-KAVLREPYTVRVEDQKTMRGNVAVFKCIIPSSVEAYVTVVS-WE----KDTVSLV----SGSRFLITSTGA---LYIKDVQNED-GLYNYRCITRHRYTGETRQSN---SARLFVSDPANSAPSILDGFDHRKAMAGQRVELP-CKALGHPEPDYRWLK----DNMPLELSGRFQKTVT----GLLIENSRPSDSGSYVCEV----SNRYGTAKVIGRLYVKQPLKATISPRKVKSSVGSQVSLSCSVTGNEDQELSWYRNGEILNPGKNVRI-TGLNHANLIMDHMVKSDGGAYQCFVR-----KDKLSAQDY--VQVVLEDGTPKII----------SAFSEKVVSPAEPVSLVCNVKGTPLPTVTWTLDDDPI------LKGSGHRISQMITSEGNV-VSYLNISSSQVRDGGVYRCTANNSAGVVLYQARINVRGPASIRPMKNITAIAGRDTYIHCRVIGYPYYSIKWYKNAN----LLPFNHRQVAFENNGTLKLSDVQKEVDEGEYTCNVLVQPQLSTSQSVHVTVKVPPFI-------------------------QP-------FEFPRFSIGQRV--FIPCVVVSGDLPITITWQK---------DGRPIPASLGVTID-NIDFTSSLRISNLSLMHNGNYTCIARNEAAAVEHQSQ-----LIVRVPPKFVVQPRDQDGIYGKAVILNCSAEGYPVPTIVWKFSKGAGVPQFQPIALNGRIQVLSNGSLLIKHVVEEDSGYYLCKVSNDVGAD-VSKSMYLTVKIPAMITSYPNTTLATQGQRKEMSCTAHGEKPIIVRW-EKED---------RIINP-EMARYLVSTKEVGEEVISTLQILPTVREDSGFFSCHAINSYGED--RGIIQLTVQEPPDPPEI--EIKDVKARTITLRWT-MGFDGNSPITGYDIECKNKSDSWDSAQRTKDVSPQLNSATIIDIHPSSTYSIRMYAKNRIGKSEPSNEITITADEAAPDGPPQEVHLEPTSSQSIRVTWKAPKKHLQNGIIRGYQIGYREYSTGGNFQFNIISIDTTGDSEVYTLDNLNK-----------------------FTQYGLVVQACNRAGTGPSSQEIITTTLEDVPSYPPENVQAIATSPES--ISISWSTLSKEALNGILQGFRVIYWANLIDGELGEI-KNVTTTQPSLELDGLEKYTNYSIQVLAFTRAGDGVRSEQIFTRTKEDVPGPPAGVKAAAASASMVFVSWLPPLKLNGIIRKY-TVFCSHPYPTV-ISEFEASPDSFSYRIPNLSRNRQYSVWVVAVTSAGRGNSSEIITVEPLAKAPARILTFSGTVTTPWMKDIVLPCKAVGDPSPAVKWMKDSNGTPSLVTIDGRRSIFSNGSFIIRTVKAEDSGYYSCVANNNWGSDEIILNL---QVQVPPDQPRLTVSKTTSSSITLSWLPGDNGGSS----IRGYILQYSEDNSEQWGSFPISPSERSYRLENLKCGTWYKFTLTAQNGVGPGRISEIIEAKTLGKEPQFSKEQELFASINTTRVRLNLIGWNDG-GCPITSFTLEYRP--------FGTTVWTTAQRTSLSK--SYILYDLQEATWYELQMRVCNSAGCAEKQANFATLNYDGSTIPPLI 1577          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Mouse
Match: Dscaml1 (DS cell adhesion molecule like 1 [Source:MGI Symbol;Acc:MGI:2150309])

HSP 1 Score: 285.804 bits (730), Expect = 7.768e-77
Identity = 407/1712 (23.77%), Postives = 672/1712 (39.25%), Query Frame = 3
Query:  258 VYCTATGNPSPKIKWYYETTQRNVFTEVND-PDRFVVGTNGDMDIF----------IQANIEVIYCKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRNIYTDIDVKSHDWISPKRLEDNSKIDFTSICQNIEV--------RVIKGSTLELPWCSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRL-PYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLN-NLKISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQISIDNLVFKESP-----PLDYSIVLGQSFALNCSAK---PTNIQLKTNWFXXXXXXXXXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKEDGNWDSLPVKRIKEKSK------VSRFFVKFESVTDSLFGEYKCVASNEHRKNGVERIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWKLVTENWFINATTKETSITIE-----DLRPFKEYDIAIVAENSVGYGEEAT-IIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSPAKY-VAIRTLEDKPEGTPIQVLC-SPKANFLFLEWNPPPQNVTNGVISGYEVTYFS---DDKHEEPDKLMKNVKET--HLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIK-AYFYQNCLKVSWTPPIKANGHIREYIIVFSFEPNNMITVSSRENDKPYYSWELCSEQICSNCNVSVLAVTTMKGPRKTVNVLSNKMG-----ILSFXXXXXXXXXXXXXLYCEVAFPDENIYYLWTHNDKD------IYGQG-VQSNGSLVINSMAESDQGIYKCKVKSEEITYNVSTKSISLV----PQTPYIEITKVSTNHIALLW--RSNGSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSN-PAISQAQTRGSIPEIPDTSNIVTEIGPHSMCFNLRAFRPGRGCPANKYILKLWPSSEGNHQESGVSVWKVVNDSDLNQIPCFNVTDLHPNTDYVYSIEASNMVGSQKAKAHNKTRQI-VSTAPP 5186
            V C A G+PS  ++WY  T       ++ D P    V  NG + +F          I  N    +C A+N  G +RS  I + K +  +   VR E +       AV  CL+  ++  Y+  V  WE       K  + I   E RF + +      L+I +V K D +    RCI +          H +    R  + +++  T   ++I           V  G ++ELP C+       A  W   +   R L   + S++   ++    L I ++   + G Y         +      + V+  + V + P  +       V L C  TG P  ++ W  N  E        +    S  + +        +G YQC A        R     Q    +++ +  P ++          S+   V+   G  F + C     P  TV W LDD+ +      + + ++R   YT+     I  S M     + + GG YR    N  G A     I V     IR   +IT   G +  + C VI     +I+W++DA    + LP+ H Q V E+G L + + V K +  G+Y+C+  +   L IS++  V +  PP++                         QP       +EF  A       L     ++  D+ I I ++K     +   +G+ +      F+     +I+ + +K+N        +C+  N A T+ +  Q     L+ +  P     P +   + G++  LNCS     P  +  K        +        +  RI  LPN +L+++++   D   ++C     VG D ISK + + +K+PA I + P+     + +   LNCT  G+  + ++W  K D   D   V R    +K      VS   +K     DS+F  + C A N + ++    +I L V + P    +  E     +RS+ + W     DG   IT + + +K  +++W    +T+  S TI      DL P   Y I + + N +G  E +  + I T+  AP+GP +++    V+   +++ W++P + L NG+ + YQ+   E     N         +  DS                        V T+  L  F +Y   V   N  G  P+   +   TLED P   P  V   S  ++   + W+ PP++  NGV+ GY V ++S   D +  E    M+NV  T   ++L  +   + Y +Q+      G G  S  +   T E  P PP  IK      + + VSW PP K NG IR+Y I  S   +     S  E       + +          + V AVT+      +  V     G     I+SF  ++       V L C  +  D      WT + +D      + G   + +NG+L++ ++   D G Y C   +   T    T  ++L+    P  P + ++K S + I L W    NG       I  F++     N    +++ +SS+ RS  + +L+CGT Y V L AKN  G      I +A+T G  P      ++ T I       NL+ +  G GCP    +L+  P         G   W+ V  +   ++    +T+L   T Y   + A N  G     A   T     ST PP
Sbjct:  103 VPCPAAGSPSAALRWYLATGD-----DIYDVPHIRHVHANGTLQLFPFSPSAFNSFIHDND--YFCTAENAAGKIRSPNIRI-KAVFREPYTVRVEDQRSMRGNVAVFKCLIPSSVQEYVSVVS-WE-------KDTVSI-TPENRFFITSHGG---LYISDVQKED-ALSTYRCITQ----------HKYSGETRQSNGARLSVTDPAESIPTILDGFHSQEVWTGHSVELP-CAASGYPIPAIRW---LKDGRPLP--ADSRW---AKRITGLTISDLRTEDSGTYICEVTNTFGSAEANGILTVIDPLHVTLTPKKLKTGIGSTVILSCALTGSPEFTIRWYRN-TELVLPGEAISIRGLSNETLLISSAQKSHSGAYQCFA-------TRKAQTAQDFAIIVLEDGTPRIV---------SSFSEKVVNP-GEQFSLMCAAKGAPPPTVTWALDDEPV------VRDGSHRTNQYTMSDGTTI--SHMNVTGPQIRDGGVYRCTARNSVGSAEYQARINVRGPPSIRAMRNITAVAGRDTLINCRVIGYPYYSIKWYKDA----LLLPDNHRQVVFENGTLKLTD-VQKGMDEGEYLCSVLIQPQLSISQSVHVAVKVPPLI-------------------------QP-------FEFPPASIGQL--LYIPCVVSSGDMPIRITWRK---DGQVIISGSGVTIESKEFM--SSLQISSVSLKHN-----GNYTCIASNAAATVSRERQ-----LIVRVPPRFVVQPNNQDGIYGKAGVLNCSVDGYPPPKVMWKHA--KGSGNPQQYHPVPLTGRIQILPNSSLLIRHVLEEDIGYYLCQASNGVGTD-ISKAMFLTVKIPAMITSHPNTTIAIKGHPKELNCTARGERPIIIRW-EKGDTVIDPDRVMRYAIATKDNGDEVVSTLKLKPADRGDSVF--FSCHAINSYGED--RGLIQLTVQEPPDPPEL--EIREVKARSMNLRWTQ-RFDGNSIITGFDIEYKNKSDSWDFKQSTRNISPTINQANIVDLHPASVYSIRMYSFNKIGRSEPSKELTISTEEAAPDGPPMDVTLQPVTSQSIQVTWKAPKKELQNGVIRGYQIGYRENSPGSNGQYSIVEMKATGDSE-----------------------VYTLDNLKKFAQYGVVVQAFNRAGTGPSSSEINATTLEDVPSQPPENVRALSITSDVAVISWSEPPRSTLNGVLKGYRVIFWSLYVDGEWGE----MQNVTTTRERVELRGMEKFTNYSVQVLAYTQAGDGVRSSVLYIQTKEDVPGPPAGIKAVPSSASSVVVSWLPPTKPNGVIRKYTIFCSSPGSGQPAPSEYETSPEQLFYRIAHLNRGQQYLLWVAAVTSAGRGNSSEKVTIEPAGKAPAKIISFGGTVTTPWMKDVRLPCN-SVGDPAPAVKWTKDSEDSAIPVSLDGHRLIHTNGTLLLRAVKAEDSGYYTCTATN---TGGFDTIIVNLLVQVPPDQPRLTVSKTSASSITLTWIPGDNGGSS----IRGFVLQYSVDNSEEWKDVFISSSERSFKLDSLKCGTWYKVKLAAKNSVGSGRISEIIEAKTHGREPSFSKDQHLFTHINSTHARLNLQGWNNG-GCPITAIVLEYRP--------KGTWAWQGVRANSSTEV---FLTELREATWYELRMRACNSAGCGNETAQFATLDYDGSTIPP 1636          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Mouse
Match: Sdk1 (sidekick cell adhesion molecule 1 [Source:MGI Symbol;Acc:MGI:2444413])

HSP 1 Score: 133.265 bits (334), Expect = 2.361e-30
Identity = 99/343 (28.86%), Postives = 163/343 (47.52%), Query Frame = 3
Query: 3138 PNSDGKKPITRYLVSWK-LVTENWFINATT---KETSITIEDLRPFKEYDIAIVAENSVGYGE--EATIIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSPAKY-VAIRTLEDKPEGTPIQVLCSP-KANFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKL-MKNVKETHLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIK-AYFYQNCLKVSWTPPIKANGHIREYIIVF 4136
            P SDG  PI  + V  + L    W   +++   + T+  +E LRPF  Y + + A N +G  +    T  + T  D P  P  ++ AT  +   V ++W+ P +  +NG+ + Y++   E+      S E     SP+     +  Q + +     +N   S     +T L  +  Y   +   N +G SPA   V +   E  P   P  V  +P  A+ L + W+PPP    NG I GY+V Y+  D   E +K+ +  + E  +K+ +L++++KY+I I   N  G GP S+P    T++AAP PP+ +  +      L VSW  P  ANG ++ Y +V+
Sbjct: 1223 PGSDGASPIRYFTVQVRELPGGEWQTYSSSISHEATACAVERLRPFTSYKLRLKATNDIGDSDFSAETEAVTTLQDVPGEPPGSVSATPHTTSSVLIQWQPPRDESLNGLLQGYRIYYRELESETGMSPEPKTLKSPSALRAELTAQSSFK----TVNSSSSLTTYELTHLKKYRRYEVIMTAYNIIGESPASVPVEVFVGEAAPAMAPQNVQVTPLTASQLEVTWDPPPPESQNGNIQGYKVYYWEADSRNETEKMKVLFLPEPVVKIKDLTSHTKYLISISAFNAAGDGPKSDPCQGRTHQAAPGPPSFLAFSEITSTTLNVSWGEPSAANGILQGYRVVY 1561          

HSP 2 Score: 89.3521 bits (220), Expect = 5.491e-17
Identity = 92/347 (26.51%), Postives = 140/347 (40.35%), Query Frame = 3
Query: 3147 DGKKPITRYLVSWKLVTEN---WFI---NATTKETSITIEDLRPFKEYDIAIVAENSVGYGEEATIIIKTQ--ADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSP-AKYVAIRTLEDKPEGTP--IQVLCSPKANFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHE-------EPDKLMKNVKETHLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIK-AYFYQNCLKVSWTPPIKANGHIREYII 4130
            DG  P+  Y+V    V+EN   W +   N   + T +T+  L P + Y   + A N VG G+ +T   +     + P  P  N++A+  +   + ++W+ P E   NG+ + Y      I   +   L                 +H  R     I+ PE    + VT+L+ +T+Y  +V   N  G    ++ V   TL+  P   P  +Q          FL WNPPPQ   NG+  GY++  +  D  E        PD     +   H  + NL   + Y   +      G GPPS P    T+E  P     +         LKVSW  P++ NG I  Y I
Sbjct:  417 DGNSPVLYYIVQ---VSENNSPWKVHLSNVGPEMTGVTVSGLTPARTYQFRVCAVNQVGKGQYSTETSRLMLPEEPPSAPPKNIVASGRTNQSIMVQWQPPPETEHNGVLRGY------ILRYRLAGLP---------------GEHQQR----NISSPEVNYCL-VTDLIIWTQYEIQVAAYNGAGLGVFSRAVTEYTLQGVPTAPPQNVQAEAVNSTTVHFL-WNPPPQQFINGINQGYKLLAWPADAPETVTVVTIAPD--FHGIH--HGYITNLKKFTAYFTSVLCFTTPGDGPPSSPQLVWTHEDKPGAVGHLSFTEILDTSLKVSWQEPLERNGIIMGYQI 729          

HSP 3 Score: 65.855 bits (159), Expect = 8.446e-10
Identity = 91/382 (23.82%), Postives = 153/382 (40.05%), Query Frame = 3
Query: 3138 PNSDGKKPITRYLVSWKLVT----ENWFI----NATTKETSITIEDLRPFKEYDIAIVAENSVGYG--EEATIIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSP-AKYVAIRTLEDKPEGTPIQVLCSP-KANFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNVKETHLKLYNLSANSKYII---QIRVKNNIGLGPPSEPINC-TTNEAAPDPPNEIKAYFYQ---NCLKVSWTPPIKANGHIREYIIVF---SFEPNNMITVSSRENDKPYYSWELCSE 4217
            P  DGK  I R++V  ++      E W              + I +L P+  Y   +   N VG     +++ +I+T    P+    +L   + S   ++L+W    +   NG             +S    ++ +    P+ +  +VV     R              +T+ EL  +TEY  R+   N +G  P ++ V  RT E  P   P  V      +  + L W   P+   NG+I GY+V Y + D   EP   +  V+  H +   L+   K+++   Q+     IG G PS P+    T +  P PP  ++  F +     +++ W PP + NG I  Y I +   S  P+   TV      + + + EL  E
Sbjct:  814 PGYDGKTAICRWIVEGQVGAIGDEEEWVTLYEEENEPDAQMLEIPNLTPYTHYRFRMRQVNIVGPSPFSQSSRVIQTLQAPPDVAPTSLTVRTASETSLRLRWVPLPDSQYNGNP-----------ESVGYRVKYWRSDQPSSALAQVVSDRLERE-------------LTIEELEEWTEYELRMQAFNAIGAGPWSELVRGRTRESVPSAAPENVSAEAVSSTQILLTWASVPEQDQNGLILGYKVLYCAKDLDPEPRSHV--VRGNHTQSALLAGLRKFVVYELQVLAFTRIGNGVPSSPLILERTKDDTPGPP--VRLVFPEVRLTAVRIVWQPPEEPNGVILGYQIAYRLASGSPHTFTTVEVGATVRQFTATELAPE 1167          

HSP 4 Score: 59.6918 bits (143), Expect = 5.806e-8
Identity = 54/206 (26.21%), Postives = 87/206 (42.23%), Query Frame = 3
Query: 3513 FAWPSPNDSTTRV------VDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSPAKYVAIRTL--EDKPEGTPIQVLCSPKAN-FLFLEWNPPPQNVTNGVISGYEVTY-FSDDKHEEPDKLMKNVKETHLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPD-PPNEIKA-YFYQNCLKVSWTPP 4094
             +W  P D  + V      V ++N   K    NV      +TV+ L     Y FRV  VN VG         R +  E+ P   P  ++ S + N  + ++W PPP+   NGV+ GY + Y  +    E   + + + +  +  + +L   ++Y IQ+   N  GLG  S  +   T +  P  PP  ++A       +   W PP
Sbjct:  410 LSWVRPFDGNSPVLYYIVQVSENNSPWKVHLSNVGPEMTGVTVSGLTPARTYQFRVCAVNQVGKGQYSTETSRLMLPEEPPSAPPKNIVASGRTNQSIMVQWQPPPETEHNGVLRGYILRYRLAGLPGEHQQRNISSPEVNYCLVTDLIIWTQYEIQVAAYNGAGLGVFSRAVTEYTLQGVPTAPPQNVQAEAVNSTTVHFLWNPP 615          

HSP 5 Score: 58.9214 bits (141), Expect = 9.298e-8
Identity = 91/371 (24.53%), Postives = 156/371 (42.05%), Query Frame = 3
Query: 3228 ETSITIEDLRPFKEYDIAIVAENSVGYGEEATIII-KTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQV--CSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSPAKYVAIRTLEDKPEGTPIQ-VLCSPKANFLFLEWNPPPQNVTNGVISGYEVTY-FSDDKHEEPDKLMKNVKETHLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNE-AAPDPPNEI---KAYFYQNCLKVSWTPPIKANGHIREYII-----------VFSFEPNNMITVSSRENDKPYYSWEL---CSEQIC-SNCNVSVLAVTTMK 4268
            E  +TIE+L  + EY++ + A N++G G  + ++  +T+   P     N+ A +VS  ++ L W S  E   NG+   Y+V  C+ ++ D + RS                V + NH   +S +       V+   ++L FT       + N V  SP   +  RT +D P G P++ V    +   + + W PP +   NGVI GY++ Y  +         +             L+  S YI ++  K   G G P E    TT +   P PP E+   +A      L++ W P       IR + +            +S   ++  T  + E  +P+ S++L    +  I  S+ +    AVTT++
Sbjct:  956 ERELTIEELEEWTEYELRMQAFNAIGAGPWSELVRGRTRESVPSAAPENVSAEAVSSTQILLTWASVPEQDQNGLILGYKVLYCAKDL-DPEPRSH---------------VVRGNH--TQSALLAGLRKFVVYELQVLAFTR------IGNGVPSSP--LILERTKDDTP-GPPVRLVFPEVRLTAVRIVWQPPEE--PNGVILGYQIAYRLASGSPHTFTTVEVGATVRQFTATELAPESAYIFRLSAKTRQGWGEPLEATVITTEKRERPAPPRELLVPQAEVTARSLRLQWVPGSDGASPIRYFTVQVRELPGGEWQTYSSSISHEATACAVERLRPFTSYKLRLKATNDIGDSDFSAETEAVTTLQ 1297          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Mouse
Match: Sdk1 (sidekick cell adhesion molecule 1 [Source:MGI Symbol;Acc:MGI:2444413])

HSP 1 Score: 133.265 bits (334), Expect = 2.751e-30
Identity = 99/343 (28.86%), Postives = 163/343 (47.52%), Query Frame = 3
Query: 3138 PNSDGKKPITRYLVSWK-LVTENWFINATT---KETSITIEDLRPFKEYDIAIVAENSVGYGE--EATIIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSPAKY-VAIRTLEDKPEGTPIQVLCSP-KANFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKL-MKNVKETHLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIK-AYFYQNCLKVSWTPPIKANGHIREYIIVF 4136
            P SDG  PI  + V  + L    W   +++   + T+  +E LRPF  Y + + A N +G  +    T  + T  D P  P  ++ AT  +   V ++W+ P +  +NG+ + Y++   E+      S E     SP+     +  Q + +     +N   S     +T L  +  Y   +   N +G SPA   V +   E  P   P  V  +P  A+ L + W+PPP    NG I GY+V Y+  D   E +K+ +  + E  +K+ +L++++KY+I I   N  G GP S+P    T++AAP PP+ +  +      L VSW  P  ANG ++ Y +V+
Sbjct: 1483 PGSDGASPIRYFTVQVRELPGGEWQTYSSSISHEATACAVERLRPFTSYKLRLKATNDIGDSDFSAETEAVTTLQDVPGEPPGSVSATPHTTSSVLIQWQPPRDESLNGLLQGYRIYYRELESETGMSPEPKTLKSPSALRAELTAQSSFKT----VNSSSSLTTYELTHLKKYRRYEVIMTAYNIIGESPASVPVEVFVGEAAPAMAPQNVQVTPLTASQLEVTWDPPPPESQNGNIQGYKVYYWEADSRNETEKMKVLFLPEPVVKIKDLTSHTKYLISISAFNAAGDGPKSDPCQGRTHQAAPGPPSFLAFSEITSTTLNVSWGEPSAANGILQGYRVVY 1821          

HSP 2 Score: 88.9669 bits (219), Expect = 6.976e-17
Identity = 92/347 (26.51%), Postives = 140/347 (40.35%), Query Frame = 3
Query: 3147 DGKKPITRYLVSWKLVTEN---WFI---NATTKETSITIEDLRPFKEYDIAIVAENSVGYGEEATIIIKTQ--ADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSP-AKYVAIRTLEDKPEGTP--IQVLCSPKANFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHE-------EPDKLMKNVKETHLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIK-AYFYQNCLKVSWTPPIKANGHIREYII 4130
            DG  P+  Y+V    V+EN   W +   N   + T +T+  L P + Y   + A N VG G+ +T   +     + P  P  N++A+  +   + ++W+ P E   NG+ + Y      I   +   L                 +H  R     I+ PE    + VT+L+ +T+Y  +V   N  G    ++ V   TL+  P   P  +Q          FL WNPPPQ   NG+  GY++  +  D  E        PD     +   H  + NL   + Y   +      G GPPS P    T+E  P     +         LKVSW  P++ NG I  Y I
Sbjct:  677 DGNSPVLYYIVQ---VSENNSPWKVHLSNVGPEMTGVTVSGLTPARTYQFRVCAVNQVGKGQYSTETSRLMLPEEPPSAPPKNIVASGRTNQSIMVQWQPPPETEHNGVLRGY------ILRYRLAGLP---------------GEHQQR----NISSPEVNYCL-VTDLIIWTQYEIQVAAYNGAGLGVFSRAVTEYTLQGVPTAPPQNVQAEAVNSTTVHFL-WNPPPQQFINGINQGYKLLAWPADAPETVTVVTIAPD--FHGIH--HGYITNLKKFTAYFTSVLCFTTPGDGPPSSPQLVWTHEDKPGAVGHLSFTEILDTSLKVSWQEPLERNGIIMGYQI 989          

HSP 3 Score: 65.855 bits (159), Expect = 8.395e-10
Identity = 91/382 (23.82%), Postives = 153/382 (40.05%), Query Frame = 3
Query: 3138 PNSDGKKPITRYLVSWKLVT----ENWFI----NATTKETSITIEDLRPFKEYDIAIVAENSVGYG--EEATIIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSP-AKYVAIRTLEDKPEGTPIQVLCSP-KANFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNVKETHLKLYNLSANSKYII---QIRVKNNIGLGPPSEPINC-TTNEAAPDPPNEIKAYFYQ---NCLKVSWTPPIKANGHIREYIIVF---SFEPNNMITVSSRENDKPYYSWELCSE 4217
            P  DGK  I R++V  ++      E W              + I +L P+  Y   +   N VG     +++ +I+T    P+    +L   + S   ++L+W    +   NG             +S    ++ +    P+ +  +VV     R              +T+ EL  +TEY  R+   N +G  P ++ V  RT E  P   P  V      +  + L W   P+   NG+I GY+V Y + D   EP   +  V+  H +   L+   K+++   Q+     IG G PS P+    T +  P PP  ++  F +     +++ W PP + NG I  Y I +   S  P+   TV      + + + EL  E
Sbjct: 1074 PGYDGKTAICRWIVEGQVGAIGDEEEWVTLYEEENEPDAQMLEIPNLTPYTHYRFRMRQVNIVGPSPFSQSSRVIQTLQAPPDVAPTSLTVRTASETSLRLRWVPLPDSQYNGNP-----------ESVGYRVKYWRSDQPSSALAQVVSDRLERE-------------LTIEELEEWTEYELRMQAFNAIGAGPWSELVRGRTRESVPSAAPENVSAEAVSSTQILLTWASVPEQDQNGLILGYKVLYCAKDLDPEPRSHV--VRGNHTQSALLAGLRKFVVYELQVLAFTRIGNGVPSSPLILERTKDDTPGPP--VRLVFPEVRLTAVRIVWQPPEEPNGVILGYQIAYRLASGSPHTFTTVEVGATVRQFTATELAPE 1427          

HSP 4 Score: 59.6918 bits (143), Expect = 6.422e-8
Identity = 54/206 (26.21%), Postives = 87/206 (42.23%), Query Frame = 3
Query: 3513 FAWPSPNDSTTRV------VDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSPAKYVAIRTL--EDKPEGTPIQVLCSPKAN-FLFLEWNPPPQNVTNGVISGYEVTY-FSDDKHEEPDKLMKNVKETHLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPD-PPNEIKA-YFYQNCLKVSWTPP 4094
             +W  P D  + V      V ++N   K    NV      +TV+ L     Y FRV  VN VG         R +  E+ P   P  ++ S + N  + ++W PPP+   NGV+ GY + Y  +    E   + + + +  +  + +L   ++Y IQ+   N  GLG  S  +   T +  P  PP  ++A       +   W PP
Sbjct:  670 LSWVRPFDGNSPVLYYIVQVSENNSPWKVHLSNVGPEMTGVTVSGLTPARTYQFRVCAVNQVGKGQYSTETSRLMLPEEPPSAPPKNIVASGRTNQSIMVQWQPPPETEHNGVLRGYILRYRLAGLPGEHQQRNISSPEVNYCLVTDLIIWTQYEIQVAAYNGAGLGVFSRAVTEYTLQGVPTAPPQNVQAEAVNSTTVHFLWNPP 875          

HSP 5 Score: 58.9214 bits (141), Expect = 9.454e-8
Identity = 91/371 (24.53%), Postives = 156/371 (42.05%), Query Frame = 3
Query: 3228 ETSITIEDLRPFKEYDIAIVAENSVGYGEEATIII-KTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQV--CSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSPAKYVAIRTLEDKPEGTPIQ-VLCSPKANFLFLEWNPPPQNVTNGVISGYEVTY-FSDDKHEEPDKLMKNVKETHLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNE-AAPDPPNEI---KAYFYQNCLKVSWTPPIKANGHIREYII-----------VFSFEPNNMITVSSRENDKPYYSWEL---CSEQIC-SNCNVSVLAVTTMK 4268
            E  +TIE+L  + EY++ + A N++G G  + ++  +T+   P     N+ A +VS  ++ L W S  E   NG+   Y+V  C+ ++ D + RS                V + NH   +S +       V+   ++L FT       + N V  SP   +  RT +D P G P++ V    +   + + W PP +   NGVI GY++ Y  +         +             L+  S YI ++  K   G G P E    TT +   P PP E+   +A      L++ W P       IR + +            +S   ++  T  + E  +P+ S++L    +  I  S+ +    AVTT++
Sbjct: 1216 ERELTIEELEEWTEYELRMQAFNAIGAGPWSELVRGRTRESVPSAAPENVSAEAVSSTQILLTWASVPEQDQNGLILGYKVLYCAKDL-DPEPRSH---------------VVRGNH--TQSALLAGLRKFVVYELQVLAFTR------IGNGVPSSP--LILERTKDDTP-GPPVRLVFPEVRLTAVRIVWQPPEE--PNGVILGYQIAYRLASGSPHTFTTVEVGATVRQFTATELAPESAYIFRLSAKTRQGWGEPLEATVITTEKRERPAPPRELLVPQAEVTARSLRLQWVPGSDGASPIRYFTVQVRELPGGEWQTYSSSISHEATACAVERLRPFTSYKLRLKATNDIGDSDFSAETEAVTTLQ 1557          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Mouse
Match: Dcc (deleted in colorectal carcinoma [Source:MGI Symbol;Acc:MGI:94869])

HSP 1 Score: 110.538 bits (275), Expect = 1.633e-23
Identity = 131/539 (24.30%), Postives = 212/539 (39.33%), Query Frame = 3
Query: 2643 LPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKEDGNWDSLPVKRIKEKSKVSRFFVKFESVTDSLFGEYKCVASNEHRKNGVERIILLNVVDVPGKVVIKNEXXXX-----XXXXXXXXWNPPNSDGKKPITRYLVSWKLVTENW--FINATTKET-SITIEDLRPFKEYDIAIVAENSVGYGEEATII-IKTQADAP-EGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFS-PAKYVAIRTLEDKPEGTPIQV-LCSPKANFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNVKETHLKLYNLSANSKYIIQIRVKNNIGLGPPSE------PINCTTNEAAPDPPNEIKAYFYQNCLKVSWTPPIKANGHIREYIIVFSFEPNNMITVSSRENDKPYYSWE 4205
            L    L++ N+   D   + C++      + IS   ++ + VP   LN P  +    + +    C V G     V W +  D     +P    +    V    ++   V  S  G Y+CVA NE         +++    +P   ++ +           SR + +SW PP ++ K  I  + V +    +N    +N T   +  +T+ +L+P   Y   +VA N  G GE +  I + TQ +    GPV NL A S S   + + WE P     NG  + Y++   E+   + +++E              VD  +++++                 L  FTEY  R +  N  G       + + TL D P   P  + L    +  + + W PPP    NG I+GY++ +    +  E + L  N          L   S+Y  Q+      G GPPS       P N       PD P+ +      NC+ +SWTPP+  N  +R YII +        TV      + YYS E
Sbjct:  290 LGGSNLLISNVTDDDSGTYTCVV--TYKNENISASAELTVLVPPWFLNHPSNLYAYESMDIEFECAVSGKPVPTVNWMKNGD---VVIPSDYFQ---IVGGSNLRILGVVKSDEGFYQCVAENEAGNAQSSAQLIVPKPAIPSSSILPSAPRDVLPVLVSSRFVRLSWRPP-AEAKGNIQTFTVFFSREGDNRERALNTTQPGSLQLTVGNLKPEAMYTFRVVAYNEWGPGESSQPIKVATQPELQVPGPVENLHAVSTSPTSILITWEPP--AYANGPVQGYRLFCTEVSTGKEQNIE--------------VDGLSYKLEG----------------LKKFTEYTLRFLAYNRYGPGVSTDDITVVTLSDVPSAPPQNISLEVVNSRSIKVSWLPPPSGTQNGFITGYKIRHRKTTRRGEMETLEPN--NLWYLFTGLEKGSQYSFQVSAMTVNGTGPPSNWYTAETPENDLDESQVPDQPSSLHVRPQTNCIIMSWTPPLNPNIVVRGYIIGYGVGSPYAETVRVDSKQR-YYSIE 784          

HSP 2 Score: 53.1434 bits (126), Expect = 5.763e-6
Identity = 64/274 (23.36%), Postives = 111/274 (40.51%), Query Frame = 3
Query: 3210 INATTKETSITIEDLRPFKEYDIAIVAENSVGYG----EEATIIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSPAKYVA-IRTLEDKPEGTPIQVLC---SPKANFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNVKETHL--KLYNLSANSKYIIQIRVKNNIGLGPPSEPI 4001
            +   +K+   +IE L     Y I++ A N+ G G    E AT    T    P  P + + A +++ + V++ W        N + K+ +   + +Y  + R+    +    ++ TT                    +L  T T L   T Y F V++  N   S     A   T E  P   P  +       K   + + W PP +   NG I+ Y + Y  D      D +M+ +    L  ++ +LS ++ Y  +I+ +N  G+GP S+PI
Sbjct:  772 VRVDSKQRYYSIERLESSSHYVISLKAFNNAGEGVPLYESATTRSITDVSTPMLPPVGVQAVALTHEAVRVSWAD------NSVPKNQKTSDVRLYTVRWRTSFSASAKYKSEDTT--------------------SLSYTATGLKPNTMYEFSVMVTKNRRSSTWSMTAHATTYEAAPTSAPKDLTVITREGKPRAVIVSWQPPLE--ANGKITAYILFYTLDKNIPIDDWIMETISGDRLTHQIMDLSLDTMYYFRIQARNVKGVGPLSDPI 1017          
BLAST of Down syndrome cell adhesion molecule vs. UniProt/SwissProt
Match: sp|O60469|DSCAM_HUMAN (Down syndrome cell adhesion molecule OS=Homo sapiens OX=9606 GN=DSCAM PE=1 SV=2)

HSP 1 Score: 307.76 bits (787), Expect = 9.200e-83
Identity = 431/1767 (24.39%), Postives = 705/1767 (39.90%), Query Frame = 3
Query:   93 LCHFITFKNVNSFDHKSFFFFLNRHKRYAEERNLEPPKLINVQKSFVTTMTDHSRVYCTATGNPSPKIKWYYETTQRNVFTEVND-PDRFVVGTNGDMDIF----------IQANIEVIYCKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRNIYTDIDVKSHDWISPKRLEDNSKIDFTSICQNIEVR-VIKGSTLELPWCSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTV----VNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLN-NLKISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQISIDNLVFKESP-----PLDYSIVLGQSFALNCSAKPTNIQLKTNWFXXXXXXXXXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKEDGNWDSLPVKRIKEKSKVSRFFVKFESVTDSLF-------------GEYKCVASNEHRKNGVERIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWKLVTENWFINATTKET-----SITIEDLRPFKEYDIAIVAENSVGYGEEAT-IIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSP-AKYVAIRTLEDKPEGTP--IQVLC-SPKANFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNVKETH--LKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIKAYFYQNCLK-VSWTPPIKANGHIREYIIVFSFEPNNMITVSSRENDKPYYSWELCSEQICSNCNVSVLAVTTM-KGPRK---TVNVLSNKMG-ILSFXXXXXXXXXXXXXLYCE-VAFPDENIYYLWTHNDK----DIYG-QGVQSNGSLVINSMAESDQGIYKCKV----KSEEITYNVSTKSISLVPQTPYIEITKVSTNHIALLW--RSNGSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSN-PAISQAQTRGSIPEIPDTSNIVTEIGPHSMCFNLRAFRPGRGCPANKYILKLWPSSEGNHQESGVSVWKVVNDSDLNQIPCFNVTDLHPNTDYVYSIEASNMVGSQKAKAHNKTRQI-VSTAPPNI 5192
            L  F +F NV S D  S  +F+N                    +  V   T  + V C A G P   ++WY  T +     E+ D P    V  NG + IF          I  N    YC A+N  G +RS+ + + K +  +   VR E ++      AV  C++  ++ AYI  V  WE     D+  ++    +  RF + +      L+I++V   D      RCI R+ YT    +S+   S +    +      SI    + R  + G  +ELP C    + +  + W          + LSG   K ++     LLI+NI  ++ G Y        SN Y T  V   + V   +K T+    V +     V L C  TG     L W  NG   N  K+    T  +  + I   +     G YQC        ++++ ++D   V V++ +  P +I          S  +  + +      + C     P  T+ W LDD  I      +   ++R+   + +   + +S +     + + GG YR    N  G       I V     IR   +IT   G +  + C VI     +I+W++++      LP  H Q   E+     +  V K +  G+Y CN  +   L  S++  VT+  PP +                         QP       +EF        V       +   DL I I +QK         +G  +P G         +  + + I     +H    +C+ +N A  +    Q     L+ +  P     P D   + G++  LNCSA+   +      F+  +         +  RI  L NG+L++K++   D   ++C +   VG D +SK + + +K+PA I + P+     +  +  ++CT HG+  + V+W  KED         RI    +++R+ V  + V + +              G + C A N + ++    II L V + P    I  E     +R+I + W     DG  PIT Y +  K  +++W     TK+      S TI D+ P   Y I + A+N +G  E +  + I     AP+GP   +    +S   +++ W++P + L NGI + YQ+   E     N      +  +  DS    +D  N                        FT+Y   V   N  G  P ++ +   TLED P   P  +Q +  SP++  + + W+   +   NG++ G+ V Y+++    E  ++ KN+  T   L+L  L   + Y IQ+      G G  SE I   T E  P PP  +KA      +  VSW PP+K NG IR+Y  VF   P   + +S  E     +S+ + +       +V V+AVT+  +G      TV  L+     IL+FS ++       +VL C+ V  P   + ++   N       I G + + SNGS +I ++   D G Y C       S+EI  N+    + + P  P + ++K +++ I L W    NG       I  +++     N        +S + RS  + NL+CGT Y   L A+N  GP     I +A+T G  P+      +   I    +  NL  +  G GCP   + L+  P         G +VW     + L++   + + DL   T Y   +   N  G  + +A+  T     ST PP I
Sbjct:    6 LSLFQSFANVFSEDLHSSLYFVNAS-----------------LQEVVFASTTGTLVPCPAAGIPPVTLRWYLATGE-----EIYDVPGIRHVHPNGTLQIFPFPPSSFSTLIHDN--TYYCTAENPSGKIRSQDVHI-KAVLREPYTVRVEDQKTMRGNVAVFKCIIPSSVEAYITVVS-WE----KDTVSLV----SGSRFLITSTGA---LYIKDVQNED-GLYNYRCITRHRYTGETRQSN---SARLFVSDPANSAPSILDGFDHRKAMAGQRVELP-CKALGHPEPDYRWLK----DNMPLELSGRFQKTVT----GLLIENIRPSDSGSYVCEV----SNRYGTAKVIGRLYVKQPLKATISPRKVKSSVGSQVSLSCSVTGTEDQELSWYRNGEILNPGKNVRI-TGINHENLIMDHMVKSDGGAYQCFVR-----KDKLSAQDY--VQVVLEDGTPKII----------SAFSEKVVSPAEPVSLMCNVKGTPLPTITWTLDDDPI------LKGGSHRISQMITSEGNV-VSYLNISSSQVRDGGVYRCTANNSAGVVLYQARINVRGPASIRPMKNITAIAGRDTYIHCRVIGYPYYSIKWYKNSN----LLPFNHRQVAFENNGTLKLSDVQKEVDEGEYTCNVLVQPQLSTSQSVHVTVKVPPFI-------------------------QP-------FEFPRFSIGQRV--FIPCVVVSGDLPITITWQK---------DGRPIP-GSLGVTIDNIDFTSSLRISNLSLMHNGNYTCIARNEAAAVEHQSQ-----LIVRVPPKFVVQPRDQDGIYGKAVILNCSAEGYPVPTIVWKFSKGAGVPQFQPIALNGRIQVLSNGSLLIKHVVEEDSGYYLCKVSNDVGAD-VSKSMYLTVKIPAMITSYPNTTLATQGQKKEMSCTAHGEKPIIVRW-EKED---------RIINP-EMARYLVSTKEVGEEVISTLQILPTVREDSGFFSCHAINSYGED--RGIIQLTVQEPPDPPEI--EIKDVKARTITLRWT-MGFDGNSPITGYDIECKNKSDSWDSAQRTKDVSPQLNSATIIDIHPSSTYSIRMYAKNRIGKSEPSNELTITADEAAPDGPPQEVHLEPISSQSIRVTWKAPKKHLQNGIIRGYQIGYREYSTGGNFQFNIISVDTSGDSEVYTLDNLNK-----------------------FTQYGLVVQACNRAGTGPSSQEIITTTLEDVPSYPPENVQAIATSPES--ISISWSTLSKEALNGILQGFRVIYWANLMDGELGEI-KNITTTQPSLELDGLEKYTNYSIQVLAFTRAGDGVRSEQIFTRTKEDVPGPPAGVKAAAASASMVFVSWLPPLKLNGIIRKY-TVFCSHPYPTV-ISEFEASPDSFSYRIPNLSRNRQYSVWVVAVTSAGRGNSSEIITVEPLAKAPARILTFSGTVTTPWMKDIVLPCKAVGDPSPAVKWMKDSNGTPSLVTIDGRRSIFSNGSFIIRTVKAEDSGYYSCIANNNWGSDEIILNL---QVQVPPDQPRLTVSKTTSSSITLSWLPGDNGGSS----IRGYILQYSEDNSEQWGSFPISPSERSYRLENLKCGTWYKFTLTAQNGVGPGRISEIIEAKTLGKEPQFSKEQELFASINTTRVRLNLIGWNDG-GCPITSFTLEYRP--------FGTTVWTTAQRTSLSK--SYILYDLQEATWYELQMRVCNSAGCAEKQANFATLNYDGSTIPPLI 1577          
BLAST of Down syndrome cell adhesion molecule vs. UniProt/SwissProt
Match: sp|Q8VHZ8|DSCAM_RAT (Down syndrome cell adhesion molecule homolog OS=Rattus norvegicus OX=10116 GN=Dscam PE=1 SV=1)

HSP 1 Score: 305.064 bits (780), Expect = 6.481e-82
Identity = 432/1767 (24.45%), Postives = 703/1767 (39.78%), Query Frame = 3
Query:   93 LCHFITFKNVNSFDHKSFFFFLNRHKRYAEERNLEPPKLINVQKSFVTTMTDHSRVYCTATGNPSPKIKWYYETTQRNVFTEVND-PDRFVVGTNGDMDIF----------IQANIEVIYCKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRNIYTDIDVKSHDWISPKRLEDNSKIDFTSICQNIEVR-VIKGSTLELPWCSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTV----VNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLN-NLKISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQISIDNLVFKESP-----PLDYSIVLGQSFALNCSAKPTNIQLKTNWFXXXXXXXXXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKEDGNWDSLPVKRIKEKSKVSRFFVKFESVTDSLF-------------GEYKCVASNEHRKNGVERIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWKLVTENWFINATTKET-----SITIEDLRPFKEYDIAIVAENSVGYGEEAT-IIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSP-AKYVAIRTLEDKPEGTP--IQVLC-SPKANFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNVKETH--LKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIKAYFYQNCLK-VSWTPPIKANGHIREYIIVFSFEPNNMITVSSRENDKPYYSWELCSEQICSNCNVSVLAVTTM-KGPRK---TVNVLSNKMG-ILSFXXXXXXXXXXXXXLYCE-VAFPDENIYYLWTHNDK----DIYG-QGVQSNGSLVINSMAESDQGIYKCKV----KSEEITYNVSTKSISLVPQTPYIEITKVSTNHIALLW--RSNGSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSN-PAISQAQTRGSIPEIPDTSNIVTEIGPHSMCFNLRAFRPGRGCPANKYILKLWPSSEGNHQESGVSVWKVVNDSDLNQIPCFNVTDLHPNTDYVYSIEASNMVGSQKAKAHNKTRQI-VSTAPPNI 5192
            L  F +F NV S +  S  +F+N                    +  V   T  + V C A G P   ++WY  T +     E+ D P    V  NG + IF          I  N    YC A+N  G +RS+ + + K +  +   VR E ++      AV  C++  ++ AY+  V  WE     D+  ++    +  RF + +      L+I++V   D      RCI R+ YT    +S+   S +    +      SI    + R  + G  +ELP C    + +  + W          + LSG   K ++     LLI+N   ++ G Y        SN Y T  V   + V   +K T+    V +     V L C  TG     L W  NG   N  K+    T  +  + I   +     G YQC        ++++ ++D   V V++ +  P +I          S  +  + +      + C     P  TV W LDD  I      +  + +R+   + +   + +S +     + + GG YR    N  G       I V     IR   +IT   G +  + C VI     +I+W+++A      LP  H Q   E+     +  V K +  G+Y CN  +   L  S++  VT+  PP +                         QP       +EF        V       +   DL I I +QK         +G  +P  +   +    +  + + I     +H    +C+ +N A  +    Q     L+ +  P     P D   + G++  LNCSA+   +      F+  +         +  RI  L NG+L++K++   D   ++C +   VG D +SK + + +K+PA I + P+     +     ++CT HG+  + V+W  KED         RI    +++R+ V  + V + +              G + C A N + ++    II L V + P    I  E     +R+I + W     DG  PIT Y +  K  +++W     TK+      S TI D+ P   Y I + A+N +G  E +  I I     AP+GP   +     S   +++ W++P + L NGI + YQ+   E     N      +  +  DS    +D  N                        FT+Y   V   N  G  P ++ +   TLED P   P  +Q +  SP++  + + W+   +   NG++ G+ V Y+++    E  ++ KNV  T   L+L  L   + Y IQ+      G G  SE I   T E  P PP  +KA      +  VSW PP+K NG IR+Y  VF   P   + +S  E     +S+ + +       +V V+AVT+  +G      TV  L+     IL+FS ++       +VL C+ V  P   + ++   N       I G + + SNGS VI ++   D G Y C       S+EI  N+    + + P  P + ++K +++ I L W    NG       I  +++     N        +S + RS  + NL+CGT Y   L A+N  GP     I +A+T G  P+      +   I    +  NL  +  G GCP   + L+  P         G +VW     + L++   + + DL   T Y   +   N  G  + +A+  T     ST PP I
Sbjct:    6 LSLFQSFANVFSEEPHSSLYFVNAS-----------------LQEVVFASTSGTLVPCPAAGIPPVTLRWYLATGE-----EIYDVPGIRHVHPNGTLQIFPFPPSSFSTLIHDN--TYYCTAENPSGKIRSQDVHI-KAVLREPYTVRVEDQKTMRGNVAVFKCIIPSSVEAYVTVVS-WE----KDTVSLV----SGSRFLITSTGA---LYIKDVQNED-GLYNYRCITRHRYTGETRQSN---SARLFVSDPANSAPSILDGFDHRKAMAGQRVELP-CKALGHPEPDYRWLK----DNMPLELSGRFQKTVT----GLLIENSRPSDSGSYVCEV----SNRYGTAKVIGRLYVKQPLKATISPRKVKSSVGSQVSLSCSVTGNEDQELSWYRNGEILNPGKNVRI-TGLNHANLIMDHMVKSDGGAYQCFVR-----KDKLSAQDY--VQVVLEDGTPKII----------SAFSEKVVSPAEPVSLVCNVKGTPLPTVTWTLDDDPI------LKGSGHRISQMITSEGNV-VSYLNISSSQVRDGGVYRCTANNSAGVVLYQARINVRGPASIRPMKNITAIAGRDTYIHCRVIGYPYYSIKWYKNAN----LLPFNHRQVAFENNGTLKLSDVQKEVDEGEYTCNVLVQPQLSTSQSVHVTVKVPPFI-------------------------QP-------FEFPRFSIGQRV--FIPCVVVSGDLPITITWQK---------DGRPIPASLGVTID-NIDFTSSLRISNLSLMHNGNYTCIARNEAAAVEHQSQ-----LIVRVPPKFVVQPRDQDGIYGKAVILNCSAEGYPVPTIVWKFSKGAGVPQFQPIALNGRIQVLSNGSLLIKHVVEEDSGYYLCKVSNDVGAD-VSKSMYLTVKIPAMITSYPNTTLATQGQRKEMSCTAHGEKPIIVRW-EKED---------RIINP-EMARYLVSTKEVGEEVISTLQILPTVREDSGFFSCHAINSYGED--RGIIQLTVQEPPDPPEI--EIKDVKARTITLRWT-MGFDGNSPITGYDIECKNKSDSWDSAQRTKDVSPQLNSATIIDIHPSSTYSIRMYAKNRIGKSEPSNEITITADEAAPDGPPQEVHLEPTSSQSIRVTWKAPKKHLQNGIIRGYQIGYREYSTGGNFQFNIISIDTTGDSEVYTLDNLNK-----------------------FTQYGLVVQACNRAGTGPSSQEIITTTLEDVPSYPPENVQAIATSPES--ISISWSTLSKEALNGILQGFRVIYWANLIDGELGEI-KNVTTTQPSLELDGLEKYTNYSIQVLAFTRAGDGVRSEQIFTRTKEDVPGPPAGVKAAAASASMVFVSWLPPLKLNGIIRKY-TVFCSHPYPTV-ISEFEASPDSFSYRIPNLSRNRQYSVWVVAVTSAGRGNSSEIITVEPLAKAPARILTFSGTVTTPWMKDIVLPCKAVGDPSPAVKWMKDSNGTPSLVTIDGRRSIFSNGSFVIRTVKAEDSGYYSCVANNNWGSDEIILNL---QVQVPPDQPRLTVSKTTSSSITLSWLPGDNGGSS----IRGYILQYSEDNSEQWGSFPISPSERSYRLENLKCGTWYKFTLTAQNGVGPGRISEIIEAKTLGKEPQFSKEQELFASINTTRVRLNLIGWNDG-GCPITSFTLEYRP--------FGTTVWTTAQRTSLSK--SYILYDLQEATWYELQMRVCNSAGCAEKQANFATLNYDGSTIPPLI 1577          
BLAST of Down syndrome cell adhesion molecule vs. UniProt/SwissProt
Match: sp|Q9ERC8|DSCAM_MOUSE (Down syndrome cell adhesion molecule homolog OS=Mus musculus OX=10090 GN=Dscam PE=1 SV=1)

HSP 1 Score: 304.679 bits (779), Expect = 9.036e-82
Identity = 431/1767 (24.39%), Postives = 703/1767 (39.78%), Query Frame = 3
Query:   93 LCHFITFKNVNSFDHKSFFFFLNRHKRYAEERNLEPPKLINVQKSFVTTMTDHSRVYCTATGNPSPKIKWYYETTQRNVFTEVND-PDRFVVGTNGDMDIF----------IQANIEVIYCKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRNIYTDIDVKSHDWISPKRLEDNSKIDFTSICQNIEVR-VIKGSTLELPWCSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTV----VNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLN-NLKISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQISIDNLVFKESP-----PLDYSIVLGQSFALNCSAKPTNIQLKTNWFXXXXXXXXXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKEDGNWDSLPVKRIKEKSKVSRFFVKFESVTDSLF-------------GEYKCVASNEHRKNGVERIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWKLVTENWFINATTKET-----SITIEDLRPFKEYDIAIVAENSVGYGEEAT-IIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSP-AKYVAIRTLEDKPEGTP--IQVLC-SPKANFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNVKETH--LKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIKAYFYQNCLK-VSWTPPIKANGHIREYIIVFSFEPNNMITVSSRENDKPYYSWELCSEQICSNCNVSVLAVTTM-KGPRK---TVNVLSNKMG-ILSFXXXXXXXXXXXXXLYCE-VAFPDENIYYLWTHNDK----DIYG-QGVQSNGSLVINSMAESDQGIYKCKV----KSEEITYNVSTKSISLVPQTPYIEITKVSTNHIALLW--RSNGSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSN-PAISQAQTRGSIPEIPDTSNIVTEIGPHSMCFNLRAFRPGRGCPANKYILKLWPSSEGNHQESGVSVWKVVNDSDLNQIPCFNVTDLHPNTDYVYSIEASNMVGSQKAKAHNKTRQI-VSTAPPNI 5192
            L  F +F NV S +  S  +F+N                    +  V   T  + V C A G P   ++WY  T +     E+ D P    V  NG + IF          I  N    YC A+N  G +RS+ + + K +  +   VR E ++      AV  C++  ++ AY+  V  WE     D+  ++    +  RF + +      L+I++V   D      RCI R+ YT    +S+   S +    +      SI    + R  + G  +ELP C    + +  + W          + LSG   K ++     LLI+N   ++ G Y        SN Y T  V   + V   +K T+    V +     V L C  TG     L W  NG   N  K+    T  +  + I   +     G YQC        ++++ ++D   V V++ +  P +I          S  +  + +      + C     P  TV W LDD  I      +  + +R+   + +   + +S +     + + GG YR    N  G       I V     IR   +IT   G +  + C VI     +I+W+++A      LP  H Q   E+     +  V K +  G+Y CN  +   L  S++  VT+  PP +                         QP       +EF        V       +   DL I I +QK         +G  +P  +   +    +  + + I     +H    +C+ +N A  +    Q     L+ +  P     P D   + G++  LNCSA+   +      F+  +         +  RI  L NG+L++K++   D   ++C +   VG D +SK + + +K+PA I + P+     +     ++CT HG+  + V+W  KED         RI    +++R+ V  + V + +              G + C A N + ++    II L V + P    I  E     +R+I + W     DG  PIT Y +  K  +++W     TK+      S TI D+ P   Y I + A+N +G  E +  I I     AP+GP   +     S   +++ W++P + L NGI + YQ+   E     N      +  +  DS    +D  N                        FT+Y   V   N  G  P ++ +   TLED P   P  +Q +  SP++  + + W+   +   NG++ G+ V Y+++    E  ++ KNV  T   L+L  L   + Y IQ+      G G  SE I   T E  P PP  +KA      +  VSW PP+K NG IR+Y  VF   P   + +S  E     +S+ + +       +V V+AVT+  +G      TV  L+     IL+FS ++       +VL C+ V  P   + ++   N       I G + + SNGS +I ++   D G Y C       S+EI  N+    + + P  P + ++K +++ I L W    NG       I  +++     N        +S + RS  + NL+CGT Y   L A+N  GP     I +A+T G  P+      +   I    +  NL  +  G GCP   + L+  P         G +VW     + L++   + + DL   T Y   +   N  G  + +A+  T     ST PP I
Sbjct:    6 LSLFQSFANVFSEEPHSSLYFVNAS-----------------LQEVVFASTSGTLVPCPAAGIPPVTLRWYLATGE-----EIYDVPGIRHVHPNGTLQIFPFPPSSFSTLIHDN--TYYCTAENPSGKIRSQDVHI-KAVLREPYTVRVEDQKTMRGNVAVFKCIIPSSVEAYVTVVS-WE----KDTVSLV----SGSRFLITSTGA---LYIKDVQNED-GLYNYRCITRHRYTGETRQSN---SARLFVSDPANSAPSILDGFDHRKAMAGQRVELP-CKALGHPEPDYRWLK----DNMPLELSGRFQKTVT----GLLIENSRPSDSGSYVCEV----SNRYGTAKVIGRLYVKQPLKATISPRKVKSSVGSQVSLSCSVTGNEDQELSWYRNGEILNPGKNVRI-TGLNHANLIMDHMVKSDGGAYQCFVR-----KDKLSAQDY--VQVVLEDGTPKII----------SAFSEKVVSPAEPVSLVCNVKGTPLPTVTWTLDDDPI------LKGSGHRISQMITSEGNV-VSYLNISSSQVRDGGVYRCTANNSAGVVLYQARINVRGPASIRPMKNITAIAGRDTYIHCRVIGYPYYSIKWYKNAN----LLPFNHRQVAFENNGTLKLSDVQKEVDEGEYTCNVLVQPQLSTSQSVHVTVKVPPFI-------------------------QP-------FEFPRFSIGQRV--FIPCVVVSGDLPITITWQK---------DGRPIPASLGVTID-NIDFTSSLRISNLSLMHNGNYTCIARNEAAAVEHQSQ-----LIVRVPPKFVVQPRDQDGIYGKAVILNCSAEGYPVPTIVWKFSKGAGVPQFQPIALNGRIQVLSNGSLLIKHVVEEDSGYYLCKVSNDVGAD-VSKSMYLTVKIPAMITSYPNTTLATQGQRKEMSCTAHGEKPIIVRW-EKED---------RIINP-EMARYLVSTKEVGEEVISTLQILPTVREDSGFFSCHAINSYGED--RGIIQLTVQEPPDPPEI--EIKDVKARTITLRWT-MGFDGNSPITGYDIECKNKSDSWDSAQRTKDVSPQLNSATIIDIHPSSTYSIRMYAKNRIGKSEPSNEITITADEAAPDGPPQEVHLEPTSSQSIRVTWKAPKKHLQNGIIRGYQIGYREYSTGGNFQFNIISIDTTGDSEVYTLDNLNK-----------------------FTQYGLVVQACNRAGTGPSSQEIITTTLEDVPSYPPENVQAIATSPES--ISISWSTLSKEALNGILQGFRVIYWANLIDGELGEI-KNVTTTQPSLELDGLEKYTNYSIQVLAFTRAGDGVRSEQIFTRTKEDVPGPPAGVKAAAASASMVFVSWLPPLKLNGIIRKY-TVFCSHPYPTV-ISEFEASPDSFSYRIPNLSRNRQYSVWVVAVTSAGRGNSSEIITVEPLAKAPARILTFSGTVTTPWMKDIVLPCKAVGDPSPAVKWMKDSNGTPSLVTIDGRRSIFSNGSFIIRTVKAEDSGYYSCVANNNWGSDEIILNL---QVQVPPDQPRLTVSKTTSSSITLSWLPGDNGGSS----IRGYILQYSEDNSEQWGSFPISPSERSYRLENLKCGTWYKFTLTAQNGVGPGRISEIIEAKTLGKEPQFSKEQELFASINTTRVRLNLIGWNDG-GCPITSFTLEYRP--------FGTTVWTTAQRTSLSK--SYILYDLQEATWYELQMRVCNSAGCAEKQANFATLNYDGSTIPPLI 1577          
BLAST of Down syndrome cell adhesion molecule vs. UniProt/SwissProt
Match: sp|F1NY98|DSCAM_CHICK (Down syndrome cell adhesion molecule homolog OS=Gallus gallus OX=9031 GN=DSCAM PE=1 SV=3)

HSP 1 Score: 301.212 bits (770), Expect = 1.012e-80
Identity = 419/1719 (24.37%), Postives = 689/1719 (40.08%), Query Frame = 3
Query:  222 KSFVTTMTDHSRVYCTATGNPSPKIKWYYETTQRNVFTEVND-PDRFVVGTNGDMDIF----------IQANIEVIYCKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRNIYTDIDVKSHDWISPKRLEDNSKIDFTSICQNIEVR-VIKGSTLELPWCSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEE-KWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLN-NLKISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQISIDNLVFKESP-----PLDYSIVLGQSFALNCSAKPTNIQLKTNWFXXXXXXXXXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKEDGNWDSLPVKRIKEKSKVSRFFVKFESVTDSLF-------------GEYKCVASNEHRKNGVERIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWKLVTENWFINATTKETS-----ITIEDLRPFKEYDIAIVAENSVGYGEEAT-IIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSP-AKYVAIRTLEDKPEGTPIQVLCSPKA-NFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNVKETH--LKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIKAYFYQ-NCLKVSWTPPIKANGHIREYIIVFSFEPNNMITVSSRENDKPYYSWELCSEQICSNCNVSVLAVTTM-KGPRK---TVNVLSNKMG-ILSFXXXXXXXXXXXXXLYCE-VAFPDENIYYLWTHNDKD----IYG-QGVQSNGSLVINSMAESDQGIYKCKVK----SEEITYNVSTKSISLVPQTPYIEITKVSTNHIALLW--RSNGSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSN-PAISQAQTRGSIPEIPDTSNIVTEIGPHSMCFNLRAFRPGRGCPANKYILKLWPSSEGNHQESGVSVWKVVNDSDLNQIPCFNVTDLHPNTDYVYSIEASNMVGSQKAKAHNKTRQI-VSTAPPNI 5192
            +  V   T  + V C A G P   ++WY  T +     E+ D P    V  NG + IF          I  N    YC A+N  G +RS+ + + K +  +   VR E ++      AV  C++  ++ AYI  V  WE       K  + +     RF + +      L+I +V   D      RCI R+ YT    +S+   S +    +      SI    + R  + G  +ELP C    +    + W      + ++     S+F+   +    LLI+N   ++ G Y            +   + V   +   I P  V +     V L C  TG     L W  NG   N   +    T  +R + I   +     G YQC        ++++ ++D   V VI+ +  P +I          S  +  + + G    + C     P  T+ W LD+  I      + + ++R+  + I T + ++ + ++I   + + GG YR    N  G       I V     IR   +IT   G +  + C VI     +I+W++++      LP  H Q   E+     +  V K +  G+Y CN  +   L  S++  VT+  PP +                         QP       +EF        V       +   DL I I +QK         +G  +P  +   +    +  + + I     +H    +C+ +N A  +    Q     L+ +  P     P D   + G++  LNCSA+   +      ++  +         +  RI  L NG+L++K++   D   ++C +   VG D +SK + + +K+PA I + P+     +  +  ++CT HG+  + V+W  KED         RI    ++SR+ V  + V D +              G + C A N + ++    II L V + P    I  E     +RSIA+ W     DG  PIT Y +  K  +++W     TK+ S      TI DL P   Y+I + A+N +G  E +  + I T   AP+GP  ++    +S   +++ W++P + L NGI + YQ+   E     N      +  +  DS                        V T+  L  FT+Y   V   N  G  P ++ +   TLED P   P  V  +  +   + + W+   +   NG++ G+ V Y+++    E  ++ +NV  T   L+L  L   + Y IQ+      G G  SE I   T E  P PP  +KA     + + VSW PP+K NG IR+Y  VF   P   + +S  E     +S+ + +       +V V+AVT   +G      TV  L+     IL+FS ++       +VL C+ V  P   + ++   N       I G + + SNGS VI ++   D G Y C       S+EI  N+    + + P  P + ++K +++ I L W    NG       I  +++     N        +S + RS  +  L+CGT Y   L A+N  GP     I +A+T G  P+      +   I    +  NL  +  G GCP   + L+  P         G +VW     + L++   + + DL   T Y   +   N  G  + +A   T     ST PP I
Sbjct:   58 QEVVFASTTGTLVPCPAAGIPPVTLRWYLATGE-----EIYDVPGIRHVHPNGTLQIFPFPPSSFNNLIHDN--TYYCTAENPSGKIRSQDVHI-KAVLREPYTVRVEDQKAMRGNVAVFKCIIPSSVEAYITVVS-WE-------KDTVSLVSGP-RFLITSTGA---LYILDVQNED-GLYNYRCITRHRYTGETRQSN---SARLFVSDPANSAPSILDGFDHRKAMAGQRVELP-CKASGHPTPKYRWL-----KDNIPWEPDSRFR---QTVTGLLIENTRPSDSGNYVCEVWNNYGTAEMIGRLYVKQPLKATISPRKVKSSVGSQVSLSCSVTGTEDQELSWYRNGEIINPGNNVRI-TGINRENLIMDGMAKSDGGAYQCFVR-----KDKMSAQDY--VQVILEDGTPKII----------SAFSEKVVSPGEPVSLMCNVKGTPLPTITWTLDEDPI------VKDGSHRI--SQIITSEGNVVSYLNISNTQVRDGGVYRCTANNSAGVVLYQARINVRGPASIRPMKNITAIAGRDTYIHCRVIGYPYYSIKWYKNSN----LLPFNHRQVAFENNGTLKLSDVQKEVDEGEYTCNVLVQPQLSTSQSVHVTVKVPPFI-------------------------QP-------FEFPRFSIGQRV--FIPCVVVSGDLPITITWQK---------DGRPIPASLGVTID-NIDFTSSLRISNLSLMHNGNYTCIARNDAAAVEHQSQ-----LIVRVPPRFVVQPSDQDGIYGKAVILNCSAEGYPVPTIVWKYSKGAGVPQFQPIALNGRIQLLTNGSLLIKHVLEEDSGYYLCKVSNDVGAD-VSKSMYLTVKIPAMITSYPNTTLATQGQKKEMSCTAHGEKPIIVRW-EKED---------RIINP-EMSRYLVSTKEVGDEVISTLQILPTVREDSGFFSCHAINSYGED--RGIIQLTVQEPPDPPEI--EIREVRARSIALRWT-MGFDGNSPITGYDIECKNKSDSWDSVQRTKDVSPQLNQATIIDLHPSSTYNIRMYAKNRIGKSEASNELTITTDEAAPDGPPQDVQLEPISSQSIRVTWKAPKKHLQNGIIRGYQIGYREYSAGGNFQFNIISIDTTGDSE-----------------------VYTLNNLKKFTQYGMVVQACNRAGIGPSSQEIITTTLEDVPSCPPGNVQATATSPETISISWSTLAKETLNGILQGFRVIYWANLLDGELGEI-RNVTTTQPSLELDGLEKYTNYSIQVLAFTRAGDGVRSEQIFTRTKEDVPGPPAGVKAAASSASTVFVSWLPPLKLNGIIRKY-TVFCSHPYPTV-ISEFEASPDSFSYRIPNLSRNRQYSVWVVAVTAAGRGNSSEIITVEPLAKAPARILTFSGTVTTPWMKDIVLPCKAVGDPAPTVKWMKDSNGTPSLVMIDGRRSIFSNGSFVIRTVKAEDSGYYSCVASNNWGSDEIILNL---QVQVPPDQPRLTVSKTTSSSITLSWIPGDNGGSS----IRGYILQYSEDNSEQWGSFPISPSERSYRLETLKCGTWYKFTLTAQNGVGPGRISEIIEAKTLGKEPQFSKEQELFASINTTRVRLNLIGWNDG-GCPITSFTLEYRP--------FGTTVWTTAQRTSLSK--SYILYDLQEATWYELQMRVCNSAGCAEKQAKFATLNYDGSTIPPLI 1603          
BLAST of Down syndrome cell adhesion molecule vs. UniProt/SwissProt
Match: sp|E1C8P7|DSCL1_CHICK (Down syndrome cell adhesion molecule-like protein 1 homolog OS=Gallus gallus OX=9031 GN=DSCAML1 PE=1 SV=2)

HSP 1 Score: 291.967 bits (746), Expect = 6.552e-78
Identity = 410/1688 (24.29%), Postives = 667/1688 (39.51%), Query Frame = 3
Query:  264 CTATGNPSPKIKWYYETTQRNVFTEVND-PDRFVVGTNGDMDI----------FIQANIEVIYCKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRNIYTDIDVKSHDWISPKRLEDNSKIDFTSI------CQNIEVRVIKGSTLELPW-CSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLN-NLKISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQISIDNLVFKESP-----PLDYSIVLGQSFALNCSAK---PTNIQLKTNWFXXXXXXXXXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKE-----DGNWDSLPVKRIKEKSKVSRFFVKFESVTDSLFGEYKCVASNEHRKNGVERIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWKLVTENWFINATTKETSITIE-----DLRPFKEYDIAIVAENSVGYGEEAT-IIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSPAKY-VAIRTLEDKPEGTPIQVLC-SPKANFLFLEWNPPPQNVTNGVISGYEVTYFS---DDKHEEPDKLMKNVKET--HLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIK-AYFYQNCLKVSWTPPIKANGHIREYIIVFSFEPNNMITVSSRENDKPYYSWELCSEQICSNCNVSVLAVTTMKGPRKTVNVLSNKMG-----ILSFXXXXXXXXXXXXXLYC-EVAFPDENIYYLWTHNDKD------IYGQG-VQSNGSLVINSMAESDQGIYKCKVKSEEITYNVSTKSISLV----PQTPYIEITKVSTNHIALLW--RSNGSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSN-PAISQAQTRGSIPEIPDTSNIVTEIGPHSMCFNLRAFRPGRGCPANKYILKLWPSSEGNHQESGVSVWKVVNDSDLNQIPCFNVTDLHPNTDYVYSIEASNMVG 5129
            C A G+PS  ++WY  T       ++ D P    V  NG + +          FI  N    +C A+N  G +RS  I V K +  +   VR E +       AV  CL+  ++  Y+  V  WE     D+  ++     E RF + +      L+I +V K D +    RCI ++ Y+    +S+      RL  +      SI       Q+ EVR   G  +ELP   S   N  I W     +   R L    G   K I+     L I ++ + + G Y         +  +T T+ V+  + V + P  +       V L C  +G P   + W  N  +      F +    S  + +        +G YQC A  +           Q    + + +  P ++          S+   V+   G  F + C     P  TV W LDD+ IP  N    N      YT+  +    +S M     + K GG YR    N  G A     I V     IR   +IT   G +  + C VI     +I+W++D+    + LP+ H Q V E+G L +++ V K +  G+Y+C+  +   L IS++  VT+  PP++    P             + C+     D+P +  W     K  H +  LS S +     +     Q  +VS K+  N                                   +C+  N A T+ +  Q     L+ +  P     P +   + G++  LNCS     P  +  K        +        +  RI  LPN +L+++++   D   ++C     VG D ISK + + +K+PA I + P+     +     LNCT  G+  + ++W + +     D N       +      +S   +K     DS+F  + C A N + ++    +I L V + P    +  E     +RS+ + W     DG   IT + + +K  +++W    +T+  S TI      DL P   Y I + + N +G  E +  + I T+  AP+GP +++    ++   +++ W++P + L NG+ + YQ+   E     N         +  DS                        V T+  L  F +Y   V   N  G  P+   +   TLED P   P  V   S  ++   + W+ PP++  NGV+ GY V ++S   D +  E    M+N+  T   ++L  +   + Y +Q+      G G  S  +   T E  P PP  IK      + + VSW PP K NG IR+Y I  S   +     S  E       + +          + V AVT+      +  V     G     I+SF  ++       V L C  V  P   I   WT + +D      + G   +Q+NG+LV+ S+   D G Y C   +   T+   T  I+L+    P  P + ++K S + I L W    NG       I  F++     N    +++ +SS+ RS  + +L+CGT Y V L AKN  G      I +A+T G  P      ++ T I       NL+ +  G GCP    +L+  P  +GN        W+ +  +   ++    +T+L   T Y   ++A N  G
Sbjct:   46 CPAAGSPSAVLRWYLATGD-----DIYDVPHIRHVHANGTLQLYPFSPSAFNSFIHDND--YFCTAENSAGKIRSPNIRV-KAVFREPYTVRVEDQRSMRGNVAVFKCLIPSSVQEYVSVVS-WE----KDTVSIIP----ENRFFITSYGG---LYISDVQKED-ALSTYRCITKHKYSGETRQSNG----ARLSVSDADPAESIPTMLDSFQSREVRA--GRLVELPCIASGYPNPAIRW-----LKDGRPL-PADGRWAKRIT----GLSIADLRVEDSGTYICEVTNTFGSAEVTGTLTVIDPLRVTLTPKKLKTGIGSTVILSCALSGSPEYVIRWYRN-TDLVVVDDFISIRGISNETLLITAAQKSHSGAYQCFATRKSQTA-------QDFSIITLEDGTPRIV---------SSFSEKVVNP-GEQFSLMCAAKGAPPPTVTWALDDEPIPRDNGHRTNQ-----YTM--SDGTTVSHMNVTSPQIKDGGVYRCTARNSVGSAEYQARINVRGPPSIRAMKNITAVAGRDTFINCRVIGYPYYSIKWYKDS----LLLPDNHRQVVFENGTLKLMD-VQKGMDEGEYLCSVLIQPQLSISQSVHVTVKVPPLIQ---PFEFPPASIGQLLYIPCV-VSSGDMPIHITWR----KDGHVI--LSGSGVTIESKEFMSSLQISSVSLKHNGN----------------------------------YTCIASNAAATVSRERQ-----LIVRVPPRFVVQPNNQDGIYGKAGVLNCSVDGYPPPKVMWKHA--KGSGNPQQYHPIPLTGRIQILPNSSLLIRHVLEEDIGYYLCQASNGVGTD-ISKSMFLTVKIPAMITSHPNTTIAIKGQSKELNCTARGERPIIIRWEKGDTVIDPDRNMRYAIATKDNGDEVISTLKLKPADRGDSVF--FSCHAINSYGED--RGLIQLTVQEPPDPPEL--EIREVKARSMNLRWTQ-RFDGNSIITGFDIEYKNKSDSWDFKQSTRNISPTINQANIVDLHPASVYSIRMYSFNKIGRSEPSKELTISTEEAAPDGPPMDVTLQPMTSQSIQVTWKAPKKELQNGVIRGYQIGYRENSPGSNGQYSIVEMKATGDSE-----------------------VYTLDNLKKFAQYGVVVQAFNRAGTGPSSSEINATTLEDVPSQPPENVRAISITSDVAVISWSEPPRSTLNGVLKGYRVIFWSLYMDGEWGE----MQNITTTRERVELRGMEKFTNYSVQVLAYTQAGDGVRSSVLYIQTKEDIPGPPAGIKAVPSSASSVVVSWLPPAKPNGIIRKYTIFCSSPGSGQPAPSEYETSPDQLFYRIAHLNRGQQYMLWVAAVTSAGRGNISEKVTIEPAGKAPAKIISFGGTVTTPWMKDVRLPCNSVGEPVPAIK--WTKDSEDSAIPVTVDGHRLIQANGTLVLRSVKAEDSGYYTCTATN---TWGFDTIIINLLVQVPPDQPRLTVSKTSASSITLAWIPGDNGGSS----IRGFVLQYSVDNSEEWKDVFISSSERSFKLESLKCGTWYKVKLAAKNSVGAGRISEIIEAKTHGREPSFSKDQHLFTHINSTHARLNLQGWSSG-GCPITAIVLEYRP--KGNWG------WQSLRTNSSGEV---FLTELREATWYELRMKACNSAG 1559          
BLAST of Down syndrome cell adhesion molecule vs. TrEMBL
Match: Q1JUB5 (Down syndrome cell adhesion molecule OS=Dugesia japonica OX=6161 GN=DjDSCAM PE=2 SV=1)

HSP 1 Score: 1881.69 bits (4873), Expect = 0.000e+0
Identity = 1065/2116 (50.33%), Postives = 1386/2116 (65.50%), Query Frame = 3
Query:   60 MRFFILILFNILCHFITFKNVNSFDHKSFFFFLNRHKRYAEERNLEPPKLINVQKSFVTTMTDHSRVYCTATGNPSPKIKWYYETTQRNVFTEVNDPDRFVVGTNGDMDIFIQANIEVIYCKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRNIYTDIDVKSHD-WISPKRLE-DNSKIDFTSICQNIEVRVIKGSTLELPWCSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENR-ILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLNNLKISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKE-AKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNG-----AALPKGVPNFVRYQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQISIDNLVFKESPPLDYSIVLGQSFALNCSAKPTNIQLKTNWFXXXXXXXXX-XXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGDDE-LDVKWYRKEDGNWDSLPVKRIKEKSKVSRFFVKFESVTDSLFGEYKCVASNEHRKNGVERIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWKLVTENWFINATTKETSITIEDLRPFKEYDIAIVAENSVGYGEEATIIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTL---VITVTELLTFTEYAFRVILVNNVGFSPAKYVAIRTLEDKPEGTPIQVLCSPKANFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNVKETHLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIKAYFYQN-CLKVSWTPPIKANGHIREYII-VFSFEPNNMITVSSREND----KPYYSWELCSEQICSNCNVSVLAVTTMKGPRKTVNVLSNKMGILSFXXXXXXXXXXXXXLYCEVAFPDENIYYLWTHNDKDIYGQGVQSNGSLVINSMAESDQGIYKCKVKSEEITYNVSTKSISLVPQTPYIEITKVSTNHIALLWRSNGSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSNPAISQAQTRGSIPEIPDTSNIVTEIGPHSMCFNLRAFRPGRGCPANKYILKLWPSSEGNHQESGVSVWKVVNDSDLNQIPCFNVTDLHPNTDYVYSIEASNMVGSQKAKAHNKTRQIVSTAPPNINYSSPPLASELKYXXXXXXXXXXXXXXXXXXXXXYCTRRSCHTYFGNRNISNNLVKPPIRSPIPVSNNRNRKLPTPPDNNFYDKGNNIISKPQDN-EEDEMLTPYATYESIPKPDPMTNRDRPNMSTNYNTGSQTNSYQYPEMQPLEASNPKMMNYPNDLKQPLLTHSIKHSSKKYDKGYSRGNESLATLRPQTVRSEVLVTMNKHRILPVISNAPGSMESEAYRPXXXXXXXXXXXXXKDELRQLFGNASGNQFPSRLQEQDEDGASTARGGNRSTLINRSHHHINNTLSDDSTQPESYCESGSSGDDCGIRNFTQDPPGQQVIAPQTIRNMNLRCNSLPYDTANRQPFIQQSNNFTLQQPRNPLPEEDEGEEANNYTNNFVVV 6344
            MRFFIL LFNILCHF+ FK V+S + KS  F+L+R  R + ++N EPP LI    + V  + D+  + C A G P P I W+   +Q N F E+ D ++ ++  +G + +      E+ YC+A+N LG VRSK   VQK    +DV +  E+ EV   QKAVI C   P + +  Y ++YWEIRY     K  +I KTEGRF VI   +P QLHIRN+TK DF D++VRC++ NIY   +V   D W  PK       K    +ICQ  E+RV KGS +ELPWCS PN   I+W  +   +S R  + L G+KFK+IS  +GNLLI NI I++EG YY+    + +  Y   TVRVM+NV+V+IKP VV     E V L+C++TGYP  S+ WL+NGN+   +KS E  ++ S  S I I V  ++AGVYQCL+ESRD  +NR +LSE+Q++V VII+EMAP LI+Q P V P  +Y    LKTD SSF+I+C+FN VP  T+ W+LDD+KIPMVN L P+T Y   YT +A L IDLS M SIE KWKYGGEYRAEVTN+YGKA+CTTL+FV +VY IR+  +    HG ++ LKCYVISG  P IEWFR ++G  +RLP +H++ VS+DGR FI+ K+DK +HSG Y+C STL    ISK F +TIA PP +L      IS +K+S   +  C P++ PDLPWYAWWEF   +  N S P+ +N  L       E     +T  EK+   G     + L  GVPNF++   N  AQI I YN+KL LS + CVV+NHAG I KTI I +  L F   PP   S+VLG+ F L+C+AK  ++ LKT W N         VN+T+ESRIHQL NGT +VK+IELTD ++FMC+IK      EIS+VVKI IKVPA I+ M D ID+K+N +NSLNCTV GD E L ++W+RK +  WD     + +EK+K++R F++F++V +   GEYKC A NEH++  VERII LNVVDVPG++    ++++   RSI ISW+PP ++G K IT Y+V WKL   N     + K  SITI++LRPFK Y I I A+NSVG GE      +T A APE  VL L A  +S   ++L W+SP+E  +NG  K YQVC +E +  +N+  E   WPSPND+ TR+ D + HR+KK C  V +S+L     T+ ELL FT YAFRVILVN VG+SPA Y+  RTLED PEG P Q++C+PK N L L WNPP Q + NG+++GYE+ YF  DK+ EPD ++ +V +T   L N+  N+ Y IQ+R+KN+ G GP SEPINC+T EAAP+ P+E++AYF  + C+ VSWTPP  +NG +R YI+ VF    NN   +S + N      PYY  +LC      +  + + AVT  +G     ++ +   GILS S++IV Q  S++ L CE      ++  +WT NDK I       NGS +I+S+ E  QGIYKC    + +TYNVS KS    P+ P IE  K S N+I L WRS GSPK++ PIN F++ I   N S ++ L +S+++R   I NLECG+ Y + LYA+N  G S+      +T G  PEIP+TS++V      S CFNL  F PG+GCPAN + L+L PS+  N + SG  + K V+  DL +IPCFNVT LHPNT Y Y IEASN VG+  A+ H+ T Q +S  PP +    PP  + L Y+ ++ V+  +IL ++  V  +  +RR+      N  I+NN     ++SP  VS NRNRKLPTPP N+ YDKG     K  +N +EDEML PYATYES+ KPD  T+R+RPN ST Y TGSQ +SYQYP+M   E+++     Y N+ KQPLL  ++ H  + YDKGYS+G+++L TLRPQ VRS     + K R   VIS APG ++SEAYRPSSSLCSSTTESSTK+ELR++F + S N F SRLQE DEDGASTARGGNRST+INRS H   NTLSDDS QPESYCESGSSGDDCGIRNFTQDPPGQQVIAP +IR  N R NS+ YDTANR+P IQQSNNFTLQQPRNPLPEEDE +E+NNYTNNFVVV
Sbjct:    1 MRFFILKLFNILCHFLIFKIVDSINDKSIDFYLSRQMR-SIDKNYEPPWLIEEYATSVKILQDNYHLKCNARGYPKPIINWFEYRSQTNSFVEIIDANKLILHEDGSLQVTPLPTSEIFYCQAKNFLGVVRSKKFYVQKRDKIRDVTINYESMEVYPNQKAVIRCDTNPQLFSKEYDLKYWEIRYMISKTKAKQINKTEGRFRVIKGIRPLQLHIRNITKEDFLDIKVRCVLENIYAPNEVLEFDVWAFPKEFTYQFDKAVSNNICQTAEIRVTKGSNVELPWCSKPNTSHISWQRTDFHTSIRAKIYLKGTKFKLISA-YGNLLINNIDISDEG-YYSPVGILAARNYPIFTVRVMVNVTVEIKPKVVFVPNEETVTLECISTGYPIPSISWLYNGNDLTETKSLEKISSISLKSTIVINVTIESAGVYQCLSESRDANDNRMLLSENQQTVPVIISEMAPKLIYQIPLVAPGKTYSNVTLKTDSSSFEIECRFNSVPKSTIVWFLDDEKIPMVNALKPSTDYFEAYTAVARLAIDLSKMDSIEHKWKYGGEYRAEVTNEYGKAYCTTLVFVANVYHIRETKNTMWLHGEQMILKCYVISGTMPQIEWFRISEGTKIRLPASHSERVSKDGRDFIVPKLDKAVHSGTYMCQSTLKTQVISKNFKITIAKPPTVLETSVNEISFSKSSTRVTSVCRPKNNPDLPWYAWWEFVHPSNKNKSKPISANGNL-------EFPAILVTYPEKFGKLGSNHIYSPLLNGVPNFLKDNFNSPAQITISYNDKLDLSSVICVVKNHAGVINKTIPIIVVTLAFDIDPPSTLSVVLGKGFTLDCTAKANHMNLKTTWLNGGDRIGSHPVNTTIESRIHQLSNGTFIVKSIELTDSNQFMCLIKITNTNHEISRVVKILIKVPAEIILMDDTIDLKKNSQNSLNCTVRGDTEGLSIRWFRKVNNKWDLSDNIKSEEKNKITRTFIEFDAVNEKDSGEYKCEAKNEHQQVPVERIIWLNVVDVPGEIRDYEKNMKKHERSIDISWSPPENNGNKTITDYVVKWKLA--NHSFEESVKVPSITIQNLRPFKNYKIEISAKNSVGVGEAVRFDARTLAAAPEKGVLKLQAIPISSTTIQLNWDSPDEFSVNGHLKFYQVCYLEKF--ENQKPESLKWPSPNDTMTRIFDSNKHRIKKGCTAVNKSSLKKVSTTIPELLIFTGYAFRVILVNEVGYSPASYITARTLEDDPEGFPTQIVCTPKENLLELGWNPPAQVLINGLVTGYEILYFRTDKNGEPDNIVSHVSKTTHLLRNVLPNTSYTIQVRIKNSKGSGPLSEPINCSTKEAAPEAPSELRAYFITDKCVNVSWTPPNNSNGIVRHYIMTVFK---NNGSIISRQTNGIYRKNPYYREKLCELMRSDDYEIEMKAVTVKEGHGIRKSIKNVDKGILSISKNIVAQRFSKIELECETIPSSTDV--IWTCNDKIIDSYKTLENGSYIIDSLTEKLQGIYKCSYGKDLVTYNVSLKSSHHKPRKPIIEFYKESANYIYLAWRSEGSPKSDDPINLFVIDIYKNNDSLTKTLNISNSMRFANISNLECGSSYKINLYAQNNNGNSSDYTIYTRTLGKKPEIPNTSDLVIGKYSDSFCFNLTTFLPGQGCPANLFKLQLTPSNIWNSRHSGFEITKSVHHKDLIRIPCFNVTHLHPNTSYYYKIEASNEVGTTTAEGHSITLQTISNRPPELITKIPPNDTLLFYVIMSVVVIFVILLIVCSVFVMRHSRRNRKRTLENNVINNNFNDNIVQSPTSVSTNRNRKLPTPPGNHVYDKGKAENPKTTNNDDEDEMLVPYATYESLSKPDSSTSRERPNRST-YLTGSQAHSYQYPDMLQTESASGSKPLYENESKQPLLIQTLNH--RPYDKGYSQGSQNLHTLRPQIVRSNAQAAIQKPRGPAVISVAPGQVDSEAYRPSSSLCSSTTESSTKEELREVFRHQSSNPFFSRLQETDEDGASTARGGNRSTIINRSGHM--NTLSDDSIQPESYCESGSSGDDCGIRNFTQDPPGQQVIAPTSIRQTNPRSNSMSYDTANRRPLIQQSNNFTLQQPRNPLPEEDE-DESNNYTNNFVVV 2091          
BLAST of Down syndrome cell adhesion molecule vs. TrEMBL
Match: A0A068Y1Y7 (Down syndrome cell adhesion molecule OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000348200 PE=4 SV=1)

HSP 1 Score: 553.132 bits (1424), Expect = 5.921e-157
Identity = 482/1870 (25.78%), Postives = 817/1870 (43.69%), Query Frame = 3
Query:  411 VIYCKAQNELGTVRSKTITV-QKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRNIYTDIDVKSHDWISPKRLEDNSKIDFTSI-------CQNIEVRVIKGSTLELPWCSMP-NNQKIAWYWS-SAVSSRRHLVNLS---------------GSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSF-------------------ETDTNFSRTSHITIRVNA---DTAGVYQCLAES--RDNA------------------------------------------ENRILSED-----QKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVL--KTDGS-SFQIQCKFNRVPNGTVAWYLDD----KKIPMVN---VLIPNTT--YRLPYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIR----DYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLV-RLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLNNLKISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWI-KYNEKLHLSQISCVVQNHAGTIRKTIQIS-IDNLVFKESPPLDYSIVLGQSFALNCSAKPTNIQLKTNWFXXXXXXX-----XXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKP--IVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGD----------------DELDVKW---------------------------------------YRKEDGNWDSLPVKR----IKEKSKVSRFFVKFESVTDSLFGEYKCVASN------EHRKNGVERIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWKLVTE------------NWFINATTKETSITIEDLRPFKEYDIAIVAENSVGYGEEATIIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYD----SQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSPAKYVAIRTLEDKPEGTPIQVLCSPKANFLFLEWNPPPQNVTNGVISGYEVTYF-SDDKHEEPDKLMKNVK-ETHLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIKAY-FYQNCLKVSWTPPIKANGHIREYIIVFSFEPNNM---------------------ITVSSR----ENDKPYYSWELCSEQICSNCNVSVLAVTTMKGPRKTVNVLS----NKMGILSFXXXXXXXXXXXXXLYCEVA-FPDENIYYLWTHNDKDIYGQGVQSNGSLVINSMAESDQGIYKCKVKSEEITYNVSTKSISLVPQTPYIEITKVSTNHIALLWRSNGSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSNPAISQ---AQTRGSIPEIPDTSNIVTEIGPHSMC--FNLRAFRPGRGCPANKYILKLWPSSEGNHQESGVS------------------------VWKVVN------DSDL--------NQIPCFNVTDLHPNTDYVYSIEASNMVGSQKAKAHNKTRQIVSTAP 5183
            V +C+A+N LG  RS+ + + Q  +  ++++++  T  V   QKAVI C     +      V+YWE+ +++DS  +  +  ++ R+SVIN ++ P+LHIR+VT+AD SD++VRC++++I     V     I  +R E      F           Q+ +V VI GST+ELPW      + ++ WYW  ++ SS +  V LS               GS+ + +   +GNL + N+ I + G Y    P     P + +T+++   + V + P      +   V+L+C+ +GYP   + WL N      + S                      +T+  +T    + +N+   + AGVYQC+AES   D+A                                          E R+   D     Q +  +++ +M P+ ++QS     +++  + +L  K+ G  +  ++C+F   P  T+ W+ DD     ++ M +   V++         PY++I  L+IDL+ +   +E W+YGGEYRA   N  G A C T + +     +R      P I    G    LKCY I    P ++W R   G+ + R+P  H   + E+ R+  I +V+K      Y C +   ++  + T ++ ++  P  + DLP    +     + + +C  ++  D PWYAWW F+   S+ ++ L  ++ LN      ++ Y       +      +L + +P FV  + N +  + I + N++ H   ++C + N  G   + I+++ I  L F+  PP    + L Q+ ++NC+A+P+ +     W   D S         +    E RI+Q  NGTLV+  +E +DP KF+C + P        IS  V + I VPA I  + DV D  R  + +L C VHGD                D  + +W                                        +   G +DS  + R    +K+  +     ++F+S+ D    EY C ASN      E R+  V +I+ L V+ VP  V     S ++ + S++ SW PP  DG K I RY + +                 N  I     E   T+  LRP+ +Y+IAI AEN VGY  E ++++ TQ   PEGPV +L AT  + D + + W+ P   L NG    Y VC   + +    S    L + +W  P D  T      +   +  C+ +        +T L  FT YA R+I +N+ G SP  YV  RTLED P+ +P  V CS + + + + W+PP     NG+++ Y V Y+ ++   +E + +++ VK +T + L  L AN++Y IQ+   N  G GP S    C+T EA P+ P  +KA    + C+ VSW+ P +  G  R Y +  ++  +++                     +T   R    +  KPY  +  C        N SV+A     G +  V++++    + + I+S   +IV Q   +V++ C VA +P     +   ++ + +       NG+L+I S+     G Y C+   + I+Y +  +     P+ P       S  +I + W S GS + + PI  F +   N        +++ ++ R+  + NL C T     + A+N  G S  A+++   A T GS P     +++V        C  FN   F PG  C  + Y  ++WP+++G+  +   S                         + V++        DL        N+  C+N++ LHP + Y Y + A N  G      +  TR +    P
Sbjct:  210 VFFCEAENSLGRTRSRKMVIHQVPVPDENLRIKYHTFPVKPGQKAVIRCQPEQEIFNRFLKVKYWEV-FRNDSL-IATVTHSKDRYSVINATRYPELHIRDVTEADLSDLQVRCVLQSI-----VDESREI--RRQETGHLQPFGFFFPYEEVRSQSTDVDVIVGSTVELPWVVESYQSLRVQWYWQPTSPSSSQGRVPLSPSVSIEEKAILTRPWGSRVEFVQGAYGNLRLINVSIDDAGQYSCEAPYPARLPAVVYTLKIRAPIDVRVTPHERVCDFGTRVELECLVSGYPHQIIYWLHNAKPLKLTSSPSSSSSSSSSSSSSSRHSVQRRETSGVQTVRERLVINSFSLEDAGVYQCVAESTLADDATTPTAKTNRGSSSSSAASTSSSLIVAATTAVTKVPMATEKTEEGRVSVGDLVDNAQDTSHLVMGKMKPMRVFQSSETAEAFTATSQILLSKSRGDLNATLECRFAANPLPTIRWFRDDLPLSHEVEMADDKGVVVSEVVKDAHRPYSLITRLKIDLNQVPPWDELWQYGGEYRAVANNSLGSADCRTFLLLDTPLRLRPVDSSKPAIA---GRFHDLKCYFIGSGIPKLQWHRIKNGQRIERIPVDHRHALLENARVLRITEVNKEQDEADYRCTAVHGDMTDNITITLKVSRAP-RIQDLPEVQRVQGGRQSLTYSCATQNHADKPWYAWWRFQLESSDEAIDLPPDAPLNPG--AFQVSYAADLHQTERRPLSESLRRQLPQFVHARPNSVVHVRIEQLNKRQHQGILTCKIVNEVGYDERPIRVTFIPELEFEIRPPNKQDVTLAQNISINCTARPSELTPMIVWKYSDESTGDFKELGSLTERTEGRIYQESNGTLVISQVEESDPRKFLCFLTPKESTTATPISVAVNLEIHVPARIEPLKDV-DAVRGSKFNLTCVVHGDANELQADWYYRSISVGDAGNSQWRLINQTCVLPASYGDAENAALALASSSSPDVLASDLLTCQKSAAGRFDSGVIFRQVSMLKQSGRGIERQLQFDSLKDVHMAEYMCNASNFYNRDKEGRRVDVRQIVRLTVISVPDPVTFVQNSSQTTATSVSFSWLPPAHDGNKEIRRYWIRYYQADSAAGESISGQSKPNSVIEVRPHEHQATLTGLRPYTKYNIAIKAENEVGYSLENSLVLTTQEAKPEGPVQHLNATGTASDTIYVAWQKPKPELRNGNVDRYSVCHQRVNESLVGSSQSDLARISW--PRDLITEDSSVSSGSSQIHCV-LMHRQQDTELTGLPKFTAYAIRIIAINSKGQSPPAYVLARTLEDLPQASPTNVTCSTQQHSITVSWDPPNFETVNGILTEYLVNYYIANSFGDETNSVIQVVKGQTTVTLAGLLANTRYEIQVAASNRKGRGPLSPKKICSTTEAPPEAPENVKALPVNETCVMVSWSHPSRPQGLTRLYCLA-AYRQDSLYRSAGASAATSATATSAIGSGVTAGPRCIKPDFSKPYNYYLFCDLSPQYLYNFSVMAKNRFDGRKAYVSMVAPASHSAVSIISIGGTIVAQERMRVLMDCLVAGYPPVEWTFGMVNDVQQL------DNGTLIIESVETRHSGRYICRHGDDSISYELKVQD---PPKPPVFHKLTPSLRNIQVEWLSPGSRRPDAPITCFHLDWTNEYTGLKDSVRLPADRRTYYLSNLTCATTVRFQMRAENQFGLS--ALTEPISASTEGSAPLFVGETDMVPSELRSRNCATFNFSVFAPGNNCSPSVYRFRVWPAADGSDADPSSSSLLTGASSSSGGNSAASTASTTPGAFSVLHFNLTLTKRDLFSLDNKPWNRRCCYNLSGLHPGSYYQYHVVAENPAGKTPHFGYFWTRTVGGIQP 2048          
BLAST of Down syndrome cell adhesion molecule vs. TrEMBL
Match: A0A068WUV8 (Down syndrome cell adhesion molecule OS=Echinococcus granulosus OX=6210 GN=EgrG_000348200 PE=4 SV=1)

HSP 1 Score: 547.354 bits (1409), Expect = 4.742e-155
Identity = 484/1870 (25.88%), Postives = 815/1870 (43.58%), Query Frame = 3
Query:  411 VIYCKAQNELGTVRSKTITV-QKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRNIYTDIDVKSHDWISPKRLEDNSKIDFTSI-------CQNIEVRVIKGSTLELPWCSMP-NNQKIAWYWS-SAVSSRRHLVNLS---------------GSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSF--------------------ETDTNFSRTSHITIRVNA---DTAGVYQCLAES--RDNA------------------------------------------ENRILSED-----QKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVL--KTDGS-SFQIQCKFNRVPNGTVAWYLDD----KKIPMVN---VLIPNTT--YRLPYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIR----DYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLV-RLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLNNLKISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWI-KYNEKLHLSQISCVVQNHAGTIRKTIQIS-IDNLVFKESPPLDYSIVLGQSFALNCSAKPTNIQLKTNWFXXXXXXX-----XXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKP--IVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGD-DELDVKWY-----------------------------------------------------RKEDGNWDSLPVKR----IKEKSKVSRFFVKFESVTDSLFGEYKCVASN------EHRKNGVERIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWKLVTE------------NWFINATTKETSITIEDLRPFKEYDIAIVAENSVGYGEEATIIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYD----SQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSPAKYVAIRTLEDKPEGTPIQVLCSPKANFLFLEWNPPPQNVTNGVISGYEVTYF-SDDKHEEPDKLMKNVK-ETHLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIKAY-FYQNCLKVSWTPPIKANGHIREYIIVFSFEPNNM---------------------ITVSSR----ENDKPYYSWELCSEQICSNCNVSVLAVTTMKGPRKTVNVLS----NKMGILSFXXXXXXXXXXXXXLYCEVA-FPDENIYYLWTHNDKDIYGQGVQSNGSLVINSMAESDQGIYKCKVKSEEITYNVSTKSISLVPQTPYIEITKVSTNHIALLWRSNGSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSNPAISQ---AQTRGSIPEIPDTSNIVTEIGPHSMC--FNLRAFRPGRGCPANKYILKLWPSSEGNHQESGVS------------------------VWKVVN------DSDL--------NQIPCFNVTDLHPNTDYVYSIEASNMVGSQKAKAHNKTRQIVSTAP 5183
            V +C+A+N LG  RS+ + + Q  +  ++++++  T  V   QKAVI C     +      V+YWE+ +++DS  +  +  ++ R+SVIN ++ P+LHIR+VT+AD SD++VRC++++I     V     I  +R E      F           Q+ +V VI GST+ELPW      + ++ WYW  ++ SS +  V LS               GS+ + +   +GNL + N+ I + G Y    P     P + +T+++   + V + P      +   V+L+C+ +GYP   + WL N      + S                       +T+  +T    + +N+   + AGVYQC+AES   D+A                                          E R+   D     Q +  +++ +M P+ ++QS     +++  + +L  K+ G  +  ++C+F   P  T+ W+ DD     ++ M +   V++         PY++I  L+IDL+ +   +E W+YGGEYRA   N  G A C T + +     +R      P I    G    LKCY I    P ++W R   G+ + R+P  H   + E+ R+  I +V+K      Y C +   ++  + T ++ ++  P  + DLP    +     + + +C  ++  D PWYAWW F+   S+  + L  ++ LN    ++           +    G  L + +P FV  + N +  + I + N++ H   ++C + N  G   + I+++ I  L F+  PP    + L Q+ ++NC+AKP+ +     W   D S         +    E RI+Q  NGTLV+  +E +DP KF+C + P        IS  V + I VPA I  + DV D  R  + +L C VHGD +EL   WY                                                     +   G +DS  + R    +K+  +     ++F+S+ D    EY C ASN      E R+  V +++ L V+ VP  V     S ++ + S++ SW PP  DG K I RY + +                 N  I     E   T+  LRP+ +Y+IAI AEN VGY  E ++++ TQ   PEGPV +L AT  + D + + W+ P   L NG    Y VC   + +    S    L + +W  P D  T      +   +  C+ +        +T L  FT YA R+I +N+ G SP  YV  RTLED P+ +P  V CS + + + + W+PP     NG+++ Y V Y+ ++   +E + +++ VK +T + L  L AN++Y IQ+   N  G GP S    C+T EA P+ P  +KA    + C+ VSW+ P +  G  R Y +  ++  +++                     +T   R    +  KPY  +  C        N SV+A     G +  V+ ++    + + I+S   +IV Q   +V++ C VA +P     +   ++ + +       NG+L+I S+     G Y C+   + I+Y +  +     P+ P       S  +I + W S GS + + PI  F +   N        +++ ++ R+  + NL C T     + A+N  G S  A+++   A T GS P     +++V        C  FN   F PG  C  + Y  ++WP+++G+  +   S                         + V++        DL        N+  C+N++ LHP + Y Y + A N  G      +  TR +    P
Sbjct:  210 VFFCEAENSLGRTRSRKMVIHQVPVPDENLRIKYHTFPVKPGQKAVIRCQPEQEIFNRFLKVKYWEV-FRNDSL-IATVTHSKDRYSVINATRYPELHIRDVTEADLSDLQVRCVLQSI-----VDESREI--RRQETGHLQPFGFFFPYEEVRSQSTDVDVIVGSTVELPWVVESYQSLRVQWYWQPTSPSSSQGRVPLSPSVSIEEKAVLTRPWGSRVEFVQGAYGNLRLINVSIDDAGQYSCEAPYPARLPAVVYTLKIRAPIDVRVTPHERVCDFGTRVELECLVSGYPHQIIYWLHNAKPLKLTSSPSSSSSSSSSSSSSSSRHSVQRRETSGVQTVRERLVINSFSLEDAGVYQCVAESTLADDATTPTAKTNRGSSSSSAASTSSSLIVAATTAVTKVPMATEKMEEGRVSVGDLVDNAQDTSHLVMGKMKPMRVFQSSETAEAFTATSQILLSKSRGDLNATLECRFAANPLPTIRWFRDDLPLSHEVEMADDKGVVVSEVVKDAHRPYSLITRLRIDLNQVPPWDELWQYGGEYRAVANNSLGSADCRTFLLLDTPLRLRPVDSSKPAIA---GRFHDLKCYFIGSGIPKLQWHRIKNGQRIERIPVDHRHALLENARVLRITEVNKEQDEADYRCTAVHGDMTDNITITLKVSRAP-RIQDLPEVQRVQGGRQSLTYSCATQNHADKPWYAWWRFQLEGSDEVIDLPPDAPLNPGAFQVSYAADLHQTERRPLSEG--LRRQLPQFVHARPNSVVHVRIEQLNKRQHQGILTCKIVNEVGYDERPIRVTFIPELEFEIRPPNKQDVTLAQNISINCTAKPSELTPMIVWKYSDESTGDFKELGSLTERTEGRIYQESNGTLVISQVEESDPRKFLCFLTPKESTTATPISVAVNLEIHVPARIEPLKDV-DAVRGSKFNLTCVVHGDANELQADWYYRSISVGDGGNSQWRLINQTCVLPASYGDAENAALALASSSPDVLASDLLTCQKSAAGRFDSGVIFRQVSMLKQSGRGIERQLQFDSLKDVHMAEYMCNASNFYNRDKEGRRVDVRQVVRLTVISVPDPVTFVQNSSQTTATSVSFSWLPPAHDGNKEIRRYWIRYYQADSAAGESISGQSKPNSVIEVRPHEHQATLTGLRPYTKYNIAIKAENEVGYSLENSLVLTTQEAKPEGPVQHLNATGTASDTIYVAWQKPKPELRNGNVDRYSVCHQRVNESLVGSSQSDLARISW--PRDLITEDSSVSSGSSQIHCV-LMHRQQDTELTGLPKFTAYAIRIIAINSKGQSPPAYVLARTLEDLPQASPTNVTCSTQQHSITVSWDPPNFETVNGILTEYLVNYYIANSFGDETNSVIQVVKGQTTVTLAGLLANTRYEIQVAASNRKGRGPLSPKKICSTTEAPPEAPENVKALPVNETCVMVSWSHPSRPQGLTRLYCLA-AYRQDSLYRSAGASAATSATATATIGSGVTAGPRCIKPDFSKPYNYYLFCDLSPQYLYNFSVMAKNRFDGRKAYVSSVAPASHSAVSIISIGGTIVAQERMRVLMDCLVAGYPPVEWTFGMVNDVQQL------DNGTLIIESVETRHSGRYVCRHGDDSISYELKVQD---PPKPPVFHKLTPSLRNIQVEWLSPGSRRPDAPITWFHLDWTNEYTGLKDSVRLPADRRTYYLSNLTCATTVRFQMRAENQFGLS--ALTEPISASTEGSAPLFVGETDMVPSELRSRNCATFNFSVFAPGSNCSPSVYRFRVWPAADGSDADPSSSSLLTGASSSSGGNSAASTASATPGAFSVLHFNLTLTKRDLFSLDNKPWNRRCCYNLSGLHPGSYYQYHVVAENPAGKTPHFGYFWTRTVGGIQP 2048          
BLAST of Down syndrome cell adhesion molecule vs. TrEMBL
Match: A0A5K3FA49 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 521.546 bits (1342), Expect = 1.095e-149
Identity = 412/1551 (26.56%), Postives = 706/1551 (45.52%), Query Frame = 3
Query:  411 VIYCKAQNELGTVRSKTITV-QKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRNIYTDIDVKSHDWISPKRLEDNSKIDFTSI--------CQNIEVRVIKGSTLELPWCSMP-NNQKIAWYWSSAVSSRR--HL---------VNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIR-------VNADTAGVYQCLAE-------------------------SRDNAENRILSED-----QKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQI--QCKFNRVPNGTVAWYLDDKKIP-----MVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIR----DYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLV-RLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLNNLKISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWI-KYNEKLHLSQISCVVQNHAGTIRKTIQIS-IDNLVFKESPPLDYSIVLGQSFALNCSAKPTNIQLKTNW-----FXXXXXXXXXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKP--IVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGD-DELDVKWYRK---------------------------------------------EDGNWDSLPVKR----IKEKSKVSRFFVKFESVTDSLFGEYKCVASN------EHRKNGVERIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWKLV--TENWFINATTK----------ETSITIEDLRPFKEYDIAIVAENSVGYGEEATIIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDS----QNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSPAKYVAIRTLEDKPEGTPIQVLCSPKANFLFLEWNPPPQNVTNGVISGYEVTYF-SDDKHEEPDKLMKNVK-ETHLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIKAY-FYQNCLKVSWTPPIKANGHIREYIIVFSFE------PNNMITVSSR----ENDKPYYSWELCSEQICSNCNVSVLAVTTMKGPRKTVNVLSNK----MGILSFXXXXXXXXXXXXXLYCEVAFPDENIYYLWTHNDKDIYGQGVQ--SNGSLVINSMAESDQGIYKCKVKSEEITYNVSTKS 4553
            V +C+A+N LG  RS+ + + Q  +  ++++++  +  +   QKAVI C     +      V+YWE+ +++++  +  +  ++ R+SVIN ++ P+LHIR+VT+AD +++ VRC++++I         D     R ++  ++    I         Q+ +V V+ GST+ELPW      + ++ WYW  A S ++  HL             GSK++ +   +GNL + N+ + + G Y          P + +T+++   + V I P      +   V+L+C+ +GYP   + WL N     ++    +      T+  T+R        + + +GVYQC+AE                         S +  + R+   D     Q +  +++ +M P+   QSP     Y+    +L        +  +C+F   P  ++ W+ DD  +      +V  ++     R  Y+VI  L+IDL+ +   +E W+YGGEYRA   N  G A C T + +     +R      P I    G    LKCY I    P ++W R   G+ V R+P  H   + E+ R+  I +V+K      Y C + L ++  + T ++ ++  P  + DLP    +     + + +C  ++  D PWYAWW F+   S  +V L  +  LN      ++ Y              AL + +P FV  + N +A + I + N++ H   ++C + N  G   + I+++ I  L F+  PP    + L Q+ ++NC+A+P+ +     W        D      +    E RI+Q  NGTLV+  +E +DP KF+C + P        IS  V + I VPA I  + +V D  R  + +L C VHGD ++L   WY +                                               G +DS  V R    +K+  +     ++F+S+ D   G+Y C ASN      + R+  V  I+ L V+ +P  V     S ++ + S++ SW PP  +G K I RY + +     + + F +  +K          E   T+  LRP+ +Y+IAI AEN VG+  E ++++ TQ   P+GPV  L A+ V+ D + + W+ P   L NG    Y VC   + +S        L +  WP+   +    V     ++  + +   + T ++    L  FT YA RVI +N+ G SP  Y   RTLED P+  P  V C  + + + + W+PP     NG+++ Y V Y+ ++D  +E + +++ VK +T + L  L AN+KYIIQ+   N  G GP S    C T EA P+ P  IKA     +C+ VSW+ PI+  G  R Y +    +      P  +++   R    +  KPY  +  C        N+SV+A     G +  V+ ++      + I+S   +IV Q   +V++ C V   D +    W  +   +  + VQ   NG+L+I ++     G Y C+ + + I+Y +  + 
Sbjct:  243 VFFCQAENTLGKSRSRKMVIHQVPVPDENLRIKYHSFPIKSGQKAVIRCQPEQEIFNRFLKVKYWEV-FRNETL-IATVAHSKDRYSVINATRYPELHIRDVTEADLAELHVRCVLQSIV--------DESREIRRQETGRLQPFGIFFQYEEVRSQSTDVDVLVGSTVELPWAVESYQSLRVQWYWYPASSPQQKFHLNPEDGKKVHSRPWGSKYEFVQGAYGNLRLINVSLEDAGQYSCEAAYPARLPPVVYTLKIRAPIEVRITPQERVCDFGTRVELECLVSGYPHQIIYWLHNAQPLLATSGRHSVQRRDATAAQTVRERLVINSFSLEDSGVYQCVAESSLSDSDSTTTSKTSQSSSAKSAVMSENADDGRVSVGDLVDNAQDTAHLVMGKMKPMRTAQSPAAAEPYATSQVLLSRRRGELNVTLECRFAANPLPSIDWFRDDLPLSPDDKGVVTSVVQKDRDRA-YSVITRLKIDLNQVPLWDELWQYGGEYRAVANNSLGYADCRTFLLLDTPLRLRPVDSSKPAIA---GRFHDLKCYFIGSGIPKLQWHRIKDGRRVERIPVDHRHALLENARVLRITEVNKEEDEADYRCTAMLGDMADNITITLKVSRAP-RIQDLPEVQRVQGGRQSLTYSCATQNHADRPWYAWWRFQPEGSEGAVDLPPDVPLNPG--AFQVSYAADLHQADRRALSEALRRQLPQFVYARPNSVAHVRIEQLNKRQHQGTLTCKIMNEVGFDERPIRVTFIPELEFEIRPPNKQDVTLAQNISINCTARPSELAPIIVWKYSDESTGDFKTLESLAERTEGRIYQEENGTLVISRVEESDPRKFLCFLTPKESTTATPISVAVNLEIHVPARIEPLKNV-DQVRGSKFNLTCVVHGDGNDLQANWYHRVSSGHPWRLINQTCVLPASYGDADSQALSLTPSDVASDPLACQKFAAGRFDSGVVFRQVSTLKQSGRGIERQLQFDSLKDVHMGDYMCNASNFYNRDEDGRRVDVREILRLTVISIPDPVTFVQNSSQTTATSVSFSWLPPAHNGNKEIRRYWIRYYQADSSASEFTSTQSKPSNVIEFRAHERQATLTGLRPYTKYNIAIKAENEVGFSLENSLVLTTQEAKPDGPVQQLNASGVASDTIYVAWQKPKPELRNGNVDRYSVCHQRVNESLTGNGQEDLARLPWPTDLITEDASVGSGLSQIHCAIMYRQQDTELVG---LPKFTAYAIRVIAINSKGQSPPAYALARTLEDLPQAPPTNVTCFTQQHSITVSWDPPNFETVNGILTEYLVNYYIANDFGDETNSVIQVVKGQTTVTLAGLLANTKYIIQVAASNRKGRGPLSPKKACVTTEAPPEAPENIKALPVNDSCVIVSWSHPIRPQGLTRLYCLAAYRQDNMYRSPGGIMSAGPRCIKPDFTKPYNYYLFCDLNPHYLYNISVMAKNRFDGRKAYVSSIAPSSHPAVSIISIGGTIVAQEKMRVLMDCLV---DGHPPVAWISSPHGM-PKDVQHLDNGTLIIEAVEPRHTGRYVCRHQDDSISYELKVQG 1768          
BLAST of Down syndrome cell adhesion molecule vs. TrEMBL
Match: A0A3R7FKW7 (Down syndrome cell adhesion molecule-like protein (Fragment) OS=Clonorchis sinensis OX=79923 GN=DSCAM PE=4 SV=1)

HSP 1 Score: 508.064 bits (1307), Expect = 2.180e-142
Identity = 427/1612 (26.49%), Postives = 725/1612 (44.98%), Query Frame = 3
Query:  243 TDHSRVYCTATGNPSPKI--KWYYETTQRNVFTEVND---PDRFVVGTNGDMDIFIQANIE----VIYCKAQNELGTVRS-KTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRNIYTDIDVKSHDWISPKRLEDNSKIDFT---SICQNIEVRVIKGSTLELPWCSMPNNQKIA-WYWSSAVSSRRHLVNL----------------------------------SGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTVVNARYNEIVQLKCVATGYPRLSLLWLFNG---------NEFNSSKSFETDTNFSRTSH---------ITIRVNADTAGVYQCLAESRDNAEN--------------------------------------------RILSED-QKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDG---SSFQIQCKFNRVPNGTVAWYLDDKKIPM--VNVLIPNTT--YRLPYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLT-HGSELRLKCYVISGLKPTIEWFRDAKGKLV-RLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLNNLKISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSE----KYTDNGAALPKGVPNFVRYQHNKIAQIWI-KYNEKLHLSQISCVVQNHAGTIRKTIQIS-IDNLVFKESPPLDYSIVLGQSFALNCSAKPTNIQLKTNWFXXXXXXX-----XXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKEDGNWDSLPVKRIKEKSKVSRFFVKFESVTDSLFGEYKCVASNEHRKNG------VERIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSW------KL---------VTENWFINATTKETSITIEDLRPFKEYDIAIVAENSVGYGEEATIIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRS-LEKFAWP--SPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSPAKYVAIRTLEDKPEGTPIQVLCSPKANFLFLEWNPPPQNVTNGVISGYEVTYFSDDK-HEEPDKLMKNVK-ETHLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIKAY-FYQNCLKVSWTPPIKANGHIREYII----VFSFEPNNMITVS---SRENDKP----------YYSWELCSEQICSNCNVSVLAVTTMKGPRKTVN----VLSNKMGILSFXXXXXXXXXXXXXLYCEVAFPDENIYYLWTHNDKDIYGQGVQSNGSLVINSMAESDQGIYKCKVKSEEITYNV 4541
             +H     +  G+P+P      YY + +R+   E+ D     + +V  +G ++ F  A +     V++C+A+N LG  RS K +  Q  +  +++++   T  +   QKAVI+C    ++      V YWEI    +   +  +  +  RFS+IN ++ P+LHIR+VT+A+   +EVRC++++I  D  VK       +       + +T   S+  +++  V++GST+ELPW         A W++ + ++  R+L++                                    G+++++++  +GNL + N+ +A+ G +    P   + P + +TV+V   + V I P+     +   V+L C+ TG PR  + WL NG            +   +  + T +  TS          I      +  GVYQC+ E+     +                                            R L+++ Q +  +++ +M P L WQ+P V+P+      +L       ++  ++C+F   P   + W+ DD  IP+    V+ P        PYT+I  L+ID+    ++EE W +GGEYRA  TN +G+A C T + +     +R    + +   G    LKCY I    P ++W R   G+ + R+P  H   + EDGR+  I ++ +     +Y C + L +   + T  + +++ P +  +LP +  +    DT S +C  +++ D PWYAWWEF+   +N  +PL ++     ++  +      ++ SE    +  D   +L   VP F + + N    + + K  ++ H   ++CVV N  G  R++I+I+ I  L F   PP +  + LGQ+  ++C+AKP++++    W  +  +         ++     RI Q  NGTL++ N++ +DP +F+C +KP  G+                       +       +++N  VHG     V +++         P KR  +K       ++F SV ++  GEY C ASN   ++       VE  + L V+ VPG V I   S R+ + ++   W+ P  DG KPI +Y + +      KL         VTE   I        I +E LRP+  Y I +VA N VG  EE  + + TQ   P+GPV  L+A   + D + + W++P    +NG    Y VC   +  + + S L +  WP  SP+  + + V      V   C  +        VT L  FT YAFRVI +N+ G SP  +   RTLED P+  P  V C+ + + + + WNPP  +  NG+++ Y V YF+ +   +E   + + V+ +T + L  L A + Y IQ+ V N  G GP S  I C T EA P  P+ +KA     +CL VSW+ P K  G  ++Y I    +     + +I +S   S E  K           Y  +  C        N+SV A    +G +        V +   GI+S    + VQN   V + C V     N    W++   D+ G  +  NG+L I S   +  G Y+C V S+ I+Y++
Sbjct:  197 ANHLETSSSLAGHPAPSGLESSYYSSFERDQVNELLDQVVSTKSIVVGDGWLN-FTAAGVAAMRWVLFCQAENYLGRARSRKMVAHQVPLPDENLRIIYNTFHIDPGQKAVISCHPEQSIFNRFLKVHYWEIYM--NGTLIHTVDHSFDRFSMINVTKHPELHIRSVTEAELEGLEVRCVLQSI-VDESVKVERPERGRLRRLRMGLFYTEQRSVSSDVD--VLRGSTVELPWAVEGKAPVGANWFYVNTLTGVRYLLSSDTPLPLPDGSGKGISPANSSQHSYGGRKVPRFLPGGTEYELVNGAYGNLRLINLSVADSGQFMVEVP-YSARPQVKYTVQVRAPLGVKITPSQRTVDWGSHVELDCIVTGNPRHLVYWLHNGRPAPRRHHVRTVSGPAAATSSTEYVGTSKSLDSLSQRLIIEAFTLEDVGVYQCVVENGQTVGSLASNVLPTLTGSFHSDTTAAGSSESPDRDLTHPPVSLPTAGEVLRDLTDNAQATALLLMGKMRPSLKWQNPAVEPTSIKAQVLLSIHSVATTNVTLECRFAANPTPKIDWFRDDLPIPLEQAGVIAPELAEDTSTPYTLITRLRIDIRKAPNLEELWVFGGEYRAVATNPHGEADCRTYVLLETPLRLRPMDALKVAIAGRAHTLKCYFIGSGIPALQWHRIKNGREIQRIPVDHRHHLLEDGRVLRITEISQEEDEAEYRCTAILGDHSANSTVKLKVSHAPRLF-ELPQTRQVKYTHDTLSYSCTLQNRADKPWYAWWEFQHEGTNALIPLPASKQERYNEFVVSYMDDLVSRSEGPPWRLPD---SLRDKVPLFAQSEPNAGVHVSVNKLQKEKHHGNLTCVVVNEVGEDRQSIRITFIPELEFAIRPPNNQDVTLGQTMTIDCAAKPSDLKPVVEWKYLQKTTGNYVGVSELSEATNGRIRQYSNGTLLLSNVDESDPREFLCFLKP--GR-----------------------LSTAAQRSSAVNLEVHGKSLSVVAFFK---------PNKRGLDKQ------LQFISVKEAHMGEYLCRASNRFNRDAQGARTEVEVFVRLTVISVPGPVNIVYNSSRTTATTVFFEWHAPTHDGNKPIRKYRIRYAPSEPSKLSLSRGPQPNVTE---IEVDESTRQILLEGLRPYTMYRITLVAINDVGPSEENVLPLTTQEAKPDGPVRRLVANGTASDTIVVSWDNPAPEHLNGNVDRYWVCRQRVNATFSTSELARLTWPADSPDHMSGQPVRGRFGHVH--CAKILRQK-DYEVTGLPKFTAYAFRVIALNSKGSSPPAFTQARTLEDLPQAPPTDVTCTSQQHSITVSWNPPHPDTINGILTEYHVRYFAANVFGDETTSVNQAVQGQTTVTLAGLLAFTNYSIQVAVSNRKGRGPSSTRIICRTKEAPPTAPDRVKATPLNASCLVVSWSHPRKPQGLTKQYCIEAIPLVKAPQDGLIGLSGSPSPERAKALCVRPDFSMSYNQYTYCGLMEQRPYNISVRATNHFEGHKAWTGPVYPVANPPPGIISIGGKLQVQNKMPVSMDCLVT---TNYPVRWSYPLDDLDGISLLDNGTLSIKSTETAHSGTYQCTVLSDTISYDL 1748          

HSP 2 Score: 445.662 bits (1145), Expect = 1.229e-122
Identity = 393/1454 (27.03%), Postives = 634/1454 (43.60%), Query Frame = 3
Query: 1260 SKSFETDTNFSRTSHITIR------VNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDG---SSFQIQCKFNRVPNGTVAWYLDDKKIPM--VNVLIPNTT--YRLPYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLT-HGSELRLKCYVISGLKPTIEWFRDAKGKLV-RLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLNNLKISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSE----KYTDNGAALPKGVPNFVRYQHNKIAQIWI-KYNEKLHLSQISCVVQNHAGTIRKTIQIS-IDNLVFKESPPLDYSIVLGQSFALNCSAKPTNIQLKTNWFXXXXXXX-----XXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKEDGNWDSLPVKRIKEKSKVSRFFVKFESVTDSLFGEYKCVASNEHRKNG------VERIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSW------KL---------VTENWFINATTKETSITIEDLRPFKEYDIAIVAENSVGYGEEATIIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRS-LEKFAWP--SPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSPAKYVAIRTLEDKPEGTPIQVLCSPKANFLFLEWNPPPQNVTNGVISGYEVTYFSDDKH-EEPDKLMKNVK-ETHLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIKAY-FYQNCLKVSWTPPIKANGHIREYII----VFSFEPNNMITVS---SRENDKP----------YYSWELCSEQICSNCNVSVLAVTTMKGPRKTVN----VLSNKMGILSFXXXXXXXXXXXXXLYCEVAFPDENIYYLWTHNDKDIYGQGVQSNGSLVINSMAESDQGIYKCKVKSEEI-----------------------TYNVSTKSI----------------------------------SLVPQTPYIEITKVSTNHIALLWRSNGSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSNPAISQAQ---TRGS----------------IPEIPDTSNIVTEIGPHSMCFNLRAFRPGRGCPANKYILKLWPSSEGNHQESGVSVWKVVNDSDL-------NQIPCFNVTDLHPNTDYVYSIEASNMVGSQKAKAH 5150
            + SF +DT  + +S    R      V+  TAG  + L +  DNA        Q +  +++ +M P L WQ+P V+P+      +L       ++  ++C+F   P   + W+ DD  IP+    V+ P        PYT+I  L+ID+    ++EE W +GGEYRA  TN +G+A C T + +     +R    + +   G    LKCY I    P ++W R   G+ + R+P  H   + EDGR+  I ++ +     +Y C + L +   + T  + +++ P +  +LP +  +    DT S +C  +++ D PWYAWWEF+   +N  +PL ++     ++  +      ++ SE    +  D   +L   VP F + + N    + + K  ++ H   ++CVV N  G  R++I+I+ I  L F   PP +  + LGQ+  ++C+AKP++++    W  +  +         ++     RI Q  NGTL++ N++ +DP +F+C +KP  G+                       +       +++N  VHG     V +++         P KR  +K       ++F SV ++  GEY C ASN   ++       VE  + L V+ VPG V I   S R+ + ++   W+ P  DG KPI +Y + +      KL         VTE   I        I +E LRP+  Y I +VA N VG  EE  + + TQ   P+GPV  L+A   + D + + W++P    +NG    Y VC   +  + + S L +  WP  SP+  + + V      V   C  +        VT L  FT YAFRVI +N+ G SP  +   RTLED P+  P  V C+ + + + + WNPP  +  NG+++ Y V YF+ +   +E   + + V+ +T + L  L A + Y IQ+ V N  G GP S  I C T EA P  P+ +KA     +CL VSW+ P K  G  ++Y I    +     + +I +S   S E  K           Y  +  C        N+SV A    +G +        V +   GI+S    + VQN   V + C V     N    W++   D+ G  +  NG+L I S   +  G Y+C V S+ I                       ++  ST S+                                  S  P+ P       S   I   W S GS + + PI  F +   N        +++ ++ R+  + NL C T     L A N  G  N ++++A    T GS                + +     N +T +      FNL +F PG GCP   Y L + PS +G      + + + +  +DL        +  C+NVT+L+P   Y Y I A+N  GS   +  
Sbjct:  644 TGSFHSDTTAAGSSESPDRDLTHPPVSLPTAG--EVLRDLTDNA--------QATALLLMGKMRPSLKWQNPAVEPTSIKAQVLLSIHSVATTNVTLECRFAANPTPKIDWFRDDLPIPLEQAGVIAPELAEDTSTPYTLITRLRIDIRKAPNLEELWVFGGEYRAVATNPHGEADCRTYVLLETPLRLRPMDALKVAIAGRAHTLKCYFIGSGIPALQWHRIKNGREIQRIPVDHRHHLLEDGRVLRITEISQEEDEAEYRCTAILGDHSANSTVKLKVSHAPRLF-ELPQTRQVKYTHDTLSYSCTLQNRADKPWYAWWEFQHEGTNALIPLPASKQERYNEFVVSYMDDLVSRSEGPPWRLPD---SLRDKVPLFAQSEPNAGVHVSVNKLQKEKHHGNLTCVVVNEVGEDRQSIRITFIPELEFAIRPPNNQDVTLGQTMTIDCAAKPSDLKPVVEWKYLQKTTGNYVGVSELSEATNGRIRQYSNGTLLLSNVDESDPREFLCFLKP--GR-----------------------LSTAAQRSSAVNLEVHGKSLSVVAFFK---------PNKRGLDKQ------LQFISVKEAHMGEYLCRASNRFNRDAQGARTEVEVFVRLTVISVPGPVNIVYNSSRTTATTVFFEWHAPTHDGNKPIRKYRIRYAPSEPSKLSLSRGPQPNVTE---IEVDESTRQILLEGLRPYTMYRITLVAINDVGPSEENVLPLTTQEAKPDGPVRRLVANGTASDTIVVSWDNPAPEHLNGNVDRYWVCRQRVNATFSTSELARLTWPADSPDHMSGQPVRGRFGHVH--CAKILRQK-DYEVTGLPKFTAYAFRVIALNSKGSSPPAFTQARTLEDLPQAPPTDVTCTSQQHSITVSWNPPHPDTINGILTEYHVRYFAANVFGDETTSVNQAVQGQTTVTLAGLLAFTNYSIQVAVSNRKGRGPSSTRIICRTKEAPPTAPDRVKATPLNASCLVVSWSHPRKPQGLTKQYCIEAIPLVKAPQDGLIGLSGSPSPERAKALCVRPDFSMSYNQYTYCGLMEQRPYNISVRATNHFEGHKAWTGPVYPVANPPPGIISIGGKLQVQNKMPVSMDCLVT---TNYPVRWSYPLDDLDGISLLDNGTLSIKSTETAHSGTYQCTVLSDTISYDLVVQERWSHLTFCMEKDFLKSFTCSTLSVLNYHATGRKHDGWDSARLPNLDRRSRDEEVGFEPSEPPRRPIWHKFTPSLRGIQAEWLSPGSKRLDAPILWFYLNWTNVYTGIQDAVQLPADQRTYYLSNLTCATTVKFQLCAANKVG--NSSLTEATSWTTLGSGKPQAAFQARKNRAFLLQQYERYLNFLTAV-----TFNLSSFLPGSGCPPLFYRLLIAPSEDGQFGLKQMVINRTLTRADLITLDGLDRERCCYNVTNLNPGVHYHYKIVATNPAGSASIQGQ 2027          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Cavefish
Match: dscamb (Down syndrome cell adhesion molecule-like [Source:NCBI gene;Acc:103044167])

HSP 1 Score: 277.715 bits (709), Expect = 2.122e-74
Identity = 399/1674 (23.84%), Postives = 668/1674 (39.90%), Query Frame = 3
Query:  294 IKWYYETTQRNVFTEVND-PDRFVVGTNGDMDI--FIQA------NIEVIYCKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRNIYTDIDVKSHDWISPKRLEDNSKIDFTS-ICQNIEVR-VIKGSTLELPWCSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDG---RLFIIEKVDKVIHSGKYICNSTLNNLK-ISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQISIDNLVFKESPPLDYSIVLGQSFALNCSAK--PTNIQLKTNWFXXXXXXXXXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKEDGNWDSLPVKRIKEKSKVSRFFVKFESVTDSLF-------------GEYKCVASNEHRKN-GVERIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWKLVTENWFINATTKETS-----ITIEDLRPFKEYDIAIVAENSVGYGEEAT-IIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSP-AKYVAIRTLEDKPEGTPIQVLCSPKA-NFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNV--KETHLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPP-NEIKAYFYQNCLKVSWTPPIKANGHIREYIIVFSFEPNNMITVSSRENDKPYYSWELCSEQICSNCNVSVLAVTTMKGPRKTVNVL-------SNKMGILSFXXXXXXXXXXXXXLYCE-VAFPDENIYYLWTHNDKDI-----YGQGVQSNGSLVINSMAESDQGIYKCKVK----SEEITYNVSTKSISLVPQTPYIEITKVSTNHIALLW--RSNGSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSN-PAISQAQTRGSIPEIPDTSNIVTEIGPHSMCFNLRAFRPGRGCPANKYILKLWPSSEGNHQESGVSVWKVVNDSDLNQIPCFNVTDLHPNTDYVYSIEASNMVG 5129
            ++WY  T +     E+ D P    V  NG + I  F+ +      N    YC A+N  G +RS+ + + K +  +   VR   + V     AV  C++  ++  Y+  V  WE     D+  ++    +  R+ + +      L+I +V   D  ++  RC  R+ YT    +S+      RL  +  +D    I    E + V+ G  +ELP C    +    + W    S        S S+F    +    LLI+    ++ G Y         N  +   ++V   +   + P  V       V L C  TG     + W  NG       S    T  +  + +   +     G YQC A       N  +S  Q  V VI+ +  P ++          ++   V+  +     + C     P  TV W LDD  +      I ++ +R+   + A     LS +     +   GG YR    N  G       I V     IR   ++T   G +  + C +I     +I+W++D+      LP  H Q   E+    +L+ ++  D+    G+Y C   ++  K I ++  VT+  PP++      S S+ +      + C+     DLP +  W       N S+ +     ++K D    ++   ++                                    ++H    +C+ +N A T+  +IQ+ +      E  P D   + G+S  LNCSAK  P    +  +          P+     SR+  L  G+L++K++   D   ++C +   VG D ISK + + +K+PA I + P+    ++ +   ++CT HG+  + V+W ++                  +SR+ V  + V D +              G + C+A N + ++ G+ ++I+ +  D P     + E      R+IA+ W     DG  PIT Y +++K  +  W  + TTK+ S      TI +L P   Y+I + A+N +G    +  + I T    P+G   ++   S S   +K+ W++P++ L NG+ + YQVC  E Y +           SP  +T               ++    T  IT+  L  +T+Y  RV   N  G  P ++   I TLED P   P  V+ +      + L W+  P+   NG++ GY V Y+++    E  ++ KNV   +  L+L NL   + Y IQ+      G G  SE I   T E  P PP     A    + + VSW PP+K NG IR+Y +   F  N   TV S     P   +   +  +  N   S+  V      R   + +            IL+FS ++       +VL C+ V  P   + +L  +N           + V +NGS VI ++   D G Y C       S+EI  N+    + + P  P + +TK +T  I L W    NG       I  +++     N        +S + RS  + NL+CGT Y   L A+N  GP     I +A+T G  P+      + + I    +  NL  +  G GCP N + L+  P           +VW  V+ + L +     + DL   T Y   +   N  G
Sbjct:   56 LRWYLATGE-----EIYDVPGIRHVHPNGTLQIYGFLPSSFSNLINDNTYYCTAENPSGKIRSQDLHI-KAVFREPYTVRVADQRVMRGNTAVFKCIIPASVEEYVTVVS-WE----KDTVSLV----SGSRYLITSTGA---LYILDVQSEDAVNI-YRCTTRHRYTGETRQSNS----ARLLLSEPVDSAPVILDGFEQKEVMVGRRVELP-CKASGHPPPRYRWLKDNSPLE-----SDSRFH---QSVSGLLIEATRPSDGGNYVCEVWNSFGNAKVVGRLQVKQPLKAVVSPRKVRGSVGSQVSLFCSVTGSDEYDITWYRNGERIQHGPSVRI-TGINHENLVMEGMAKSDGGAYQCFAR------NGKMST-QDFVQVILEDGTPKIL---------SAFSEKVVSPN-EPISLVCHVKGTPLPTVTWTLDDDPV------IKDSHHRMDRVITAESHT-LSYLNVSHTQVTDGGVYRCTCNNSAGSVSYQARINVRGPASIRPMKNLTAIAGRDTFIHCRIIGYPYYSIKWYKDSN----LLPFNHRQRAFENNGTLKLYNVQNSDE----GEYTCYVLVDPEKQIHRSVHVTVKVPPLIQHSDSQSASIGQR---VFIPCVVTSG-DLPMFITWHKDGKPINDSLGVT----IDKIDFTSSLRISNLS------------------------------------EIHNGSYTCIARNEAATVEHSIQLIVKVPPHFEVQPRDQDGIYGKSVILNCSAKGNPIPTIVWKHSKGAGVPQFQPIALNSGSRVQLLEKGSLLIKHVLEEDSGYYLCKVSNDVGAD-ISKSMYLTVKIPAMITSYPNTTRAEQGHMTEMSCTAHGEKPIKVRWEKESH-----------IINPDMSRYVVNVKEVADEVISTLQILHTVREDSGFFSCIAINSYGEDKGIIQLIVQDRPDPP-----EVEIREVKDRTIALRWT-MGFDGNSPITGYDINYKNKSAPWASSQTTKDVSPQLNQATIIELHPASTYNIRMFAKNQIGESRPSNELTITTDEAPPDGAPQDVQLESTSSQSIKVTWKAPHKHLQNGLIRSYQVCYRE-YGTGG---------SPQYNTIN-------------LDTTGDTETITLDNLKKYTQYEVRVQAANRAGMGPTSEEAVITTLEDVPSRPPENVVTTATTPETISLSWSALPKEALNGMLLGYRVIYWANLLDGELGEI-KNVTTGKPSLELENLEKYTNYSIQVLAFTRAGDGVRSEQIYTRTKEDVPGPPAGVKAAAASASVVFVSWLPPLKLNGIIRKYTV---FCSNPYPTVISEFEAAPDVYFRRVT-NLNQNWKYSIWVVAVTAAGRGNASEIITVEPQAKAPARILTFSGTVTTPWMRDIVLPCKAVGDPPPAVKWLKGNNGTPAPVSVDNRRSVHTNGSFVIRTVKAEDSGFYSCVASNNWGSDEIMLNL---QVQVPPDQPRLTVTKTTTTSITLSWIPGDNGGSS----IRGYILQYSEDNSEEWGSFPISPSERSYRLENLKCGTWYKFTLTAQNAVGPGRISEIIEAKTHGKEPQFAKDHELFSTINSTRVELNLIGWNNG-GCPINSFTLEYRPVD--------TTVWTTVSRAALTK--SHILYDLQEATWYELQMRVGNSAG 1556          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Cavefish
Match: dscaml1 (Down syndrome cell adhesion molecule like 1 [Source:ZFIN;Acc:ZDB-GENE-110601-1])

HSP 1 Score: 271.166 bits (692), Expect = 1.957e-72
Identity = 412/1710 (24.09%), Postives = 657/1710 (38.42%), Query Frame = 3
Query:  264 CTATGNPSPKIKWYYETTQRNVFTEVND-PDRFVVGTNGDMDI----------FIQANIEVIYCKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRNIYTDIDVKSHDWISPKRLEDNSKIDFTSICQNIEVRVIKGSTLELPW-CSMPNNQKIAWYWSS---AVSSR--RHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLN-NLKISKTFSVTIANPPIMLS-DLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQISIDNLVFKESPPLDYSIVLGQSFALNCSAK---PTNIQLKTNWFXXXXXXXXXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKE-----DGNWDSLPVKRIKEKSK--VSRFFVKFESVTDSLFGEYKCVASNEHRKNGVERIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWKLVTENWFINATTKETSIT-----IEDLRPFKEYDIAIVAENSVGYGEEAT-IIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSPAKY-VAIRTLEDKPEGTPIQVLC-SPKANFLFLEWNPPPQNVTNGVISGYEVTY---FSDDKHEEPDKLMKNVKET--HLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIK-AYFYQNCLKVSWTPPIKANGHIREYIIVFSFEPNNMITVSSRENDKPYYSWELCSEQICSNCNVSVLAVTTMKGPRKTVNVLSNKMG-----ILSFXXXXXXXXXXXXXLYC-EVAFPDENIYYLWTHNDKD----IYGQG---VQSNGSLVINSMAESDQGIYKCKVKSEEITYNVSTKSISLV----PQTPYIEITKVSTNHIALLW--RSNGSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSN-PAISQAQTRGSIPEIPDTSNIVTEIGPHSMCFNLRAFRPGRGCPANKYILKLWPSSEGNHQESGVSVWKVVNDSDLNQIPCFNVTDLHPNTDYVYSIEASNMVGSQKAKAHNKTRQIV------STAPP 5186
            C A G P   ++WY  T       ++ D P    V  NG + +          FI  N    +C A+N+ G +RS +I V K +  +   VR   +       AV  CL+ P+ +     V  WE       K  + I      F  +  +    L+I +V K D +    RCI ++ Y+    +S+           S        Q+ EV+V  G ++ELP   S   N  I W          SR  R L  L+ S  ++  ED GN       I E    + S         +T  + V+  + V + P  +    +  V L C   G P  ++ W  N       + F    + + T  IT       +G YQC A  +           Q    +++ +  P ++          S+   V+   G  F + C     P  T+ W LDD+ I        ++ +R     ++     +S +     + + GG YR    N  G A     I V     IR   +IT   G    + C VI     +I+W++D     + LP+ H Q V E+G L + + V K +  G Y+C+  +   L IS+T  VT+  PP++   D P + S+ K      + C+                               ++  D+ I I ++K         +G  +  G           ++ + I      H    +C+  N A T+    Q+ +         P +   + G+S  LNCS     P  +  K        +        +  RI  +PNG+L+++++   D   ++C     VG D ISK + + +K+PA I + P+     +     LNCT  G+  + ++W R +     D N          EKS   +S   +K     DS+F  + C A N + +     +I L V + P    +  E      RS+ + W     DG   IT Y + +K  ++ W +   T++ S T     I +L P   Y I + + N +G  + +  + I T+   P+GP ++++   ++   +++ W++P + L NG+ + YQ+   E     N         +  DS                        V T+  L  F +Y   V   N  G  P+   +   TLED P   P  V   +  ++   + W+ PP+   NGV+ GY V +   F D +  E    M+N+  T   ++L  L   + Y +Q+      G G  S  +   T E  P PP  IK      + + VSW PP K NG IR+Y I  S   +     S  E +     + +          +   AVTT      +  V     G     ILSF  ++      +V L C  V  P   I   WT + +D    +   G   +  NG+LV+ S+   D G Y C   +   T    T  I+LV    P  P + ++  ST+ I L W    NG       I  F++     N    R++ +SS+ RS  + NL CGT Y V L AKN  G      I +A+T G  P+      + T I       NL+ +  G GCP N  +L   P         G   W  V  +    +    + +L   T Y   ++A N  G       N+T Q        ST PP
Sbjct:   47 CPAGGAPHAVLRWYLATGD-----DIYDVPHIRHVHANGTLQLYPFSPSAFNSFIHDND--YFCTAENQAGKIRSPSIRV-KAVFREPYTVRVADQRSMRGNVAVFKCLI-PSAVQEYVSVVSWE-------KDTVSIVPGNRFFLTLYGA----LYISDVQKED-ALSTYRCITKHKYSGETRQSNGARLSVLDPTESPPSVMDSFQSGEVQV--GRSIELPCIASGYPNPTIRWLKDGRPLPADSRWTRRLTGLTISDLRL--EDSGNY------ICEVTNSFGSK-------EVTGHLNVIEPLRVTLSPKNLKTGISSTVILSCAVQGSPHFTVSWFRNTEPVLPDQHFSIQGSHNETLFITA-AQKRHSGAYQCFATRKGQTA-------QDFSIILLEDGTPRIV---------SSFSERVV-APGEPFSLMCAAKGAPPPTITWTLDDEPIAR------DSAHRASQYTLSDGST-VSHVNVSNPQIRDGGVYRCAARNSAGSAEYQARINVRGPPSIRAMRNITAVAGRNTFINCRVIGYPYYSIKWYKDG----MLLPDNHRQVVYENGTLKLSD-VQKGMDEGAYLCSVLIQPQLSISQTVYVTVKVPPLIQPFDFPPT-SIGK---LMYIACV-------------------------------VSSGDMPIRITWRK---------DGQEIVSGTSGVTIETKEFMSSLQISKVSLKHNGNYTCIASNDAATVSSERQLIVTVPPRFRVQPNNQDGIYGKSGVLNCSVDGYPPPKVMWKHA--KGIGNPQQYHPVPLTGRIQIMPNGSLLIRHVLEEDRGYYLCQASNGVGSD-ISKSMLLTVKIPAMITSHPNTTMAIKGQNKELNCTARGEYPIIIRWERGDTVIDPDRNPRYSITTSPNEKSDEVISTLKLKPAERGDSVF--FSCHAINSYGEG--RGLIQLTVQEPPDPPEL--EVREVKDRSMNLRWTQ-RFDGNSIITSYDIEYKNKSDPWELKHATRKISPTNNQANIVELHPASVYSIRMYSYNKIGRSQASKELTISTEEAPPDGPPMDVILQPMTSQSIRVTWKAPKKELQNGVIRGYQIGYRENGPGSNGQYSIVEMKATGDSE-----------------------VYTLDNLKKFAQYGVVVQAFNRAGTGPSSSEINATTLEDVPSQPPQNVRAITVTSDEAVITWSEPPRMTLNGVLKGYRVVFWSLFPDGEWGE----MQNITTTREQVELRGLEKFTNYSVQVLAYTQAGDGVRSNVLYIQTREDHPGPPAGIKAVPSSASSVVVSWLPPHKPNGIIRKYTIYCSSPGSGQPAPSEYEANPEVLFYRITHLTRGQQYLIWAAAVTTAGRGNISEKVTVEPAGKAPAKILSFGGTVTTPWMKEVRLPCSSVGEPTPTIK--WTKDSEDSAIPVTQDGHRNILVNGTLVLRSVKAEDSGYYTCTATN---TLGFDTIIINLVVQVPPDQPRLTVSTTSTSSITLAWIPGDNGGSS----IRGFVLQYSVDNTEEWRDVFISSSERSFKLDNLRCGTWYKVKLAAKNSVGAGRISEIIEAKTHGREPQFNKDQPLFTHINSTHARLNLQGWTSG-GCPINAVLLDFRP--------KGTWAWHSVRTNATTDV---FLAELREATWYELKMKACNSAG-----CGNQTSQFATLDYDGSTIPP 1581          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Cavefish
Match: dscamb (Down syndrome cell adhesion molecule-like [Source:NCBI gene;Acc:103044167])

HSP 1 Score: 263.848 bits (673), Expect = 3.348e-70
Identity = 367/1531 (23.97%), Postives = 609/1531 (39.78%), Query Frame = 3
Query:  696 LHIRNVTKADFSDMEVRCIMRNIYTDIDVKSHDWISPKRLEDNSKIDFTS-ICQNIEVR-VIKGSTLELPWCSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDG---RLFIIEKVDKVIHSGKYICNSTLNNLK-ISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQISIDNLVFKESPPLDYSIVLGQSFALNCSAK--PTNIQLKTNWFXXXXXXXXXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKEDGNWDSLPVKRIKEKSKVSRFFVKFESVTDSLF-------------GEYKCVASNEHRKN-GVERIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWKLVTENWFINATTKETS-----ITIEDLRPFKEYDIAIVAENSVGYGEEAT-IIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSP-AKYVAIRTLEDKPEGTPIQVLCSPKA-NFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNV--KETHLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPP-NEIKAYFYQNCLKVSWTPPIKANGHIREYIIVFSFEPNNMITVSSRENDKPYYSWELCSEQICSNCNVSVLAVTTMKGPRKTVNVL-------SNKMGILSFXXXXXXXXXXXXXLYCE-VAFPDENIYYLWTHNDKDI-----YGQGVQSNGSLVINSMAESDQGIYKCKVK----SEEITYNVSTKSISLVPQTPYIEITKVSTNHIALLW--RSNGSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSN-PAISQAQTRGSIPEIPDTSNIVTEIGPHSMCFNLRAFRPGRGCPANKYILKLWPSSEGNHQESGVSVWKVVNDSDLNQIPCFNVTDLHPNTDYVYSIEASNMVG 5129
            L+I +V   D  ++  RC  R+ YT    +S+      RL  +  +D    I    E + V+ G  +ELP C    +    + W    S        S S+F    +    LLI+    ++ G Y         N  +   ++V   +   + P  V       V L C  TG     + W  NG       S    T  +  + +   +     G YQC A       N  +S  Q  V VI+ +  P ++          ++   V+  +     + C     P  TV W LDD  +      I ++ +R+   + A     LS +     +   GG YR    N  G       I V     IR   ++T   G +  + C +I     +I+W++D+      LP  H Q   E+    +L+ ++  D+    G+Y C   ++  K I ++  VT+  PP++      S S+ +      + C+     DLP +  W       N S+ +     ++K D    ++   ++                                    ++H    +C+ +N A T+  +IQ+ +      E  P D   + G+S  LNCSAK  P    +  +          P+     SR+  L  G+L++K++   D   ++C +   VG D ISK + + +K+PA I + P+    ++ +   ++CT HG+  + V+W ++                  +SR+ V  + V D +              G + C+A N + ++ G+ ++I+ +  D P     + E      R+IA+ W     DG  PIT Y +++K  +  W  + TTK+ S      TI +L P   Y+I + A+N +G    +  + I T    P+G   ++   S S   +K+ W++P++ L NG+ + YQVC  E Y +           SP  +T               ++    T  IT+  L  +T+Y  RV   N  G  P ++   I TLED P   P  V+ +      + L W+  P+   NG++ GY V Y+++    E  ++ KNV   +  L+L NL   + Y IQ+      G G  SE I   T E  P PP     A    + + VSW PP+K NG IR+Y +   F  N   TV S     P   +   +  +  N   S+  V      R   + +            IL+FS ++       +VL C+ V  P   + +L  +N           + V +NGS VI ++   D G Y C       S+EI  N+    + + P  P + +TK +T  I L W    NG       I  +++     N        +S + RS  + NL+CGT Y   L A+N  GP     I +A+T G  P+      + + I    +  NL  +  G GCP N + L+  P           +VW  V+ + L +     + DL   T Y   +   N  G
Sbjct:   35 LYILDVQSEDAVNI-YRCTTRHRYTGETRQSNS----ARLLLSEPVDSAPVILDGFEQKEVMVGRRVELP-CKASGHPPPRYRWLKDNSPLE-----SDSRFH---QSVSGLLIEATRPSDGGNYVCEVWNSFGNAKVVGRLQVKQPLKAVVSPRKVRGSVGSQVSLFCSVTGSDEYDITWYRNGERIQHGPSVRI-TGINHENLVMEGMAKSDGGAYQCFAR------NGKMST-QDFVQVILEDGTPKIL---------SAFSEKVVSPN-EPISLVCHVKGTPLPTVTWTLDDDPV------IKDSHHRMDRVITAESHT-LSYLNVSHTQVTDGGVYRCTCNNSAGSVSYQARINVRGPASIRPMKNLTAIAGRDTFIHCRIIGYPYYSIKWYKDSN----LLPFNHRQRAFENNGTLKLYNVQNSDE----GEYTCYVLVDPEKQIHRSVHVTVKVPPLIQHSDSQSASIGQR---VFIPCVVTSG-DLPMFITWHKDGKPINDSLGVT----IDKIDFTSSLRISNLS------------------------------------EIHNGSYTCIARNEAATVEHSIQLIVKVPPHFEVQPRDQDGIYGKSVILNCSAKGNPIPTIVWKHSKGAGVPQFQPIALNSGSRVQLLEKGSLLIKHVLEEDSGYYLCKVSNDVGAD-ISKSMYLTVKIPAMITSYPNTTRAEQGHMTEMSCTAHGEKPIKVRWEKESH-----------IINPDMSRYVVNVKEVADEVISTLQILHTVREDSGFFSCIAINSYGEDKGIIQLIVQDRPDPP-----EVEIREVKDRTIALRWT-MGFDGNSPITGYDINYKNKSAPWASSQTTKDVSPQLNQATIIELHPASTYNIRMFAKNQIGESRPSNELTITTDEAPPDGAPQDVQLESTSSQSIKVTWKAPHKHLQNGLIRSYQVCYRE-YGTGG---------SPQYNTIN-------------LDTTGDTETITLDNLKKYTQYEVRVQAANRAGMGPTSEEAVITTLEDVPSRPPENVVTTATTPETISLSWSALPKEALNGMLLGYRVIYWANLLDGELGEI-KNVTTGKPSLELENLEKYTNYSIQVLAFTRAGDGVRSEQIYTRTKEDVPGPPAGVKAAAASASVVFVSWLPPLKLNGIIRKYTV---FCSNPYPTVISEFEAAPDVYFRRVT-NLNQNWKYSIWVVAVTAAGRGNASEIITVEPQAKAPARILTFSGTVTTPWMRDIVLPCKAVGDPPPAVKWLKGNNGTPAPVSVDNRRSVHTNGSFVIRTVKAEDSGFYSCVASNNWGSDEIMLNL---QVQVPPDQPRLTVTKTTTTSITLSWIPGDNGGSS----IRGYILQYSEDNSEEWGSFPISPSERSYRLENLKCGTWYKFTLTAQNAVGPGRISEIIEAKTHGKEPQFAKDHELFSTINSTRVELNLIGWNNG-GCPINSFTLEYRPVD--------TTVWTTVSRAALTK--SHILYDLQEATWYELQMRVGNSAG 1410          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Cavefish
Match: dscama (Down syndrome cell adhesion molecule a [Source:ZFIN;Acc:ZDB-GENE-050310-7])

HSP 1 Score: 244.202 bits (622), Expect = 2.554e-64
Identity = 351/1519 (23.11%), Postives = 604/1519 (39.76%), Query Frame = 3
Query:  744 RCIMRNIYTDIDVKSHDWISPKRLEDNSKIDFTSICQNIEVR-VIKGSTLELPWCSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLN-NLKISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQISIDNLVFKESPPLDYSIVLGQSFALNCSA----KPTNIQLKTNWFXXXXXXXXXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKEDGNWDS-----------LPVKRIKEKSKVSRFFVKFESVTDSLFGEYKCVASNEHRKNGVER-IILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWKLVTENWFINATTKETS-----ITIEDLRPFKEYDIAIVAENSVGYGEEATIIIKTQADA-PEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPES--TLVITVTELLTFTEYAFRVILVNNVGFSPAKY-VAIRTLEDKPEGTPIQVLCSPKA-NFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNVK-----ETHLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIKAYFYQN-CLKVSWTPPIKANGHIREYIIV-----------FSFEPNNMI-TVSSRENDKPYYSWELCSEQICSNCNVSVLAVTTM-KGPRKTVNVLSNKMGILSFXXXXXX--XXXXXXXLYCEVAF-PDENIYYLWTHNDKDIYGQGVQSNGSLVINSMAESDQGIYKCKVK----SEEITYNVSTKSISLVPQTPYIEITKVSTNHIALLW--RSNGSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSN-PAISQAQTRGSIPEIPDTSNIVTEIGPHSMCFNLRAFRPGRGCPANKYILKLWPSSEGNHQESGVSVWKVVNDSDLNQIPCFNVTDLHPNTDYVYSIEASNMVG 5129
            RC+ R+ YT    +S+   S +    +      +I    E R V+    +ELP C    +    + W   +   R L     ++F+   +    LLI+    ++ G Y         N  +   + V   + V + P  V       V L C  TG     L W  NG+  N+  S   +   ++ + +   +     G YQC A      + +I ++D   V VI+ +  P ++          ++   V+  +     + C     P   V W LDD      ++++ ++ +R+ +++ A   + +S +   + + +  G YR    N  G       I V     IR   ++T   G +  + C+VI     +I+W++++      LP    Q   E+     +  V K +  G+Y C+  +   +  +++  VT+  PP +    P             + C+ R   DLP    WE      N S+ +     ++K D    ++   +                                    +++H    +C+ +N A  ++   Q+ +      +  P D   + G++  LNCSA    +PT I+ K +          P+      RI  L NG+L++K++   D   ++C +   VG D +SK + + +K+PA I + P+     +  +  ++C  HG+  + V+W ++ +    S           + VK++ E+  +S   +      DS F  + C A N +   G +R II L V + P     K E      R+IA+ W     DG  PIT Y +  K  +  W     T++ S      TI +L P   Y+I + A+N +G  E +  +  T  +A PEGP  ++   ++S   +K+ W++P + L NG+ + YQVC  E   S N S +                         CI+V  +  T  +++  L  +T+Y   V   N+ G  PA   V   T+ED P   P +V  +  +   + L W  P +   NGV+ G+ + Y+++     PD  +  ++     +  L+L  L   + Y IQ+      G G  SE I   T E  P PP  +KA    N  + VSW PP+K NG IR+Y +            F   P+  +  V +   ++ Y  W +         +  V+ V  + K P +          IL+FS ++           L C  +  P   +        + I+G     NGS VI ++   D G Y C       ++EIT N+    + + P  P + +TK +T  I L W    NG       I  +++     N        +S + RS  + NL+CGT Y   L A+N  GP     I +A+T G  P+      + T I    +  NL  +  G GCP   + L+  P            VW     + L +   +N+ DL   T Y   ++  N  G
Sbjct:   10 RCMTRHRYTSETRQSN---SARLFVPDPTNSSPAILDGFEKREVMASHRVELP-CKASGHPAPKYRW---LKDNRPLE--PDTRFR---QSVTGLLIERAQPSDSGNYVCEVWNSYGNAEVIGRLLVKEPLRVVVSPRKVKGSVGSQVSLTCSVTGSGEYELSWYRNGDLINTGPSVHMN-GINKENLVMDGMAKSDGGAYQCFAR-----KGKISAQD--FVQVILEDGTPKIL---------SAFSEKVVSPN-EFVSLMCHVKGTPQPVVTWTLDD------DLVMKDSRHRMGHSITAEGNV-ISYLNISQTQVRDSGVYRCTCNNSAGTVSYQARINVRGPADIRPMKNLTAIAGRDTYIHCHVIGYPYYSIKWYKNSN----LLPFNDRQRAFENNGTLKLLNVQKELDEGEYSCHVLVQPQVFKNQSVYVTVKVPPFIQ---PFEFPRYSIGHRVFVPCVVRSG-DLPISIDWEKDGKPINASLDVT----IDKIDFTSSLRISNL------------------------------------QRVHNGTYTCIARNDAAVVKYQSQLIVRVPPRFKVQPKDQDGIYGKAVILNCSADGEPRPT-IEWKYS-KGAGVPQFHPIALNSGYRIQLLGNGSLLIKHVLEEDAGYYLCKVSNDVGAD-VSKSMYLNVKIPAMITSYPNNTLATKGEKIEMSCKAHGEKPIMVRWEKEVEKEKQSHMINPDMWRHTVTVKKVGEEV-ISTLEIYPTLREDSGF--FSCHAINSY---GEDRGIIQLTVQEPPEPP--KVEIREVKERTIALRWTM-GFDGNSPITGYDIECKNKSATWDKARRTRDVSPTLNLATIIELHPSSTYNIRMFAKNHIGDSEPSNELTVTTDEADPEGPPQDVTLEAISSQSIKVTWKAPQKHLQNGMIRGYQVCHRE--HSMNGSHQFI-----------------------CISVESTGETETLSLNNLKKYTQYEVVVQASNSAGPGPASSEVRATTMEDVPSRPPEKVQATATSPETISLSWLTPAKEALNGVLQGFRLIYWAN----LPDGELGEIRNMTTLQPPLELDGLEKYTNYSIQVLAFTRAGDGVRSEAIYTRTKEDVPGPPGGVKAAAASNSVVYVSWLPPLKLNGVIRKYTVFCSSSYPTVVSEFEAAPDEFLHRVQNLSRNRKYSIWVMAVTAAGRGNSSEVITVEPLAKAPAR----------ILTFSGTVTTPWMRDIVFALLCSTSGSPAPAV----IDGRRSIHG-----NGSFVIKTVKAEDSGYYTCVASNNWGTDEITLNL---QVQVPPDQPRLTVTKTTTTSITLSWIPGDNGGSS----IRGYILQYSEDNSEQWGSFPISPSERSYRLENLKCGTWYKFTLTAQNTVGPGRISEIIEAKTHGKEPQFSKEQELFTSINATCVRLNLIGWNDG-GCPITSFTLEYRPMDS--------PVWTKAQRTSLTK--SYNLMDLQEATWYELQMKVYNSAG 1365          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Cavefish
Match: sdk2b (sidekick cell adhesion molecule 2b [Source:ZFIN;Acc:ZDB-GENE-030131-8203])

HSP 1 Score: 118.242 bits (295), Expect = 7.626e-26
Identity = 100/349 (28.65%), Postives = 161/349 (46.13%), Query Frame = 3
Query: 3138 PNSDGKKPITRYLVSWK-LVTENWFINATT---KETSITIEDLRPFKEYDIAIVAENSVGYGE--EATIIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTE---YAFRVILVNNVGFSPAK-----YVAIRTLEDKPEGTPIQVLCSPKANFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMK-NVKETHLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIK-AYFYQNCLKVSWTPPIKANGHIREYIIVF 4136
            P SDG  P+  Y V  + L + NW +++ +     TS  ++ L+PF  Y   + A N +G  E  E +  I T  DAP+   + L  T  +   V ++W++P E  INGI   ++V   E+   + RS       SP+ S   +   ++ R      N+ + +  IT  EL   ++   Y  R+ + N VG  P       +V        P+   IQ   S  A  L + W+PPP +  NG I GY++ ++   +  E +KL    + E  +KL NL+  + Y+I +   N  G GP S P    T +AAP  P+ I  +      + VSW  P+  NG +  Y +++
Sbjct: 1291 PGSDGLSPVRYYTVQVRELPSRNWTVHSASVNHDSTSYIVDRLKPFTSYQFRVKATNDIGDSEYSEDSEAITTLQDAPDESPIILSVTPHTTTSVLIRWQAPAEERINGIPLGFRVRYRELLYDRLRSFSVQPINSPSTSWAELTSPYSIR------NLSDPS--ITQYELDNLSKHKRYEIRLSVYNAVGEGPTSSPQEVFVGEAVPTAPPQNVAIQ---SSTATQLDITWDPPPLDTQNGDIQGYKIYFWEFQRKNETEKLRTLFLPEGGVKLKNLTGYTTYMISVAPFNAAGDGPRSAPTRGRTQQAAPSAPSFIHFSELTTTSVNVSWGEPVFPNGILEGYRLIY 1628          

HSP 2 Score: 76.6406 bits (187), Expect = 3.068e-13
Identity = 86/331 (25.98%), Postives = 130/331 (39.27%), Query Frame = 3
Query: 3240 TIEDLRPFKEYDIAIVAENSVGYGEEA-TIIIKTQADAPEGPVLN--LLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFS--PAKYVAIRTLEDKPEGTPIQVLCSPKANF-LFLEWNPPPQNVTNGVISGYEVTY----------FSDDKHEEPDKL---------MKNVKE---THLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIKAYFYQNC--LKVSWTPPI--KANGHIREYIIVF 4136
            T+  L+P   Y   I A+   G+GE A  +++ T+  A   P     +   +V    V L WE  ++ L            +  Y  Q R L    W                 V  + +N   ++ +  V  L  FT Y FRV   N++G S       AI TL+D P+ +PI +  +P     + + W  P +   NG+  G+ V Y          FS      P            ++N+ +   T  +L NLS + +Y I++ V N +G GP S P      EA P  P +  A        L ++W PP     NG I+ Y I F
Sbjct: 1228 TVTGLKPESVYVFRITAQTRKGWGEAAEALVVTTEKRARPQPTSRPTVPQENVQARSVLLSWEPGSDGL----------SPVRYYTVQVRELPSRNW----------------TVHSASVNHDSTSYI--VDRLKPFTSYQFRVKATNDIGDSEYSEDSEAITTLQDAPDESPIILSVTPHTTTSVLIRWQAPAEERINGIPLGFRVRYRELLYDRLRSFSVQPINSPSTSWAELTSPYSIRNLSDPSITQYELDNLSKHKRYEIRLSVYNAVGEGPTSSPQEVFVGEAVPTAPPQNVAIQSSTATQLDITWDPPPLDTQNGDIQGYKIYF 1530          

HSP 3 Score: 65.4698 bits (158), Expect = 8.824e-10
Identity = 103/457 (22.54%), Postives = 173/457 (37.86%), Query Frame = 3
Query: 2826 SLNCTVHGDDELDVKWYRKEDG---NWDSLPVKRIKEKSKVSRFFVKFESVTDSLFGEYKC----VASNEHRKNGVERIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWKLVTEN---WFI---NATTKETSITIEDLRPFKEYDIAIVAENSVGYG--EEATIIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSPAKY-VAIRTLEDKPEGTPIQVLCSP-KANFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPD--KLMKNVKET-HLK-LYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIK-AYFYQNCLKVSWTPPIKANGHIREYII 4130
            +L C V  D  + V++  ++DG   N  S P  R+     +               G Y C    V  N+ R   +    L +  + P  V+   E            W  P  DG  P+ RY++    V+EN   W I   N   + T++T+  L P + Y   + A N+VG G   + T  +    + P  P  N++A+  +   + ++W+ P E   NG+ + Y V    +                   T   VD     ++   I+ P+ T ++ + +L+ +T Y   V   N  G     + V   TL+  P   P  V      +  +   W  P     NG+  GY++  +   + EE     +  N +++ H+  +  L   ++Y   +      G GP S      T+E  P     +         LKVSW  P + NG +  Y I
Sbjct:  443 TLTCGVTHDPSVSVRFVWEKDGQVMNPKSSPRLRLDGNGTL-----HISQTWSGDIGTYTCRVTSVGGNDSRSAHLRVRQLPHAPENPSAVLSSTEKRSINLT-----WAKP-FDGNSPLIRYMLE---VSENNAPWMILLANIEPESTAVTVSGLIPARSYQFRLCAVNNVGKGPFSKETERVSLPEEPPSAPPQNVIASGRTNSSIMIQWQPPPESQQNGVLRGY-VIRYRL-------------------TGLPVD-----IQYKNISNPDVTNLL-LEDLIIWTNYEIEVAAYNGAGLGVYSHKVTEWTLQGVPTVAPGNVQAEAVNSTSIRFTWAAPNPQFINGINQGYKLLAWEPGQEEEVTMVTVRPNFQDSVHVGYISGLKKFTQYYTSVLCFTTPGDGPRSAAKRIHTHEDTPGAVGHLSFTEILDTSLKVSWREPNEKNGVLTGYRI 859          

HSP 4 Score: 64.3142 bits (155), Expect = 1.700e-9
Identity = 75/262 (28.63%), Postives = 116/262 (44.27%), Query Frame = 3
Query: 3597 PESTLVITVTELLTFTEYAFRVILVNNVGFSP-AKYVAIRTLEDKPEGTPIQ-VLCSPKANF-LFLEWNPPPQNVTNGVISGYEVTY-FSDDKHEEPDKLMKNVKETHLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPD--PPNEIKAYFYQNCLKVSWTPPIKA--NGHIREYIIVFSFEPNN-----MITVSSRENDKPYYSWELCSEQICSNCNVSVLAVTT-MKGPRKTVNVLS------NKMGILSF 4322
            PEST V TV+ L+    Y FR+  VNNVG  P +K     +L ++P   P Q V+ S + N  + ++W PPP++  NGV+ GY + Y  +    +   K + N   T+L L +L   + Y I++   N  GLG  S  +   T +  P   P N          ++ +W  P     NG I +   + ++EP       M+TV     D  +  + +   +  +    SVL  TT   GPR     +         +G LSF
Sbjct:  574 PESTAV-TVSGLIPARSYQFRLCAVNNVGKGPFSKETERVSLPEEPPSAPPQNVIASGRTNSSIMIQWQPPPESQQNGVLRGYVIRYRLTGLPVDIQYKNISNPDVTNLLLEDLIIWTNYEIEVAAYNGAGLGVYSHKVTEWTLQGVPTVAPGNVQAEAVNSTSIRFTWAAPNPQFING-INQGYKLLAWEPGQEEEVTMVTVRPNFQDSVHVGY-ISGLKKFTQYYTSVLCFTTPGDGPRSAAKRIHTHEDTPGAVGHLSF 832          

HSP 5 Score: 58.5362 bits (140), Expect = 1.038e-7
Identity = 74/322 (22.98%), Postives = 129/322 (40.06%), Query Frame = 3
Query: 3129 WNPPNSDGKKPITR-YLVSWKLV---TENWFINATTKE-TSITIEDLRPFKEYDIAIVAENSVGYGEEATIIIK-TQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSPAKYVA-IRTLEDKPEGTPIQVLCSPKANFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNVKETH--------LKLYNLSANSKYIIQIRVKNNIGLGP-PSEPINCTTNEAAPDPPNEI 4046
            W PP    +  + R Y++ ++L     +  + N +  + T++ +EDL  +  Y+I + A N  G G  +  + + T    P     N+ A +V+   ++  W +PN   INGI + Y++ + E              P   +  T V  + N +         +S  V  ++ L  FT+Y   V+     G  P      I T ED P               L + W  P  N  NGV++GY +++      EE ++   N + TH         ++  L+A + Y I++    + G G   S  I+       P PP  +
Sbjct:  640 WQPPPESQQNGVLRGYVIRYRLTGLPVDIQYKNISNPDVTNLLLEDLIIWTNYEIEVAAYNGAGLGVYSHKVTEWTLQGVPTVAPGNVQAEAVNSTSIRFTWAAPNPQFINGINQGYKLLAWE--------------PGQEEEVTMVTVRPNFQ---------DSVHVGYISGLKKFTQYYTSVLCFTTPGDGPRSAAKRIHTHEDTPGAVGHLSFTEILDTSLKVSWREP--NEKNGVLTGYRISW------EEYNR--TNTRVTHYLPNVTLDYRVTGLTALTTYTIEVAAMTSKGQGQLSSSTISSGVPPELPGPPTNL 928          

HSP 6 Score: 57.7658 bits (138), Expect = 1.901e-7
Identity = 56/187 (29.95%), Postives = 84/187 (44.92%), Query Frame = 3
Query: 3615 ITVTELLTFTEYAFRVILVNNVGFSPAKYVA--IRTLEDKPEGTPIQV-LCSPKANFLFLEWNPPPQNVTNGVIS--GYEVTYFSDDK------HEEPDKLMKNVKETHLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPD-PPNEIKAYF-YQNCLKVSW--TPPIKANGHIREYII 4130
            + V  L  +T Y FR+  VN VG SP    +  I+TL+  P+  P+ V L +     L+L W P P+   NG     GY V Y           H  PD+L     E    + +L   ++Y ++++  N IG GP S+P+   T E+ P   P  + A+    + + V W   P    NG I  Y +
Sbjct:  981 LEVPALNPYTFYRFRMRQVNIVGTSPPSQPSRKIQTLQAPPDMAPVNVTLRTASETSLWLRWVPLPEWEYNGNPESVGYRVQYSWTGPQAKALIHRIPDRL-----EREFTIEDLEEWTEYEVKVQAINGIGAGPWSQPVRGRTRESVPSCGPTNVSAFATTSSSILVRWFEVPDPDRNGLILGYKV 1162          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008186.1 (pep scaffold:Pmarinus_7.0:GL476501:83598:168579:1 gene:ENSPMAG00000007342.1 transcript:ENSPMAT00000008186.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 238.424 bits (607), Expect = 3.539e-63
Identity = 316/1357 (23.29%), Postives = 532/1357 (39.20%), Query Frame = 3
Query: 1110 TVRVMINVSVDIKPTVVNARYNEIVQLKCVATGYPRLSLL-WLFNGNEFNSSKSFETDTNFSRTSHITIRVNADTAGVYQCLA--ESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIE-EKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLN-NLKISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQISIDNLVFKESP-----PLDYSIVLGQSFALNCSAKPTNI-QLKTNWFXXXXXXXXXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKEDGNWDSLPVKRIKEKSKVSRFFVKFESVTDSLF-------------GEYKCVASNEHRKNGVERIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWKLVTENWFINATTKETSITIE-----DLRPFKEYDIAIVAENSVGYGEEAT-IIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSPAKYVA-IRTLEDKPEGTPIQV-LCSPKANFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNVK-----ETHLKLYNLSANSKYIIQIRVKNNIGLGPPS-EPINCTTNEAAPDPPNEIKAYFYQNCLKVSWTPPIKANGHIRE---------YIIVFSFEPNNMITVSSRENDKPYYSWELCSEQICS----NCNVSVLAVTTMKGPRKTVNVLSNKMGILSFXXXXXXXXXXXXXLYCE-VAFPDENIYYLWTHND--------KDIYGQGVQSNGSLVINSMAESDQGIYKCKVKSEEITYNVSTKSISLV----PQTPYIEITKVSTNHIALLW--RSNGSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSN-PAISQAQTRGSIPEIPDTSNIVTEIGPHSMCFNLRAFRPGRGCPANKYILKLWP 4979
            T++  + V VD  P  +    +   +  C  +G     ++ W  NG+    + S         + H   R +    G YQC+A  E  D A++          F I+     +L   SP +  S+S     + + G  F +QC     P  T+AW LD +       L  +  +R    ++     D++  +++   +   GG YR +  N  G+A     I V     IR   ++T   G E  L C VI     +I W R+       LP  H QTV  +G L + + V K +  G YIC+  +      S++  VT+  PP++    P  +          + C+                               +   D  I I + K         +G  LP  +   V      I+ + I    +LH    +C+ +N A T+    Q     L+ +  P     P D   + G+   LNCSA    I ++   +   + +       +   R   L NG+L+++ ++  D   ++C +   VG D ISK + + +K+PA + +  +V    R   ++L C+  G+  + ++W ++E           + +  ++ R+ V  +   D L              G + C A N + ++    +I L V + P    +  E     +R+I + W     DG  PIT + + +K  ++ W     TK+ S TI      DL P   Y   + A+N +G  E +  + I TQ  AP+GP L ++    S   +++ W+ P+  L NG+ + YQ+   E  +  + +L +F           +V   +   ++SC+          +  L  FT YA  V   N  G  P+   A   TLED P   P  +   S  A+ + L W+PPP++  NG++ GY V Y+       PD  + +V+     +    L +L   + Y +Q+      G G  S     CT  +    P     A    + + VSW PP K NG +R           +++  +E +   T  S  N   +  + +C   + S    N   SV    +   P +          ILSF   I       V L C  V  P   +   WT            D +G  +  NGSL++ S+   D G Y C   +    +      I+L+    P  P + ++K S + I L W   +NG      P+  +L+           E+ +S + +   +  L CGT Y   L A+N+ G      I +A+T G  P     + +V  +    +  NLR +  G GCP +   L+  P
Sbjct:  142 TIKAPVVVRVD--PHRLKTTLSGTAEFSCEVSGAAGDGMVTWFHNGDPPTPTASVSGAQGERLSVHAAGRSDG---GTYQCVARGEGGDTAQD----------FSIL-----MLEDGSPKIASSFSE---RVVSPGEPFSLQCVVRGSPPPTIAWTLDGEP-----ALSRDAPHRRGNHIVTPG--DVTGYLNVTGARVTDGGVYRCQAGNAAGQAEYQARINVRGSPSIRPMRNVTAIAGREAYLHCRVIGYPYYSIRWLREG----TPLPYNHRQTVFANGTLRLAD-VQKGMDEGAYICSVLVQPGASPSRSLIVTVKEPPLIQ---PFEMPAVTQGQRVYVPCV-------------------------------IVSGDSPIRITWHK---------DGQPLPPRLGAQVETTEF-ISSLLIPNVTQLHNGNYTCLARNEAATVSHGSQ-----LIVRVPPRFVVQPKDQDGIFGKPVVLNCSADGYPIPKIIWKYSKGNGNPQFQPVLSGGGRFQPLGNGSLLLRQVQEEDGGFYLCQVSNGVGTD-ISKSMLLNVKIPALVTSQANVTLATRGQHSNLQCSARGERPIIIRWEKEET----------LIDPERMFRYVVYTQDTGDELLSTLQILPTVRGDSGFFTCHAINSYGED--RGLIQLTVQEPPDPPEV--EVREVNARTITLRWTS-GFDGNSPITAFDIEYKNRSDTWEQKQRTKDISSTINQATIIDLHPATHYVFRVYAKNRIGASEPSKDLPITTQEAAPDGPPLEVILEPQSSQSIRVTWKVPHGHLRNGVIRGYQIGYREA-EPGSGALSQF----------NIVRLESTGERESCL----------LHHLKKFTRYAVMVQAFNLAGSGPSSSEAYAATLEDVPSKPPANIQAASISADAITLSWSPPPRDAHNGLLQGYRVIYYP----VLPDGELGDVRNLTTSQLRADLRDLEKFTNYSLQVLAFTRAGDGVRSVATFVCTQEDVPCPPAAVKAAPASASSVVVSWLPPAKPNGLLRRNEQLCDHAHGVLISEYEVSPESTHHSISNLSRHRQYSVCVAAVTSAGRGNNTESVSVEPSPNAPAR----------ILSFGGPISSPWMRDVELPCRSVGEPTPVVR--WTKESDTSQVAVPADEHGSFL-PNGSLLLRSVRAEDSGDYSCTASN---AWGSDALLITLLVQVPPDQPRLSVSKTSASSITLSWIPGNNGG----SPLRGYLLQYSVDRSEQWEEMVISPHQKRFALERLRCGTWYKFTLAARNVVGTGRISEIIEAKTHGREPHFVKDAELVLPMNASVVRVNLRGWDDG-GCPISSLALEYQP 1352          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Sea Lamprey
Match: neo1b (neogenin 1b [Source:ZFIN;Acc:ZDB-GENE-131121-320])

HSP 1 Score: 110.538 bits (275), Expect = 1.783e-24
Identity = 138/587 (23.51%), Postives = 233/587 (39.69%), Query Frame = 3
Query: 2493 PLDYSIVLGQSFALNC--SAKPTNIQLKTNWFXXXXXXXXXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKV-VKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKED------------GNWDSLPVKRIKEKSKVSRFFVKFESVTDSLFGEYKCVASNEHRKNGVERIILLNVVD--VPGKVVIKNEXXXXXXXXXXX----XWNPPNSDGKKPITRYLVSWKLVT---ENWFINATTKETSITIEDLRPFKEYDIAIVAENSVGYGEE-ATIIIKTQADAP-EGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSPAKYVAI-RTLEDKPEGTPIQVLCSP-KANFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNVKET-HLKLY--NLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEA------APDPPNEIKAYFYQNCLKVSWTPPIKANGHIREYIIVFSF 4142
            P+D S+ LG +  L C  +  P       +W            S +  R   +  G + + N++  D   + CIIK    ++E  ++  K+ +  P  IL+ P+  +   + +  L C   G     + W++  D            G+   L V R  E                   G Y+C+A +E   +G++    L V++  VPG +        +           SW  P ++ +  +  Y V +  V    E         E  + + +LRP   Y   +VA N  G GE  A + I TQ +    GPVLNL   +++   V L+W+ P  +    +  HY++  M++                 ++TT    +H+        N P      T   L  FT Y+FRV+  N  G   +   AI RT  D P G+P +++     +  + + W PP     NG I+GY++ Y    +  E +     ++ET HL      L   S+Y  ++   N+ G GP S+ ++  T +A       PD P+ +    +   + VSWTPP      +R Y + +  
Sbjct:  107 PVDVSVRLGHTATLECVVAGFPAP---SVHW-------TRGTESVLSERFSVVAGGIMRIDNVQEDDAGDYTCIIK---AQNETQRLYAKLTVLEPPRILHGPENRNASVSDDIILECQAEGRPRPVISWFQNGDLIIPDDFIQIVDGSLHVLGVMRSDE-------------------GVYQCMAESE--VDGMQAAAQLVVINHAVPGILASSAPRGVTAVLVSTRFIRLSWRAP-AESRGSVLHYSVYYMRVGSVRERRSDTLQASELQLVVGELRPETRYSFQVVAVNQAGPGERSAPLRITTQPEVQVPGPVLNLHVVAITTTSVSLQWDPPANVFSPIM--HYKLYYMQL---------------DGEATT----EHDLDT-----NGPS----FTKEGLRKFTRYSFRVVAYNKHGPGVSSEDAIVRTYSDVPSGSPQELILEVVNSQSVLVRWKPPSLETHNGDITGYKIHYRKAGRRAEAE-----IEETAHLSYLAVGLDRGSEYSFRVAAVNSNGTGPFSDWLSSETFQADLDESRVPDQPSSLHVRPFPTSIVVSWTPPANPQIMVRGYALGYGI 623          

HSP 2 Score: 58.151 bits (139), Expect = 1.878e-8
Identity = 120/568 (21.13%), Postives = 219/568 (38.56%), Query Frame = 3
Query: 2508 IVLGQSFALNCSAKPTNIQLKTNWFXXXXXXXXXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVP-------ATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKEDGNWDSLPVKRIKEKSKVSRFFVKFESVTDSLFGEYKCVASNEHRKNGVERIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGK-KPITRYLVSWKLVTENWFINATTKETSITIEDLRPFKEYDIAIVAENSV-GYGEEATIIIKTQA-------DAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSPAKYVAIRTLEDKPE-GTPIQVL----CSPKANFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNVKETHLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAP--DPPNEIKAYFYQNCLKVSWTPPI--KANGHIREYIIVF 4136
            ++ G S  L+C A+ T +  +  WF          + T +S++  L +G L+++N  + D  K+ C +    G+   ++   +++ +P         +L  P  + ++  +  +L C V G     V W R      +S+  +R    S V+   ++ ++V +   G+Y C+   +   N  +R+     V  P +++   E+  +      I      ++G+ +P+  +  +  L+  + FI     + S+ +  +    E     +AE+ V G    A +++   A        AP G    + A  VS   ++L W +P E    G   HY V  M +   + R  +                               S L + V EL   T Y+F+V+ VN  G  P +  A   +  +PE   P  VL     +     + L+W+ PP NV + ++  Y++ Y   D     +  +     +  K   L   ++Y  ++   N  G G  SE     T    P   P   I        + V W PP     NG I  Y I +
Sbjct:   14 VIQGDSVVLDCGAEVTGLWNEVRWF------KEGRSITEDSQVMVLSSGDLLLQNASMADGGKYFCQLV-FGGRTFTNQGTNLSV-LPEMESNRLCVVLRHPVDVSVRLGHTATLECVVAGFPAPSVHWTRGT----ESVLSERF---SVVAGGIMRIDNVQEDDAGDYTCIIKAQ---NETQRLYAKLTVLEPPRILHGPENRNASVSDDIIL--ECQAEGRPRPVISWFQNGDLIIPDDFIQIV--DGSLHVLGVMRSDEGVYQCMAESEVDGMQAAAQLVVINHAVPGILASSAPRG----VTAVLVSTRFIRLSWRAPAES--RGSVLHYSVYYMRVGSVRERRSDTLQ---------------------------ASELQLVVGELRPETRYSFQVVAVNQAG--PGERSAPLRITTQPEVQVPGPVLNLHVVAITTTSVSLQWD-PPANVFSPIMH-YKLYYMQLDGEATTEHDLDTNGPSFTK-EGLRKFTRYSFRVVAYNKHGPGVSSEDAIVRTYSDVPSGSPQELILEVVNSQSVLVRWKPPSLETHNGDITGYKIHY 521          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003988.1 (pep scaffold:Pmarinus_7.0:GL479628:888:7913:1 gene:ENSPMAG00000003645.1 transcript:ENSPMAT00000003988.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.9745 bits (232), Expect = 1.231e-20
Identity = 85/323 (26.32%), Postives = 139/323 (43.03%), Query Frame = 3
Query: 3705 AIRTLEDKPEGTPIQVLCSPKANFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMK-NVKETHLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIKAYFYQNCLK-VSWTPPIKANGHIREYIIVFSFEPNNMITVSSRENDKPYYSWELCSEQICSNCNVSVLAVTTMKGPRKTVNVLSNKM-----GILSFXXXXXXXXXXXXXLYCE-VAFPDENIYY------------LWTHNDKDIYGQGVQSNGSLVINSMAESDQGIYKCKVK----SEEITYNVSTKSISLVPQTPYIEITKVS 4601
            ++R +  +P GT   V  S +A  + + W PPP++  NGV++GY VTY+      +P ++   +  ET  +L  L   ++Y +Q+      G G  S      T E  P  P  IKA         VSW PP+  NG IR+Y I  +++      VS  E+      + + + +  +   VSV A T       T +V    M      +LSF   +       V L C  V  P  ++ +            LW+   + I+     +NGSLVI ++   D G Y C+      S+ IT  +   ++ + P  P + ++K +
Sbjct:    2 SLRPVPSRPPGTVTVVAMSSEA--VEVTWEPPPRDAFNGVLTGYRVTYWPLSTDGDPGEVSNVSTTETRAQLRGLLKYTEYSVQVAACTRAGEGARSPATQARTAEDVPGSPAGIKAAAASANAAMVSWLPPLTPNGLIRKYTIYLNYQGQPHTVVSEFESAPDTLLYRVGNLRTGTRYVVSVSASTAAGRGNATHSVPVEAMHKAPARVLSFGGRVSSPWMRDVQLPCRSVGEPGPSVRWTKDRSRDGVPVALWSDARRLIH-----TNGSLVIRAVKADDSGFYSCEASNSWGSDRITLQL---TVQVPPDQPRLSVSKTT 314          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005381.1 (pep scaffold:Pmarinus_7.0:GL480507:730:13780:1 gene:ENSPMAG00000004869.1 transcript:ENSPMAT00000005381.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.1965 bits (217), Expect = 1.295e-17
Identity = 91/317 (28.71%), Postives = 141/317 (44.48%), Query Frame = 3
Query: 3252 LRPFKEYDIAIVAENSVG---YGEEATIIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGI----KKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINV--PESTLVITVTELLTFTEYAFRVILVNNVGFSP-AKYVAIRTLEDKPEGTP--IQVLCSPKANFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKN--VKETHLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIKAYFYQNCLKVSWTPPIKANGHIREYIIVFSFEPNNMI 4160
            LRPF  Y   ++A N VG   +  E+  +   QA   E PV+ +  T  +   V ++W++P E  +NGI    + HY+   +++YD+  R       P    +             +  ++     S+    +  L  +  Y  RV   N +G  P +    +   E  P   P  +QV+ S  A  L L W PPPQ+  NG I GY+  YF +       + +K   + ET +KL  LS  ++Y + I   N  G GP S P++  T+ AAP  P  +   F +  + VSW  P   NG I  Y +V  +EP+  I
Sbjct:    7 LRPFTSYAFRLMATNDVGDSDFSPESEAVTTLQAVPSEAPVI-VSITPHTTTSVLVRWKAPPEESVNGILLGFRVHYR--PLQLYDAPPRLP-----PGGRRARDTAAVAAAELTPRYLVHTLNDSSSTQHELENLTKYLRYEVRVTGYNVMGDGPPSPPYEVFVGEAVPTAPPQNVQVVGS-TATQLELSWEPPPQDKQNGDIQGYKA-YFWETARGNASQRVKTLFLPETSIKLRRLSGYTEYALAIAAFNAAGDGPRSAPLSAWTDSAAPSAPGALS--FSE--VNVSWADPAAPNGIIDGYRLV--YEPSTPI 307          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003996.1 (pep scaffold:Pmarinus_7.0:GL479628:2065:17993:1 gene:ENSPMAG00000003645.1 transcript:ENSPMAT00000003996.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.5741 bits (205), Expect = 3.157e-16
Identity = 73/283 (25.80%), Postives = 121/283 (42.76%), Query Frame = 3
Query: 4077 VSWTPPIKANGHIREYIIVFSFEPNNMITVSSRENDKPYYSWELCSEQICSNCNVSVLAVTTMKGPRKTVNVLSNKM-----GILSFXXXXXXXXXXXXXLYCE-VAFPDENIYY------------LWTHNDKDIYGQGVQSNGSLVINSMAESDQGIYKCKVK----SEEITYNVSTKSISLVPQTPYIEITKVSTNHIALLWRSNGSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSN-PAISQAQTRGSIP 4856
            VSW PP+  NG IR+Y I  +++      VS  E+      + + + +  +   VSV A T       T +V    M      +LSF   +       V L C  V  P  ++ +            LW+   + I+     +NGSLVI ++   D G Y C+      S+ IT  +   ++ + P  P + ++K + N I L W +     +   I  +++ + +  G    E++V    RS+ +  L CGT Y   L A+N  G      I +A+T+G  P
Sbjct:   31 VSWLPPLTPNGLIRKYTIYLNYQGQPHTVVSEFESAPDTLLYRVGNLRTGTRYVVSVSASTAAGRGNATHSVPVEAMHKAPARVLSFGGRVSSPWMRDVQLPCRSVGEPGPSVRWTKDRSRDGVPVALWSDARRLIH-----TNGSLVIRAVKADDSGFYSCEASNSWGSDRITLQL---TVQVPPDQPRLSVSKTTANSITLTWVTGDDGGSN--IRGYVLQLSSERGERWDEVRVGPGERSLRVQQLRCGTWYKFTLAARNAVGTGRISEILEAKTQGKAP 303          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Nematostella
Match: EDO43169 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZM7])

HSP 1 Score: 81.2629 bits (199), Expect = 2.889e-15
Identity = 104/470 (22.13%), Postives = 180/470 (38.30%), Query Frame = 3
Query: 2658 LVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATIL--NMPDVIDMKRNYENSLNCTVHGDDELDVK--WYRKEDGNWDSLPVKRIKEKSKVSRFFVKFESVTDSLFGEYKCVASNEH-RKNGVERIILLNVVDVPGKVVIKN--EXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWKLVTENWFINATTKETSITIEDLRPFKE----YDIAIVAENSVGYGEEATIIIKTQADAPEGP--VLNLLATSVSFDKVKLKWESPNE---MLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSPAKYVAIRTLEDKPE-----GTPIQVLCSPKANFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNVKETHLKLYNLSANSKYIIQIRVKNNIGLGPPSEPIN 4004
            LV+ N++L D  +F C++K    ++ ++  V + + V   IL     +V+    N +  L C V    +   K  W  +  GN     V +  ++       +   +  D+ FG Y CVA   +  +  V  I  L+    PG V  +       + S   +++W PP  +G  P+T Y V +K   E W+   T    +  I   RP  +     ++ ++A N VG GE + + I T    P  P  +   L  +  +  +++ W+ P +   + +NG K  Y+                 AW     + T   +                   + + +     EY  RVI  N VG S    V      +KP      G     L +     + + W+ P  N     I+ Y V Y  + +          V      L  +  N KY I++  +N++G GPPS+ ++
Sbjct:  127 LVISNVQLADSSEFYCLVKFSGSRNTMTDYVFLRV-VDLQILKSTSSNVVSSWHNNKVQLLCHVKVARDTTTKFIWRNQAIGN----SVSQFPQRDDQVTSVLTVHTYDDADFGPYVCVAMTPNTNQTHVVHIKRLHKPSAPGNVTRQRLLRPSANCSVQTSVTWMPPLDNGGSPVTHYDVQFKPFGEGWWEAETAVVNTPYIHMCRPRDQGRNGLEMRVMARNVVGQGEPSEVFIVTFWGEPTPPRNLAYRLVRNDGYPYIRVTWDYPYDDGGVSVNGYKVEYKATGA-------------AWARAIQTGTFAKE-------------------VRLEKKSNLKEYEIRVIAYNGVGPSKPSEVLKAAFAEKPSRPLNVGISATALNTNHGPHIQIRWDSPLDN-GGSPITEYMVEYKEEVQTNWSQGRYVEVDRNEFILTGIDRNMKYDIRVSARNSMGYGPPSKVVS 558          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Nematostella
Match: EDO49021 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHR1])

HSP 1 Score: 74.7146 bits (182), Expect = 1.174e-13
Identity = 54/204 (26.47%), Postives = 90/204 (44.12%), Query Frame = 3
Query: 3243 IEDLRPFKEYDIAIVAENSVGYGEEATIIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSP-AKYVAIRTLEDKPEGTPIQVLCSPKA-NFLFLEWNPPPQNVTNGVISGYEVTY 3848
            +  L  ++EY++ + A  S+G G  AT+ I T  D+      N     +S  +++L+WE    +L NG    Y    +  Y++ N+S+   A                          P     +T+ +L  F  Y  R++  N +GF P + Y+ +RT ED PE  P     +      +F+EW P P +  NG I+GY++ Y
Sbjct:  163 VTGLYKYREYNVTVAAITSIGIGPPATVFIWTDQDS------NFRGQPISSTRLRLQWEPVPLLLTNGEMVGY----ILEYNNTNKSIADNA------------------------TYPTIQTEVTLVDLHKFNYYQLRIVAYNVMGFGPWSDYITLRTDEDVPERPPANSSGNADGPTSIFVEWKPVPFDYRNGFITGYKLIY 332          

HSP 2 Score: 71.2478 bits (173), Expect = 1.509e-12
Identity = 75/315 (23.81%), Postives = 127/315 (40.32%), Query Frame = 3
Query: 3210 INATTKETSITIEDLRPFKEYDIAIVAENSVGYGE-EATIIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSPAKYVAIRTLEDKP-EGTPIQVLCSPKANFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNVKETHLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPD--PPNEIKAYFYQNCLKVSWTP-PIK-ANGHIREYIIVF 4136
            I      +S+ +  LR +K Y + I A N +G G     + ++T  D P  P  ++   ++S   + + W    E   +G+ + Y+V +                       TR+      ++   C+          VT L  + EY   V  + ++G  P   V I T +D    G PI       +  L L+W P P  +TNG + GY + Y + +K    +     + +T + L +L   + Y ++I   N +G GP S+ I   T+E  P+  P N          + V W P P    NG I  Y +++
Sbjct:   54 ITVAPDNSSVLLVSLRKYKVYCVTIAAYNRIGSGNFSEPVCVRTLEDVPTAPPESVSGHNISSTAISVSWSEVPEDHKHGVIRGYKVWA-----------------------TRIETGEIEKMMIVCMKTAN------VTGLYKYREYNVTVAAITSIGIGPPATVFIWTDQDSNFRGQPI------SSTRLRLQWEPVPLLLTNGEMVGYILEYNNTNKSIADNATYPTI-QTEVTLVDLHKFNYYQLRIVAYNVMGFGPWSDYITLRTDEDVPERPPANSSGNADGPTSIFVEWKPVPFDYRNGFITGYKLIY 332          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Nematostella
Match: EDO34057 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQD9])

HSP 1 Score: 71.633 bits (174), Expect = 3.698e-13
Identity = 67/296 (22.64%), Postives = 126/296 (42.57%), Query Frame = 3
Query: 3162 ITRYLVSWKLVTENWFINATTK----ETSITIEDLRPFKEYDIAIVAENSVGYGE-EATIIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSP-AKYVAIRTLEDKPEGTP----IQVLCSPKANFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNVKETHLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNE 4019
            + ++++ +KL   +W +++  +     T   +  L+P   Y + + A N++G  +   +I + T+ DAP  P   L  T+VS  +V + WE P     NG+ + Y V     Y+  NR+   +      + T    ++ ++ ++K                L  FTEY+  +      G S   +   ++TLED P   P    I VL S     + + W  PP +  +GV+ GY + Y+     +   +   +    ++ L  L   + Y + +    ++G G PS  +   T E
Sbjct:    4 VHQFIIQFKLARNDWLMSSKQEVLGSSTFYRLTGLKPATTYHVRVYARNAIGTSQPGGSIRVLTKEDAPSLPPKVLNITAVSSTEVLVTWEPPPPEHCNGVIRGYYVS----YNEPNRAKVFY------NVTVNGGEKMSYLIQK----------------LKKFTEYSVVLQAFTRAGPSTRTRKRKVKTLEDVPSQPPQFVDITVLGS---QSILVTWKRPPYDSIHGVLRGYHIRYYRVSDPQSAGETTVDRSRLNVTLRKLGKFTSYRVSVSAFTSVGDGVPSAEMKIKTAE 270          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Nematostella
Match: EDO41204 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4S8])

HSP 1 Score: 74.3294 bits (181), Expect = 6.047e-13
Identity = 78/333 (23.42%), Postives = 132/333 (39.64%), Query Frame = 3
Query: 3159 PITRYLVSWKLVTENW----FINATTKETSITIEDLRPFKEYDIAIVAENSVGYGEEATIIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSPAKYVAIRTLEDKPEGTPIQVLCSPKAN-FLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNVKETHL--------KLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPD-PPNEIKAY-FYQNCLKVSWTPPIKANGH 4112
            P+  Y V   LVTE+      IN      + T   LR F  Y + +   N  G G +A I I+T ++ P  P   L   + S   + + W+     L +   +H  +   ++  +Q                    D ++  V  +C     S  ++   +L+ +TEY   V   N  G  P+  V   T +D P   P+QV     ++  + + W P P    +GVI GY++ Y         DK+  N + + +         + +L   + Y++++      G GP    IN  T E  P   P +++ Y      ++V+W P   AN H
Sbjct:  551 PLLGYKVGLYLVTESVEKANLINLAPNARNATFAGLRIFTRYKVIVYGFNEYGDGIQAAIDIRTDSERPSRPPTYLTCFNTSSTSLNVTWQP----LSDSYYEHGDIQGYKVITNQT-------------------DGNSSFVIATC----SSNRMLQFKDLIKYTEYNVTVEAFNEKGGGPSAEVMCTTDQDVPSAAPVQVEGYNISDTAIRVNWLPVPSANQHGVILGYKIYY--------SDKITSNRQSSTVDGGDVLTGDIQDLEPYTVYLVRVSAFTIKGQGPSGPLINVKTEERVPSAAPVQLEGYNISDTAIRVNWLPVPSANHH 848          

HSP 2 Score: 67.0106 bits (162), Expect = 9.637e-11
Identity = 73/319 (22.88%), Postives = 135/319 (42.32%), Query Frame = 3
Query: 3243 IEDLRPFKEYDIAIVAENSVGYGEEATII-IKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSPAKYVAIRTLEDKPEGTPIQVLCSP--KANFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNVKETHLKLY---NLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPD-PPNEIKAYFYQN-CLKVSWT--PPIKANGHIREYIIVFSFEPNNMITVS 4169
            I+DL P+  Y + + A    G G    +I +KT+   P    + L   ++S   +++ W     + +     H  +   +I+ S N +         ++  +  VD  +              L   + +L  +T Y  RV      G  P+  +     E++    P Q+        + + + W+P P +  NGVI GY + Y      E P  +++ V ++  +++   +L   + Y +Q+      G+GP +  I  TT+EAAP  PP + + +F  +  +K+ WT  PP    G +R Y I  S+E    + +S
Sbjct:  781 IQDLEPYTVYLVRVSAFTIKGQGPSGPLINVKTEERVPSAAPVQLEGYNISDTAIRVNW-----LPVPSANHHGVILGYKIHYSDNIT---------SNRQSSTVDGGD-------------VLTGDIQDLEPYTVYLVRVSAFTIKGQGPSGPLINVQTEERVPSAPPQLFAGNNISKSAINITWSPVPTDHQNGVILGYLIQYKESSSPESPWDIIQ-VNDSSAEVWTVDDLWPLTLYTMQVAAFTLKGVGPWTSEIEVTTDEAAPAYPPEDFRGHFASSVAVKLYWTPIPPETLRGALRLYRI--SYEAQGSLYIS 1069          

HSP 3 Score: 56.9954 bits (136), Expect = 1.046e-7
Identity = 65/317 (20.50%), Postives = 127/317 (40.06%), Query Frame = 3
Query: 3207 FINAT-TKETSITIEDLRPFKEYDIAIVAENSVGYGEEATIIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSPAK-YVAIRTLEDKPEGTPIQVLCSPKAN-FLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNVKETHLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIKAY--FYQNCLKVSWTP-PI-KANGHIREYIIVF 4136
            F+ AT +    +  +DL  + EY++ + A N  G G  A ++  T  D P    + +   ++S   +++ W     + +    +H  +   +IY S                     D+     + S ++  +  L   + +L  +T Y  RV      G  P+   + ++T E  P   P+Q+     ++  + + W P P    +GVI GY++ Y  +         +         + +L   + Y++++      G GP    IN  T E  P  P ++ A     ++ + ++W+P P    NG I  Y+I +
Sbjct:  669 FVIATCSSNRMLQFKDLIKYTEYNVTVEAFNEKGGGPSAEVMCTTDQDVPSAAPVQVEGYNISDTAIRVNW-----LPVPSANQHGVILGYKIYYS---------------------DKITSNRQSSTVDGGD-VLTGDIQDLEPYTVYLVRVSAFTIKGQGPSGPLINVKTEERVPSAAPVQLEGYNISDTAIRVNWLPVPSANHHGVILGYKIHYSDNITSNRQSSTVDGGDVLTGDIQDLEPYTVYLVRVSAFTIKGQGPSGPLINVQTEERVPSAPPQLFAGNNISKSAINITWSPVPTDHQNGVILGYLIQY 958          

HSP 4 Score: 50.8322 bits (120), Expect = 7.045e-6
Identity = 65/267 (24.34%), Postives = 113/267 (42.32%), Query Frame = 3
Query: 3243 IEDLRPFKEYDIAIVAENSVGYGEEATIIIKTQADAPEG----PVLNLLATSVSFDKVKLKWESPNEMLIN----GIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVG-FSPAKYVAIRTLEDKPEGTPIQVLCSPKAN--FLFLEWNPPPQNVTNGVISGYEVTY----FSDDKHEEPD-KLMKNVKETHLKLYNLSANSKYIIQIRVKNNIGLGPPSE 3995
            +  L  F EY   I   N       + I+IKT  D P+      V+   +T  + D + ++WE   +   N    G K +Y+  SM   +S+ R   +     P D    VV             VP +   +T++ L  F+ Y+ +VI     G  + ++ + + T +D P+G P  +  + K++  ++ + W   P  + NG++ GY + Y     +    +EP   L     E    L NL  +S Y +Q+     +G GP +E
Sbjct: 1082 VTGLNEFTEYRFWIQGVNRFEGNISSEIVIKTDEDVPDSIPSEDVVVRESTERTTDLI-VQWEELTDDEKNGDLLGYKVYYKYNSMNSKESRKR---RAISGEPLDGYEMVV-------------VPPTQTSVTLSGLKKFSTYSVKVIGFTAKGNANISQDIVVSTPQDAPDGIPADLRVTNKSDPYWIPVWWGRIPIELINGILLGYRLYYKRVVTNGRPVDEPAMNLTFRTTEFSTTLVNLRKDSIYRVQVTAFTKVGEGPRAE 1331          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Nematostella
Match: EDO32151 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVV8])

HSP 1 Score: 69.707 bits (169), Expect = 6.916e-12
Identity = 60/203 (29.56%), Postives = 90/203 (44.33%), Query Frame = 3
Query: 2826 SLNCTVHGDDELDVKWYRKEDGNWDSLPVKRIKEKSKVSRFFVKFESVTDSLFGEYKCVASNEHRKNGVERIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWKLVTENWFINATTKETSITIEDLRPFKEYDIAIVAENSVGYGEEATIIIKTQADAPEG-PVLNLLATSVSFDKVKLKWESPNE 3431
            SL C   G     + WY K  G   +  VK I   S++       +   D  +G+YKC ASN      VER+I +     PG  +I        + SI ++W PP+S+G  P+  Y V           +A      + I DL    EY + + A N VGYGE  T  I+T+   P   P L  +  + + +++ L+W  P+E
Sbjct:   17 SLQCKARGVPSAHITWY-KPGGQPITAEVKLISGGSQLQ--VTTTQDAGD--YGQYKCRASN--LLGSVERLIYVTQWFAPGPPIIT--VSNIEASSIKVNWAPPSSNGGSPVIDYKVEVDPAKTPREGDAGGP---VVISDLTKNTEYTVKVTARNVVGYGETGTRTIRTRKQGPPSPPFLKPVDNTTTSEEITLEWSKPDE 207          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Medaka
Match: dscama (Down syndrome cell adhesion molecule homolog [Source:NCBI gene;Acc:101158128])

HSP 1 Score: 291.582 bits (745), Expect = 8.620e-79
Identity = 423/1756 (24.09%), Postives = 689/1756 (39.24%), Query Frame = 3
Query:   66 FFILILFNILCHFITFKNVNSFDHKSFFFFLNRHKRYAEERNLEPPKLINVQKSFVTTMTDHSRVYCTATGNPSPKIKWYYETTQRNVFTEVND-PDRFVVGTNGDMDIF----------IQANIEVIYCKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRNIYTDIDVKSHDWISPKRLEDNSKIDFT-SICQNIEVR-VIKGSTLELPWCSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLN-NLKISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQISIDNLVFKESP-----PLDYSIVLGQSFALNCSAK----PTNIQLKTNWFXXXXXXXXXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKEDGNWDSLPVKRIKEKSKVSRFFVKFESVTDSLF-------------GEYKCVASNEHRKNGVERIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWKLVTENWFINATTKETS-----ITIEDLRPFKEYDIAIVAENSVGYGEEAT-IIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSPAKY-VAIRTLEDKPEGTP--IQ-VLCSPKANFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNVKETH--LKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIKAYFYQNCLK-VSWTPPIKANGHIREYIIVFSFEPNNMITVSSRENDKP-YYSWELCSEQICSNCNVSVLAVTTMKGPRKTVNVLSNKMG-----ILSFXXXXXXXXXXXXXLYCE-VAFPDENIYYLWTHNDKDI-----YGQGVQSNGSLVINSMAESDQGIYKCKVKS----EEITYNVSTKSISLVPQTPYIEITKVSTNHIALLW--RSNGSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSN-PAISQAQTRGSIPEIPDTSNIVTEIGPHSMCFNLRAFRPGRGCPANKYILKLWPSSEGNHQESGVSVWKVVNDSDLNQIPCFNVTDLHPNTDYVYSIEASNMVG 5129
            FF   + N+ C           D +S  +F+N                 +VQ+    + T  S V C A G P   ++WY  T +     E+ D P    V  NG + IF          I  N    YC A+N  G +RS+ + + K +  +   VR E ++      AV  C++  ++ AYI  V  WE       K  + I     RF + +      L+I +V   D      RC+ R+ YT    +S+      RL  +  I+    I  + E R V+    +ELP C    +    + W   +   R L     ++F+   +    LLI+    ++ G Y         N  +   + V   + V + P  V       V L C  TG     L W  NG     S S    T  +R + +   +     G YQC A        ++ ++D   V V++ +  P ++          S+   V   +     + C     P   V W LDD+ +      I ++ +R+ Y +     + +S +   + +   GG YR    N  G       I V     IR   ++T   G ++ + C VI     +I+W++D+      LP  H Q   E+G L + + V K +  G+Y CN  +   L   ++  +T+  PP +    P             + C+     D P +  W+    K    +P      ++  D    ++   +T+                                    +H    +C+ +N A  +    +     L+ +  P     P D   + G+S  LNCSA+    PT IQ + +          P+      RI  L NG+L++K++   D   ++C +   VG D +SK + + +K+PA I + P+     +  E  ++CT HG+  + V+W ++E          RI    + SR+ V  +   D +              G + C A N + ++    II L V + P    +  E      R+IA+ W     DG  PIT + +  K  + +W     TK+ S      TI DL P   Y+I + A+N +G  E +  + I T   AP+GP  ++   ++S   +++ W  P + L NG  K YQV   E     N      +  +  D+   +V                      +  L  FT+Y   V   N+ G  P+   VA  TLED P   P  +Q V  SP+   + L W  PP++  NG + G+ V Y+++    E  ++ +NV  +   L+L  L   + Y IQ+      G G  SE I   T E  P PP  +KA    N +  VSW PP K NG IR+Y +   F  N   TVSS     P  + + + +       +V V+AVT       +  +    M      IL+F++++       +VL C+ V  P   I +L   N+          + V  NGSLVI ++   D G Y C   +    ++I  N+    + + P  P + +TK +T  I L W    NG       I  +++     N        +S + RS  + NL+CGT Y   L A+N  GP     I +A+T G  P+      + T I    +  NL  +  G GCP   + L+        ++ +    W     + L +   + + DL   T Y   ++  N  G
Sbjct:    7 FFSQCILNVFCE----------DLRSSLYFVN----------------ASVQEVVFASTTGTS-VPCPAAGVPPVSLRWYLATGE-----EIYDVPGIRHVHPNGTLQIFHIPPSSFSKLIHDN--TYYCTAENPSGRIRSQDVHI-KAVLREPYTVRVEDQKAMRGNVAVFKCIIPASVEAYITVVS-WE-------KDTMSISAEMSRFLITSTGA---LYILDVQMED-GLYNYRCMTRHRYTGETRQSNS----ARLIVSDPINSAPHILDSFERREVMAAHRVELP-CKASGHPTPKYRW---LKDNRPLE--PDTRFR---QSVTGLLIERAQSSDTGTYVCEVWNSYGNAEVVGRLLVKEPLKVTVSPRKVKGSVGSQVSLSCGVTGSEEYQLSWYRNGELIYPSNSVRM-TGQNRENLVMAGMAKSDGGAYQCFAR-----HGKMSAQD--FVQVVLEDGTPKIL---------SSFSEKVYNIN-DFLSLSCTVKGTPEPRVTWSLDDEPV------IRDSRHRISYYINVEGHV-VSHLNISQTQVPDGGVYRCICNNSAGTVSYQARINVRGPASIRPMKNLTAIAGRDMYIHCRVIGYPYYSIKWYKDSN----LLPYNHRQRAFENGTLKLFD-VQKDVDEGEYTCNVLVQPQLSTHQSVYITVKVPPTIH---PFEFPRFSIGQRVFIPCV-VMSGDQPVFITWQ----KDGRPIPASLGVTIDNIDFTSSLRVSNLTL------------------------------------MHNGNYTCIARNQAAAVEHQSE-----LIVRVPPKFVVQPKDQDGIYGKSVTLNCSAQGYPVPT-IQWEYS-KGAGVPQFKPIALNSGFRIEVLVNGSLLIKHVLEEDSGFYLCRVSNDVGAD-VSKSMYLNVKIPAMITSYPNTTLATQGEEKKMSCTAHGEKPIMVRWEKEE----------RIINP-ETSRYVVSVKEAGDEVVSTLQIMPTVREDSGFFSCHAINSYGED--RGIIQLTVQEPPDPPEV--EIREVKDRTIALRWT-MGFDGNSPITGFDIESKNKSASWETAQKTKDVSPQLNQATIIDLHPSSTYNIRMFAKNLIGKSEASNELTITTDEAAPDGPPQDVQLEALSSQSLRVTWRPPKKHLQNGAIKGYQVGYREFSSGGNYQFSVISVETTGDNAESLV----------------------LDNLKKFTQYGVVVQASNSAGTGPSSTEVAATTLEDVPSRPPENVQAVATSPE--IVSLSWLTPPKDALNGNLLGFRVIYWANLPDGELGEI-RNVTTSKPSLELDGLEKYTNYSIQVLAFTRAGDGVRSEQIYTRTKEDVPGPPAGVKAAAASNSVVFVSWLPPSKVNGIIRKYTV---FCSNPHPTVSSEFEAAPDVFFYRIPNLSRNRQYSVWVVAVTAAGRGNASEVITVKPMAEAPARILTFNRTVTTPWMRDIVLPCKAVGDPSPTIKWLKDINESPAPVVIDSRRSVHGNGSLVIRTVKAEDSGNYTCGASNSFGLDKIVLNL---QVQVPPDQPRLTVTKTTTTSITLSWIPGDNGGSS----IRGYILQYSEDNSEQWGNFAISPSERSYRLENLKCGTWYKFTLTAQNAVGPGRISEIIEAKTHGKEPQYSKEQELFTSINATRVKLNLSGWNNG-GCPITSFTLE--------YRAADSPTWTTAQRTSLTK--SYILYDLQEATWYELQMKVYNSAG 1558          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Medaka
Match: dscama (Down syndrome cell adhesion molecule homolog [Source:NCBI gene;Acc:101158128])

HSP 1 Score: 291.582 bits (745), Expect = 9.457e-79
Identity = 423/1756 (24.09%), Postives = 689/1756 (39.24%), Query Frame = 3
Query:   66 FFILILFNILCHFITFKNVNSFDHKSFFFFLNRHKRYAEERNLEPPKLINVQKSFVTTMTDHSRVYCTATGNPSPKIKWYYETTQRNVFTEVND-PDRFVVGTNGDMDIF----------IQANIEVIYCKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRNIYTDIDVKSHDWISPKRLEDNSKIDFT-SICQNIEVR-VIKGSTLELPWCSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLN-NLKISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQISIDNLVFKESP-----PLDYSIVLGQSFALNCSAK----PTNIQLKTNWFXXXXXXXXXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKEDGNWDSLPVKRIKEKSKVSRFFVKFESVTDSLF-------------GEYKCVASNEHRKNGVERIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWKLVTENWFINATTKETS-----ITIEDLRPFKEYDIAIVAENSVGYGEEAT-IIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSPAKY-VAIRTLEDKPEGTP--IQ-VLCSPKANFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNVKETH--LKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIKAYFYQNCLK-VSWTPPIKANGHIREYIIVFSFEPNNMITVSSRENDKP-YYSWELCSEQICSNCNVSVLAVTTMKGPRKTVNVLSNKMG-----ILSFXXXXXXXXXXXXXLYCE-VAFPDENIYYLWTHNDKDI-----YGQGVQSNGSLVINSMAESDQGIYKCKVKS----EEITYNVSTKSISLVPQTPYIEITKVSTNHIALLW--RSNGSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSN-PAISQAQTRGSIPEIPDTSNIVTEIGPHSMCFNLRAFRPGRGCPANKYILKLWPSSEGNHQESGVSVWKVVNDSDLNQIPCFNVTDLHPNTDYVYSIEASNMVG 5129
            FF   + N+ C           D +S  +F+N                 +VQ+    + T  S V C A G P   ++WY  T +     E+ D P    V  NG + IF          I  N    YC A+N  G +RS+ + + K +  +   VR E ++      AV  C++  ++ AYI  V  WE       K  + I     RF + +      L+I +V   D      RC+ R+ YT    +S+      RL  +  I+    I  + E R V+    +ELP C    +    + W   +   R L     ++F+   +    LLI+    ++ G Y         N  +   + V   + V + P  V       V L C  TG     L W  NG     S S    T  +R + +   +     G YQC A        ++ ++D   V V++ +  P ++          S+   V   +     + C     P   V W LDD+ +      I ++ +R+ Y +     + +S +   + +   GG YR    N  G       I V     IR   ++T   G ++ + C VI     +I+W++D+      LP  H Q   E+G L + + V K +  G+Y CN  +   L   ++  +T+  PP +    P             + C+     D P +  W+    K    +P      ++  D    ++   +T+                                    +H    +C+ +N A  +    +     L+ +  P     P D   + G+S  LNCSA+    PT IQ + +          P+      RI  L NG+L++K++   D   ++C +   VG D +SK + + +K+PA I + P+     +  E  ++CT HG+  + V+W ++E          RI    + SR+ V  +   D +              G + C A N + ++    II L V + P    +  E      R+IA+ W     DG  PIT + +  K  + +W     TK+ S      TI DL P   Y+I + A+N +G  E +  + I T   AP+GP  ++   ++S   +++ W  P + L NG  K YQV   E     N      +  +  D+   +V                      +  L  FT+Y   V   N+ G  P+   VA  TLED P   P  +Q V  SP+   + L W  PP++  NG + G+ V Y+++    E  ++ +NV  +   L+L  L   + Y IQ+      G G  SE I   T E  P PP  +KA    N +  VSW PP K NG IR+Y +   F  N   TVSS     P  + + + +       +V V+AVT       +  +    M      IL+F++++       +VL C+ V  P   I +L   N+          + V  NGSLVI ++   D G Y C   +    ++I  N+    + + P  P + +TK +T  I L W    NG       I  +++     N        +S + RS  + NL+CGT Y   L A+N  GP     I +A+T G  P+      + T I    +  NL  +  G GCP   + L+        ++ +    W     + L +   + + DL   T Y   ++  N  G
Sbjct:    7 FFSQCILNVFCE----------DLRSSLYFVN----------------ASVQEVVFASTTGTS-VPCPAAGVPPVSLRWYLATGE-----EIYDVPGIRHVHPNGTLQIFHIPPSSFSKLIHDN--TYYCTAENPSGRIRSQDVHI-KAVLREPYTVRVEDQKAMRGNVAVFKCIIPASVEAYITVVS-WE-------KDTMSISAEMSRFLITSTGA---LYILDVQMED-GLYNYRCMTRHRYTGETRQSNS----ARLIVSDPINSAPHILDSFERREVMAAHRVELP-CKASGHPTPKYRW---LKDNRPLE--PDTRFR---QSVTGLLIERAQSSDTGTYVCEVWNSYGNAEVVGRLLVKEPLKVTVSPRKVKGSVGSQVSLSCGVTGSEEYQLSWYRNGELIYPSNSVRM-TGQNRENLVMAGMAKSDGGAYQCFAR-----HGKMSAQD--FVQVVLEDGTPKIL---------SSFSEKVYNIN-DFLSLSCTVKGTPEPRVTWSLDDEPV------IRDSRHRISYYINVEGHV-VSHLNISQTQVPDGGVYRCICNNSAGTVSYQARINVRGPASIRPMKNLTAIAGRDMYIHCRVIGYPYYSIKWYKDSN----LLPYNHRQRAFENGTLKLFD-VQKDVDEGEYTCNVLVQPQLSTHQSVYITVKVPPTIH---PFEFPRFSIGQRVFIPCV-VMSGDQPVFITWQ----KDGRPIPASLGVTIDNIDFTSSLRVSNLTL------------------------------------MHNGNYTCIARNQAAAVEHQSE-----LIVRVPPKFVVQPKDQDGIYGKSVTLNCSAQGYPVPT-IQWEYS-KGAGVPQFKPIALNSGFRIEVLVNGSLLIKHVLEEDSGFYLCRVSNDVGAD-VSKSMYLNVKIPAMITSYPNTTLATQGEEKKMSCTAHGEKPIMVRWEKEE----------RII-NPETSRYVVSVKEAGDEVVSTLQIMPTVREDSGFFSCHAINSYGED--RGIIQLTVQEPPDPPEV--EIREVKDRTIALRWT-MGFDGNSPITGFDIESKNKSASWETAQKTKDVSPQLNQATIIDLHPSSTYNIRMFAKNLIGKSEASNELTITTDEAAPDGPPQDVQLEALSSQSLRVTWRPPKKHLQNGAIKGYQVGYREFSSGGNYQFSVISVETTGDNAESLV----------------------LDNLKKFTQYGVVVQASNSAGTGPSSTEVAATTLEDVPSRPPENVQAVATSPE--IVSLSWLTPPKDALNGNLLGFRVIYWANLPDGELGEI-RNVTTSKPSLELDGLEKYTNYSIQVLAFTRAGDGVRSEQIYTRTKEDVPGPPAGVKAAAASNSVVFVSWLPPSKVNGIIRKYTV---FCSNPHPTVSSEFEAAPDVFFYRIPNLSRNRQYSVWVVAVTAAGRGNASEVITVKPMAEAPARILTFNRTVTTPWMRDIVLPCKAVGDPSPTIKWLKDINESPAPVVIDSRRSVHGNGSLVIRTVKAEDSGNYTCGASNSFGLDKIVLNL---QVQVPPDQPRLTVTKTTTTSITLSWIPGDNGGSS----IRGYILQYSEDNSEQWGNFAISPSERSYRLENLKCGTWYKFTLTAQNAVGPGRISEIIEAKTHGKEPQYSKEQELFTSINATRVKLNLSGWNNG-GCPITSFTLE--------YRAADSPTWTTAQRTSLTK--SYILYDLQEATWYELQMKVYNSAG 1558          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Medaka
Match: dscamb (Down syndrome cell adhesion molecule [Source:NCBI gene;Acc:101167815])

HSP 1 Score: 263.848 bits (673), Expect = 3.230e-70
Identity = 393/1668 (23.56%), Postives = 667/1668 (39.99%), Query Frame = 3
Query:  417 YCKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRNIYTDIDVKSHDWISPKRLEDNSKIDFTSICQNIEVR-VIKGSTLELPWCSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYA------SNPTVPSNPYLTHTVRVMINVSVDIKPTVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEE-KWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLNNLKI-SKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKYNEKLHLSQIS--------CVVQNHAGTIRKTIQISIDNLVFKESP-----PLDYSIVLGQSFALNCSAK----PTNIQLKTNWFXXXXXXXXXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKEDGNWDSLPVKRIKEKSKVSRFFVKFESVTDSLF-------------GEYKCVASNEHRKNGVERIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWKLVTENWFINATTKETS-----ITIEDLRPFKEYDIAIVAENSVGYGEEAT-IIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSP-AKYVAIRTLEDKPEGTPIQVLCSPKA-NFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNV--KETHLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIK-AYFYQNCLKVSWTPPIKANGHIREYIIVFS-FEPNNMITVSSRENDKPYYSWELCSEQICSNCNVSVLAVTTMK----GPRKTVNVLSNKMG-ILSFXXXXXXXXXXXXXLYCE-VAFPDENIYYLWTHNDKD-----IYG-QGVQSNGSLVINSMAESDQGIYKCKV----KSEEITYNVSTKSISLVPQTPYIEITKVSTNHIALLW--RSNGSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSN-PAISQAQTRGSIPEIPDTSNIVTEIGPHSMCFNLRAFRPGRGCPANKYILKLWPSSEGNHQESGVSVWKVVNDSDLNQIPCFNVTDLHPNTDYVYSIEASNMVGSQKAKAHNKTRQI-VSTAPPNINYSSP 5207
            YC A+N  G +RS+ + + K +  +   VR   ++      AV  C++  ++ AY+  V  WE    S S     +  + G            L+I +V   D  +   RC  R+ YT    +S+   S + +  +      +I    + R V+    +ELP C         + W    S          S+F+   +    LLI++   ++ G Y         N  V  + Y+   ++V+++      P  V       V L C  +G     L W  NG       +    T  +R + I   ++    G YQC A      + ++ ++D   V VI+ +  P ++          S+   V+  +   F + C     P     W LDD  +      I ++ + L +    T +  +++ +++   + + GG YR   +N  G  +    I V     IR   +IT   G +  + C VI     +I+W++++      LP  H Q   E+     +  V +V  +G+Y C   +   K+ S++  V +  PP +                         QP       +EF+       V       +   D  ++I +QK         +G  +P  +   V           I +   L +S ++        C+ +N A  +    Q     L+ +  P     P D   + G++  LNCSA+    PT +   +           P+     SRI  L NG+L++K++   D   ++C +   VG D +SK + + +K+PA I + P+     +  E  ++C  HG+  + V+W ++E          RI    + SR+ V  + V D +              G + C A N   ++    II L V + P   V+  E      R+IA+ W     DG  PIT Y +  K  + +W     TK+ S      TI DL P   Y+I ++A+N +G    +  + I T   AP+GP  ++   S S   +K+ W+ P + L NG+ + +QV   E     +      +  +  D+T  +V                      +  L  FT+Y+  V   N  G  P ++ V ++TLED P   P  VL   K+   + L W P P+   NG + GY V Y+++    E  ++ +NV   +  L+L +L   + Y IQ+    N G G  SE I   T E  P PP  +K A    + + VSW PP+K NG IR+YI+  S   P   + +S  E     Y + + +       ++ V+AVT         + TV  L+     IL+F+ ++       +V+ C+ V  P   I ++  + +       + G + +  NGS +I ++   D G Y C       S+E+T N+    + + P  P + +TK +T  I L W    NG       I  +++     N        +S + RS  + NL+CGT Y   L A+N  GP     I +A+T G  P+      + T I       NL  +  G GCP   +IL+        ++      W     + L +   + + DL   T Y   ++ +N  GS + +    T     ST PP +    P
Sbjct:   96 YCTAENPSGKIRSQDVHI-KAVSREPYTVRVADQKAMRGSVAVFKCIIPASVEAYVTVVS-WEKDTVSLSSGQRYLITSTG-----------ALYIVDVLPEDGLN-NYRCTTRHRYTGETRQSN---SARLIVSDPTNAEPAILDGFDHREVMINHRVELP-CKASGYPTPKYRWLKDNSPLE-----PDSRFR---QTISGLLIESTQPSDSGTYVCEVWNSYGNAEVVGHLYIKQPLKVVVS------PRKVKGSVGSKVSLSCSVSGSDEYELSWYRNGEIIYPGNNVRF-TGLNRENLIMEGMSKSDGGAYQCFAR-----KGKMSAQD--FVQVILEDGTPKIL---------SSFSEKVVSPNEPVFLV-CNVKGTPPPRCTWTLDDDPV------IKDSHHHLGH--YETHEAHVASQLNVTHTQVQDGGVYRCTCSNSAGVVYHQARINVRGRASIRPMKNITAIAGRDAFVHCRVIGYPYYSIKWYKNS----ALLPFNHRQRAFENNGTLKLSNVQQV-DAGEYTCKVMVQPNKMDSQSVHVRVRVPPYI-------------------------QP-------FEFQRFTIGQRV--FIPCVVMSGDRPLDITWQK---------DGRPIPASLGVTVDN---------IDFTSSLRISNLTPDHNGNYTCIARNEAAVVEHQSQ-----LIVRVPPQFVVQPEDQDGIYGKTVTLNCSAEGYPPPTIVWEHSK--GAGVPQFQPILLNSGSRIQLLSNGSLLIKHVLEDDSGFYLCKVSNDVGAD-VSKSMYLTVKIPAMITSYPNTTLATQGEEKRMSCIAHGEKPIMVRWEKEE----------RIINP-ETSRYVVTVKEVADEVISTLVIMPTVREDSGFFSCHAINSFGED--RGIIQLTVQEPPDPPVV--EIREVKDRTIALRWT-MGFDGNSPITGYDIECKNKSASWLSAQVTKDVSPQLNQATIIDLHPSSTYNIRMIAKNIIGNSNPSNELTITTDEAAPDGPPQDVTLDSTSPQSIKVSWKPPLKHLQNGVIRGFQVGYREYSPGGSHQFTIISVDTTGDTTESIV----------------------LDNLKKFTQYSVVVQAANRAGTGPSSQQVVVKTLEDVPSRPPENVLAVAKSPEIISLSWMPLPREALNGNLQGYRVIYWANLPDGELGEI-RNVTTGQPSLELDSLEKYTNYSIQVLAFTNAGDGVRSEQIYVRTKEDVPGPPAGVKAAASSSSAVFVSWLPPLKLNGIIRKYIVFCSNLHP---MVMSEFEASPDIYFYRIPNLARNRQYSIWVVAVTAAGHGNNSEKITVEPLAKAPARILTFNGTVTTPWMKDIVVPCKAVGDPPPTIKWVKGNTNGTPTPVVVDGRRSLHGNGSFIIRTVKAEDSGNYSCVATNTWGSDEVTLNL---QVQVPPDQPRLTVTKTTTTSITLSWIPGDNGGSS----IRGYILQYSEDNSEQWGSFPISPSERSYRLENLKCGTWYKFTLTAQNAVGPGRISEIIEAKTHGKEPQFAKEHELFTSINSTRARLNLAGWNNG-GCPITSFILE--------YRAVDSPTWTTAQRTSLTK--SYILYDLQEATWYELQMKVTNSAGSTEKRITFATLSTDGSTIPPLLKTGDP 1580          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Medaka
Match: dscamb (Down syndrome cell adhesion molecule [Source:NCBI gene;Acc:101167815])

HSP 1 Score: 263.077 bits (671), Expect = 5.346e-70
Identity = 393/1668 (23.56%), Postives = 667/1668 (39.99%), Query Frame = 3
Query:  417 YCKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRNIYTDIDVKSHDWISPKRLEDNSKIDFTSICQNIEVR-VIKGSTLELPWCSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYA------SNPTVPSNPYLTHTVRVMINVSVDIKPTVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEE-KWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLNNLKI-SKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKYNEKLHLSQIS--------CVVQNHAGTIRKTIQISIDNLVFKESP-----PLDYSIVLGQSFALNCSAK----PTNIQLKTNWFXXXXXXXXXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKEDGNWDSLPVKRIKEKSKVSRFFVKFESVTDSLF-------------GEYKCVASNEHRKNGVERIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWKLVTENWFINATTKETS-----ITIEDLRPFKEYDIAIVAENSVGYGEEAT-IIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSP-AKYVAIRTLEDKPEGTPIQVLCSPKA-NFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNV--KETHLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIK-AYFYQNCLKVSWTPPIKANGHIREYIIVFS-FEPNNMITVSSRENDKPYYSWELCSEQICSNCNVSVLAVTTMK----GPRKTVNVLSNKMG-ILSFXXXXXXXXXXXXXLYCE-VAFPDENIYYLWTHNDKD-----IYG-QGVQSNGSLVINSMAESDQGIYKCKV----KSEEITYNVSTKSISLVPQTPYIEITKVSTNHIALLW--RSNGSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSN-PAISQAQTRGSIPEIPDTSNIVTEIGPHSMCFNLRAFRPGRGCPANKYILKLWPSSEGNHQESGVSVWKVVNDSDLNQIPCFNVTDLHPNTDYVYSIEASNMVGSQKAKAHNKTRQI-VSTAPPNINYSSP 5207
            YC A+N  G +RS+ + + K +  +   VR   ++      AV  C++  ++ AY+  V  WE    S S     +  + G            L+I +V   D  +   RC  R+ YT    +S+   S + +  +      +I    + R V+    +ELP C         + W    S          S+F+   +    LLI++   ++ G Y         N  V  + Y+   ++V+++      P  V       V L C  +G     L W  NG       +    T  +R + I   ++    G YQC A      + ++ ++D   V VI+ +  P ++          S+   V+  +   F + C     P     W LDD  +      I ++ + L +    T +  +++ +++   + + GG YR   +N  G  +    I V     IR   +IT   G +  + C VI     +I+W++++      LP  H Q   E+     +  V +V  +G+Y C   +   K+ S++  V +  PP +                         QP       +EF+       V       +   D  ++I +QK         +G  +P  +   V           I +   L +S ++        C+ +N A  +    Q     L+ +  P     P D   + G++  LNCSA+    PT +   +           P+     SRI  L NG+L++K++   D   ++C +   VG D +SK + + +K+PA I + P+     +  E  ++C  HG+  + V+W ++E          RI    + SR+ V  + V D +              G + C A N   ++    II L V + P   V+  E      R+IA+ W     DG  PIT Y +  K  + +W     TK+ S      TI DL P   Y+I ++A+N +G    +  + I T   AP+GP  ++   S S   +K+ W+ P + L NG+ + +QV   E     +      +  +  D+T  +V                      +  L  FT+Y+  V   N  G  P ++ V ++TLED P   P  VL   K+   + L W P P+   NG + GY V Y+++    E  ++ +NV   +  L+L +L   + Y IQ+    N G G  SE I   T E  P PP  +K A    + + VSW PP+K NG IR+YI+  S   P   + +S  E     Y + + +       ++ V+AVT         + TV  L+     IL+F+ ++       +V+ C+ V  P   I ++  + +       + G + +  NGS +I ++   D G Y C       S+E+T N+    + + P  P + +TK +T  I L W    NG       I  +++     N        +S + RS  + NL+CGT Y   L A+N  GP     I +A+T G  P+      + T I       NL  +  G GCP   +IL+        ++      W     + L +   + + DL   T Y   ++ +N  GS + +    T     ST PP +    P
Sbjct:  101 YCTAENPSGKIRSQDVHI-KAVSREPYTVRVADQKAMRGSVAVFKCIIPASVEAYVTVVS-WEKDTVSLSSGQRYLITSTG-----------ALYIVDVLPEDGLN-NYRCTTRHRYTGETRQSN---SARLIVSDPTNAEPAILDGFDHREVMINHRVELP-CKASGYPTPKYRWLKDNSPLE-----PDSRFR---QTISGLLIESTQPSDSGTYVCEVWNSYGNAEVVGHLYIKQPLKVVVS------PRKVKGSVGSKVSLSCSVSGSDEYELSWYRNGEIIYPGNNVRF-TGLNRENLIMEGMSKSDGGAYQCFAR-----KGKMSAQD--FVQVILEDGTPKIL---------SSFSEKVVSPNEPVFLV-CNVKGTPPPRCTWTLDDDPV------IKDSHHHLGH--YETHEAHVASQLNVTHTQVQDGGVYRCTCSNSAGVVYHQARINVRGRASIRPMKNITAIAGRDAFVHCRVIGYPYYSIKWYKNS----ALLPFNHRQRAFENNGTLKLSNVQQV-DAGEYTCKVMVQPNKMDSQSVHVRVRVPPYI-------------------------QP-------FEFQRFTIGQRV--FIPCVVMSGDRPLDITWQK---------DGRPIPASLGVTVDN---------IDFTSSLRISNLTPDHNGNYTCIARNEAAVVEHQSQ-----LIVRVPPQFVVQPEDQDGIYGKTVTLNCSAEGYPPPTIVWEHSK--GAGVPQFQPILLNSGSRIQLLSNGSLLIKHVLEDDSGFYLCKVSNDVGAD-VSKSMYLTVKIPAMITSYPNTTLATQGEEKRMSCIAHGEKPIMVRWEKEE----------RII-NPETSRYVVTVKEVADEVISTLVIMPTVREDSGFFSCHAINSFGED--RGIIQLTVQEPPDPPVV--EIREVKDRTIALRWT-MGFDGNSPITGYDIECKNKSASWLSAQVTKDVSPQLNQATIIDLHPSSTYNIRMIAKNIIGNSNPSNELTITTDEAAPDGPPQDVTLDSTSPQSIKVSWKPPLKHLQNGVIRGFQVGYREYSPGGSHQFTIISVDTTGDTTESIV----------------------LDNLKKFTQYSVVVQAANRAGTGPSSQQVVVKTLEDVPSRPPENVLAVAKSPEIISLSWMPLPREALNGNLQGYRVIYWANLPDGELGEI-RNVTTGQPSLELDSLEKYTNYSIQVLAFTNAGDGVRSEQIYVRTKEDVPGPPAGVKAAASSSSAVFVSWLPPLKLNGIIRKYIVFCSNLHP---MVMSEFEASPDIYFYRIPNLARNRQYSIWVVAVTAAGHGNNSEKITVEPLAKAPARILTFNGTVTTPWMKDIVVPCKAVGDPPPTIKWVKGNTNGTPTPVVVDGRRSLHGNGSFIIRTVKAEDSGNYSCVATNTWGSDEVTLNL---QVQVPPDQPRLTVTKTTTTSITLSWIPGDNGGSS----IRGYILQYSEDNSEQWGSFPISPSERSYRLENLKCGTWYKFTLTAQNAVGPGRISEIIEAKTHGKEPQFAKEHELFTSINSTRARLNLAGWNNG-GCPITSFILE--------YRAVDSPTWTTAQRTSLTK--SYILYDLQEATWYELQMKVTNSAGSTEKRITFATLSTDGSTIPPLLKTGDP 1585          
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Medaka
Match: dscaml1 (Down syndrome cell adhesion molecule-like protein 1 homolog [Source:NCBI gene;Acc:101165578])

HSP 1 Score: 254.988 bits (650), Expect = 1.977e-67
Identity = 407/1699 (23.96%), Postives = 663/1699 (39.02%), Query Frame = 3
Query:  264 CTATGNPSPKIKWYYETTQRNVFTEVND-PDRFVVGTNGDMDIFI---QANIEVI-----YCKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRNIYTDIDVKSHDWISPKRLEDNSKIDFTSICQNIEVRVIKGSTLELPW-CSMPNNQKIAWYWSS---AVSSR--RHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINV----SVDIKPTVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLN-NLKISKTFSVTIANPPIMLS-DLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQISIDNLVFKESPPLDYSIVLGQSFALNCSAK---PTNIQLK--TNWFXXXXXXXXXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKEDG-NWDSLPVKRI------KEKSKVSRFFVKFESVTDSLFGEYKCVASNEHRKNGVERIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWKLVTENWFINATTKETSIT-----IEDLRPFKEYDIAIVAENSVGYGEEAT-IIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSPAKY-VAIRTLEDKPEGTPIQVLC-SPKANFLFLEWNPPPQNVTNGVISGYEVTY---FSDDKHEEPDKLMKNVK--ETHLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIK-AYFYQNCLKVSWTPPIKANGHIREYIIVFS-----------FEPNNMI---TVSSRENDKPYYSWELCSEQIC-SNCNVSVLAVTTMKGPRKTVNVLSNKMGILSFXXXXXXXXXXXXXLYC-EVAFPDENIYYLWTHNDKD------IYGQG-VQSNGSLVINSMAESDQGIYKCKVKSEEITYNVSTKSISLV----PQTPYIEITKVSTNHIALLW--RSNGSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSN-PAISQAQTRGSIPEIPDTSNIVTEIGPHSMCFNLRAFRPGRGCPANKYILKLWPSSEGNHQESGVSVWKVVNDSDLNQIPCFNVTDLHPNTDYVYSIEASNMVG 5129
            C A G P   ++WY  T       ++ D P    V  NG + ++     A   +I     +C A+N+ G +RS +I + K +  +   VR   +       AV  CL+ P+ +     V  WE       K  + I      F  +  +    L+I  V K D +    RCI ++ Y+    +S+           S        Q+ EV++  G  +ELP   S   N  I W          SR  R +  L+ S  ++  ED GN + +                  +N + +  V   +NV     V + P  +    +  V L C   G P  ++ W  N       + F      + T  I+       +G YQC A  +        ++D    F II     LL   +P +  S+S    V    G  F + C     P  T+ W LDD+ +      +  + Y L      +  +++S+      + + GG YR    N  G A     I V     IR   +IT   G    + C VI     +I W++D     + LP+ H Q V E+G L + + V K +  G Y+C+  +   L I++T  VT+  PP++   D P + S+ K      + C+     D+P +  W                    + D +  +    IT+  K              F+     +I+++ +K+N        +C+ +N A T+    Q+++         P +   + G++  LNCS     P  +  K          +        +  RI  + NG+L+++++   D   ++C     VG D ISK + + +K+PA I + P+    K+ +   LNCT  G+  + ++W R +   + D  P   I      K    +S   +K     DS+F  + C A N + +     +I L V + P    +  E      RS+ + W     DG   IT Y + +K  T+ W +   T+  S T     I DL P   Y I + + N++G  E +  + I T+   P+GP +++   +V+   +++ W++P + L NG+ + YQ+   E     N         +  DS                        V T+  L  F +Y   V   N  G  P+   +   TLED P   P  V   S  ++   + W  PP+   +GV+ GY V +   F D +  E    M+N+   +  ++L +L   + Y IQ+      G G  S  +   T E  P PP  IK      + + VSW PP K NG IR+Y I  S           +E N  +    ++   + + Y  W          N +  V      K P K          ILSF  ++      +V L C  V  P  +I   WT + +D      + GQ  + +NG+LV+ S+   D G Y C   +   T    T  ++L+    P  P + ++  ST+ I L W    NG       +  F++     N    +++ +SS  RS  + NL CGT Y V L AKN  G      I +A+T G  P+      + T I       NL+ +  G GCP +   L+  P         G   W+ V     N      + +L   T Y   ++A N  G
Sbjct:   35 CPAGGAPHAVLRWYLATGD-----DIYDVPHIRHVHANGTLQLYPFSPSAYNSIIHDNEYFCTAENQAGKIRSPSIHI-KAVFREPYTVRVADQRSMRGNVAVFKCLI-PSAVQEYVSVVSWE-------KDTVSIVPGNRFFLTLYGA----LYISEVQKED-ALSTYRCITKHKYSGETRQSNGARLSVMDPTESTPSVLDSFQSGEVQI--GHNVELPCIASGYPNPTIRWLKDGRPLPADSRWTRRITGLTISDLRL--EDSGNYICEV-----------------TNSFGSKEVAGHLNVIEPLRVTLSPKNLKTGISSTVILSCAVQGSPHFTVSWYRNTESVLPDQHFSIQGAHNETLFISA-AQKRHSGAYQCFATRKGQT-----AQD----FSII-----LLEDGTPRIVASFSERVVV---PGEPFSLMCAAKGAPPPTITWTLDDEPVARDLSRVRTSQYTLSDGSTVS-HVNVSS-----PQIRDGGVYRCAARNSAGSAEYQARINVRGPPRIRPMKNITAVAGRNTFINCRVIGYPYYSINWYKDG----LLLPDNHRQVVFENGTLKLSD-VQKGMDEGAYVCSVLIQPQLFITQTVYVTVKVPPLIQPFDFPPT-SIGK---LMYIACV-VSSGDMPIHITW--------------------RKDGQEIVPSSGITIDTK-------------EFM--SSLQISKVSLKHN-----GNYTCIARNDAATVSTERQLTVTVPPRFVVQPNNQDGIYGKAAILNCSVDGYPPPKVMWKHAKGALAGIGNPQQYHPVPLTGRIQIMNNGSLLIRHVLEEDRGFYLCQASNGVGSD-ISKSMVLTVKIPAMITSHPNTTMAKKGHVKELNCTARGEWPIIIRWERGDTVIDPDRNPRYSITTSPNEKTDEVLSTLKLKPAEREDSVF--FSCHAINSYGEG--RGLIQLTVQEPPDPPEL--EVREVKDRSMNLRWT-QRFDGNSIITSYDIEYKNKTDTWELKHATRNISPTNNQANIVDLHPASVYSIRMYSYNAIGKSEASKELTISTEEAQPDGPPMDVTLQAVTSQSIRVTWKAPRKELQNGVIRGYQIGYRENGPGSNGQYSIVEMKATGDSE-----------------------VYTLDNLKKFAQYGVVVQAFNRAGTGPSSSEINATTLEDVPSQPPQNVRAISVTSDEAVITWAEPPRMTLHGVLKGYRVVFWAVFPDGEWGE----MQNITTIKEQVELKSLEKFTNYSIQVLAFTQAGDGVRSNVLYIQTREDLPGPPAGIKAVPSSASSVVVSWLPPHKPNGIIRKYTIYCSSPGLGQPLPSEYEANPELLFYRITHLNHRQQYLIWAAAVTTAGRGNFSDKVTVEPAAKAPAK----------ILSFGGTVTTPWMKEVRLPCSSVGEPTPSIK--WTKDSEDTAIPVSVDGQRLILANGTLVLRSVKAEDSGYYTCTATN---TLGFDTIIVNLLVQVPPDQPRLTVSSTSTSSITLAWIPGDNGGSS----VRGFVLQYSVDNTEEWKDVFISSTERSFKLDNLRCGTWYKVKLAAKNSVGAGRISEIIEAKTHGREPQFNKDQPVFTYINSSHARLNLQGWASG-GCPISAVTLEFRP--------KGTWAWQSVR---TNATADVFLAELREATWYELKMKACNSAG 1553          
BLAST of Down syndrome cell adhesion molecule vs. Planmine SMEST
Match: SMESG000048977.1 (SMESG000048977.1)

HSP 1 Score: 4111.99 bits (10663), Expect = 0.000e+0
Identity = 2073/2095 (98.95%), Postives = 2077/2095 (99.14%), Query Frame = 3
Query:   60 MRFFILILFNILCHFITFKNVNSFDHKSFFFFLNRHKRYAEERNLEPPKLINVQKSFVTTMTDHSRVYCTATGNPSPKIKWYYETTQRNVFTEVNDPDRFVVGTNGDMDIFIQANIEVIYCKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRNIYTDIDVKSHDWISPKRLEDNSKIDFTSICQNIEVRVIKGSTLELPWCSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLNNLKISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQISIDNLVFKESPPLDYSIVLGQSFALNCSAKPTNIQLKTNWFXXXXXXXXXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKEDGNWDSLPVKRIKEKSKVSRFFVKFESVTDSLFGEYKCVASNEHRKNGVERIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWKLVTENWFINATTKETSITIEDLRPFKEYDIAIVAENSVGYGEEATIIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSPAKYVAIRTLEDKPEGTPIQVLCSPKANFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNVKETHLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIKAYFYQNCLKVSWTPPIKANGHIREYIIVFSFEPNNMITVSSRENDKPYYSWELCSEQICSNCNVSVLAVTTMKGPRKTVNVLSNKMGILSFXXXXXXXXXXXXXLYCEVAFPDENIYYLWTHNDKDIYGQGVQSNGSLVINSMAESDQGIYKCKVKSEEITYNVSTKSISLVPQTPYIEITKVSTNHIALLWRSNGSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSNPAISQAQTRGSIPEIPDTSNIVTEIGPHSMCFNLRAFRPGRGCPANKYILKLWPSSEGNHQESGVSVWKVVNDSDLNQIPCFNVTDLHPNTDYVYSIEASNMVGSQKAKAHNKTRQIVSTAPPNINYSSPPLASELKYXXXXXXXXXXXXXXXXXXXXXYCTRRSCHTYFGNRNISNNLVKPPIRSPIPVSNNRNRKLPTPPDNNFYDKGNNIISKPQDNEEDEMLTPYATYESIPKPDPMTNRDRPNMSTNYNTGSQTNSYQYPEMQPLEASNPKMMNYPNDLKQPLLTHSIKHSSKKYDKGYSRGNESLATLRPQTVRSEVLVTMNKHRILPVISNAPGSMESEAYRPXXXXXXXXXXXXXKDELRQLFGNASGNQFPSRLQEQDEDGASTARGGNRSTLINRSHHHINNTLSDDSTQPESYCESGSSGDDCGIRNFTQDPPGQQVIAPQTIRNMNLRCNSLPYDTANRQPFIQQSNNFTLQQPRNPLPEEDEGEEANNYTNNFVVV 6344
            MRFFILILFNILCHFITFKNVNSFDHKSFFFFLNRHKRYAEERNLEPPKLINVQKSFVTTMTDHSRVYCTATGNPSPKIKWYYETTQRNVFTEVNDPDRFVVGTNGDMDIFIQANIEVIYCKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRNIYTDIDVKSHDWISPKRLEDNSKIDFTSICQN+EVRVIKGSTLELPWCSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLNNLKISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQISIDNLVFKESPPLDYSIVLGQSFALNCSAKPTNIQLKTNWFNVDSSNNVPVNSTVESRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKEDGNWDSLPVKRIKEKSKVSRFFVKFESVTDSL GEYKCVASNEHRKNGVERIILLNVVDVPGKVVIKNESIRSFSRSIAISWNPPNSDGKKPI RYLVSWKLVTENWFINATTKETSITIEDLRPFKEYDIAIVAENSVGYGEEATIIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSPAKYVAIRTLEDKPEGTPIQVLCSPKANFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNVKETHLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIKAYFYQNCLKVSWTPPIKANGHIREYIIVFSFEPNNMITVSSRENDKPYYSWELCSEQICSNCNVSVLAVTTMKGPRKTVNVLSNKMGILSFSQSIVVQNSSQVVLYCEVAFPDENIYYLWTHNDKDIYGQGVQSNGSLVINSMAESDQGIYKCKVKSEEITYNVSTKSISLVPQTPYIEITKVSTNHIALLWRSNGSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSNPAISQAQTRGSIPEIPDTSNIVTEIGPHSMCFNLRAFRPGRGCPANKYILKLWPSSEGNHQESGVSVWKVVNDSDLNQIPCFNVTDLHPNTDYVYSIEASNMVGSQKAKAHNKTRQIVSTAPPNINYSSPPLASELKYIFVAAVISVIILFVIIVVLALYCTRRSCHTYFGNRNISNNLVKPPIRSPIPVSNNRNRKLPTPPDNNFYDKGNNIISKPQDNEEDEMLTPYATYESIPKPDPMTNRDRPNMSTNYNTGSQTNSYQYPEMQPLEASNPKMMNYPNDLKQPLLTHSIKHS+               TLRPQTVRSEVL+TMNK RI+PVISNAPGSMESEAYRPSSSLCSSTTESSTKDELRQLFGNASGNQFPSRLQEQDEDGASTARGGNRSTLINRSHHHINNTLSDDSTQPESYCESGSSGDDCGIRNFTQDPPGQQVIAPQTIRNMNLRCNSLPYDTANRQPFIQQSNNFTLQQPRNPLPEEDEGEEANNYTNNFVVV
Sbjct:    1 MRFFILILFNILCHFITFKNVNSFDHKSFFFFLNRHKRYAEERNLEPPKLINVQKSFVTTMTDHSRVYCTATGNPSPKIKWYYETTQRNVFTEVNDPDRFVVGTNGDMDIFIQANIEVIYCKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRNIYTDIDVKSHDWISPKRLEDNSKIDFTSICQNMEVRVIKGSTLELPWCSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLNNLKISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQISIDNLVFKESPPLDYSIVLGQSFALNCSAKPTNIQLKTNWFNVDSSNNVPVNSTVESRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKEDGNWDSLPVKRIKEKSKVSRFFVKFESVTDSLSGEYKCVASNEHRKNGVERIILLNVVDVPGKVVIKNESIRSFSRSIAISWNPPNSDGKKPINRYLVSWKLVTENWFINATTKETSITIEDLRPFKEYDIAIVAENSVGYGEEATIIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSPAKYVAIRTLEDKPEGTPIQVLCSPKANFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNVKETHLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIKAYFYQNCLKVSWTPPIKANGHIREYIIVFSFEPNNMITVSSRENDKPYYSWELCSEQICSNCNVSVLAVTTMKGPRKTVNVLSNKMGILSFSQSIVVQNSSQVVLYCEVAFPDENIYYLWTHNDKDIYGQGVQSNGSLVINSMAESDQGIYKCKVKSEEITYNVSTKSISLVPQTPYIEITKVSTNHIALLWRSNGSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSNPAISQAQTRGSIPEIPDTSNIVTEIGPHSMCFNLRAFRPGRGCPANKYILKLWPSSEGNHQESGVSVWKVVNDSDLNQIPCFNVTDLHPNTDYVYSIEASNMVGSQKAKAHNKTRQIVSTAPPNINYSSPPLASELKYIFVAAVISVIILFVIIVVLALYCTRRSCHTYFGNRNISNNLVKPPIRSPIPVSNNRNRKLPTPPDNNFYDKGNNIISKPQDNEEDEMLTPYATYESIPKPDPMTNRDRPNMSTNYNTGSQTNSYQYPEMQPLEASNPKMMNYPNDLKQPLLTHSIKHST---------------TLRPQTVRSEVLMTMNKQRIIPVISNAPGSMESEAYRPSSSLCSSTTESSTKDELRQLFGNASGNQFPSRLQEQDEDGASTARGGNRSTLINRSHHHINNTLSDDSTQPESYCESGSSGDDCGIRNFTQDPPGQQVIAPQTIRNMNLRCNSLPYDTANRQPFIQQSNNFTLQQPRNPLPEEDEGEEANNYTNNFVVV 2080          
BLAST of Down syndrome cell adhesion molecule vs. Planmine SMEST
Match: SMESG000048977.1 (SMESG000048977.1)

HSP 1 Score: 3986.03 bits (10336), Expect = 0.000e+0
Identity = 2013/2035 (98.92%), Postives = 2017/2035 (99.12%), Query Frame = 3
Query:  240 MTDHSRVYCTATGNPSPKIKWYYETTQRNVFTEVNDPDRFVVGTNGDMDIFIQANIEVIYCKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRNIYTDIDVKSHDWISPKRLEDNSKIDFTSICQNIEVRVIKGSTLELPWCSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLNNLKISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQISIDNLVFKESPPLDYSIVLGQSFALNCSAKPTNIQLKTNWFXXXXXXXXXXXXXXXXRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKEDGNWDSLPVKRIKEKSKVSRFFVKFESVTDSLFGEYKCVASNEHRKNGVERIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWKLVTENWFINATTKETSITIEDLRPFKEYDIAIVAENSVGYGEEATIIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSPAKYVAIRTLEDKPEGTPIQVLCSPKANFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNVKETHLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIKAYFYQNCLKVSWTPPIKANGHIREYIIVFSFEPNNMITVSSRENDKPYYSWELCSEQICSNCNVSVLAVTTMKGPRKTVNVLSNKMGILSFXXXXXXXXXXXXXLYCEVAFPDENIYYLWTHNDKDIYGQGVQSNGSLVINSMAESDQGIYKCKVKSEEITYNVSTKSISLVPQTPYIEITKVSTNHIALLWRSNGSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSNPAISQAQTRGSIPEIPDTSNIVTEIGPHSMCFNLRAFRPGRGCPANKYILKLWPSSEGNHQESGVSVWKVVNDSDLNQIPCFNVTDLHPNTDYVYSIEASNMVGSQKAKAHNKTRQIVSTAPPNINYSSPPLASELKYXXXXXXXXXXXXXXXXXXXXXYCTRRSCHTYFGNRNISNNLVKPPIRSPIPVSNNRNRKLPTPPDNNFYDKGNNIISKPQDNEEDEMLTPYATYESIPKPDPMTNRDRPNMSTNYNTGSQTNSYQYPEMQPLEASNPKMMNYPNDLKQPLLTHSIKHSSKKYDKGYSRGNESLATLRPQTVRSEVLVTMNKHRILPVISNAPGSMESEAYRPXXXXXXXXXXXXXKDELRQLFGNASGNQFPSRLQEQDEDGASTARGGNRSTLINRSHHHINNTLSDDSTQPESYCESGSSGDDCGIRNFTQDPPGQQVIAPQTIRNMNLRCNSLPYDTANRQPFIQQSNNFTLQQPRNPLPEEDEGEEANNYTNNFVVV 6344
            MTDHSRVYCTATGNPSPKIKWYYETTQRNVFTEVNDPDRFVVGTNGDMDIFIQANIEVIYCKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRNIYTDIDVKSHDWISPKRLEDNSKIDFTSICQN+EVRVIKGSTLELPWCSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLNNLKISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQISIDNLVFKESPPLDYSIVLGQSFALNCSAKPTNIQLKTNWFNVDSSNNVPVNSTVESRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKEDGNWDSLPVKRIKEKSKVSRFFVKFESVTDSL GEYKCVASNEHRKNGVERIILLNVVDVPGKVVIKNESIRSFSRSIAISWNPPNSDGKKPI RYLVSWKLVTENWFINATTKETSITIEDLRPFKEYDIAIVAENSVGYGEEATIIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSPAKYVAIRTLEDKPEGTPIQVLCSPKANFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNVKETHLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIKAYFYQNCLKVSWTPPIKANGHIREYIIVFSFEPNNMITVSSRENDKPYYSWELCSEQICSNCNVSVLAVTTMKGPRKTVNVLSNKMGILSFSQSIVVQNSSQVVLYCEVAFPDENIYYLWTHNDKDIYGQGVQSNGSLVINSMAESDQGIYKCKVKSEEITYNVSTKSISLVPQTPYIEITKVSTNHIALLWRSNGSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSNPAISQAQTRGSIPEIPDTSNIVTEIGPHSMCFNLRAFRPGRGCPANKYILKLWPSSEGNHQESGVSVWKVVNDSDLNQIPCFNVTDLHPNTDYVYSIEASNMVGSQKAKAHNKTRQIVSTAPPNINYSSPPLASELKYIFVAAVISVIILFVIIVVLALYCTRRSCHTYFGNRNISNNLVKPPIRSPIPVSNNRNRKLPTPPDNNFYDKGNNIISKPQDNEEDEMLTPYATYESIPKPDPMTNRDRPNMSTNYNTGSQTNSYQYPEMQPLEASNPKMMNYPNDLKQPLLTHSIKHS+               TLRPQTVRSEVL+TMNK RI+PVISNAPGSMESEAYRPSSSLCSSTTESSTKDELRQLFGNASGNQFPSRLQEQDEDGASTARGGNRSTLINRSHHHINNTLSDDSTQPESYCESGSSGDDCGIRNFTQDPPGQQVIAPQTIRNMNLRCNSLPYDTANRQPFIQQSNNFTLQQPRNPLPEEDEGEEANNYTNNFVVV
Sbjct:    1 MTDHSRVYCTATGNPSPKIKWYYETTQRNVFTEVNDPDRFVVGTNGDMDIFIQANIEVIYCKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRNIYTDIDVKSHDWISPKRLEDNSKIDFTSICQNMEVRVIKGSTLELPWCSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLNNLKISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQISIDNLVFKESPPLDYSIVLGQSFALNCSAKPTNIQLKTNWFNVDSSNNVPVNSTVESRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKEDGNWDSLPVKRIKEKSKVSRFFVKFESVTDSLSGEYKCVASNEHRKNGVERIILLNVVDVPGKVVIKNESIRSFSRSIAISWNPPNSDGKKPINRYLVSWKLVTENWFINATTKETSITIEDLRPFKEYDIAIVAENSVGYGEEATIIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSPAKYVAIRTLEDKPEGTPIQVLCSPKANFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNVKETHLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIKAYFYQNCLKVSWTPPIKANGHIREYIIVFSFEPNNMITVSSRENDKPYYSWELCSEQICSNCNVSVLAVTTMKGPRKTVNVLSNKMGILSFSQSIVVQNSSQVVLYCEVAFPDENIYYLWTHNDKDIYGQGVQSNGSLVINSMAESDQGIYKCKVKSEEITYNVSTKSISLVPQTPYIEITKVSTNHIALLWRSNGSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSNPAISQAQTRGSIPEIPDTSNIVTEIGPHSMCFNLRAFRPGRGCPANKYILKLWPSSEGNHQESGVSVWKVVNDSDLNQIPCFNVTDLHPNTDYVYSIEASNMVGSQKAKAHNKTRQIVSTAPPNINYSSPPLASELKYIFVAAVISVIILFVIIVVLALYCTRRSCHTYFGNRNISNNLVKPPIRSPIPVSNNRNRKLPTPPDNNFYDKGNNIISKPQDNEEDEMLTPYATYESIPKPDPMTNRDRPNMSTNYNTGSQTNSYQYPEMQPLEASNPKMMNYPNDLKQPLLTHSIKHST---------------TLRPQTVRSEVLMTMNKQRIIPVISNAPGSMESEAYRPSSSLCSSTTESSTKDELRQLFGNASGNQFPSRLQEQDEDGASTARGGNRSTLINRSHHHINNTLSDDSTQPESYCESGSSGDDCGIRNFTQDPPGQQVIAPQTIRNMNLRCNSLPYDTANRQPFIQQSNNFTLQQPRNPLPEEDEGEEANNYTNNFVVV 2020          
BLAST of Down syndrome cell adhesion molecule vs. Planmine SMEST
Match: SMESG000024214.1 (SMESG000024214.1)

HSP 1 Score: 598.971 bits (1543), Expect = 3.075e-178
Identity = 495/1722 (28.75%), Postives = 793/1722 (46.05%), Query Frame = 3
Query:  201 PKLINVQKSFVTTMTDHSR--VYCTATGNPSPKIKWYYET-----TQRNV----FTEVNDPDRFVVGTNGDMDIFIQANIEVIYCKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRNIYTDIDVKS--------HDWISPKRLEDNSKIDFTSICQNIE-VRVIKGSTLELPWCSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNA---DTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTT--YRLPYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAK-GKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLNNLKISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKY--NEKLHLSQISCVVQNHAGTIRKTIQISIDNLVFKESPPLDYSIVLGQSFALNCSAKPTNIQLKTNWFXXXXXXXXXXXXXXX---XRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEI-SKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGD-DELDVKW-YRKED-GNWDSL----------------PVKR-----IKE--KSKVSRFFVKFESVTDSLFGEYKCVASNEHRKNGVERIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWK---------LVTENWFINATTKETSITIEDLRPFKEYDIAIVAENSVGYGEEATIIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSPAKYVAIRTLEDKPEGTPIQVLCSPKANFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNV--KETHLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIKAYFYQN-CLKVSWTPPIKANGHIREYIIVFSFEPNNMITVSSRENDKPYYSWELCSEQICSNCNVSVLAVTTMKGPRKTVNVLSNKMGILSFXXXXXXXXXXXXXLYCEVAFPDENIYYLWTHNDKDIYG-----QGVQSNGSLVINSMAESDQGIYKCKVKSEEITYNVST-KSISLVPQTPYIEITKVSTNHIALLWRSNGSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSNPA-ISQAQTRGSIPEIPDTSNI--VTEIGPHSMCFNLRAFRPGRGCPANKYILKLWPSSEGNHQESGVSVWKVVNDSDLNQIPCFNVTDLHPNTDYVYSIEASNMVG 5129
            P  +  +     T+ D+ R  + C   G P P  +WY  T     T  N+    F  ++  D++ +  N +        I + YC AQN LG + SK + V+K      + ++  +  V   +K V+ C +   + + ++    WE+R   D  ++  I KTEGR+SVI  ++ PQLHIRNVTK DF+  + RCI  +     D+ S        +D++ P+ L +         C + E + V  GS LELPWCS+P   ++ W+   ++++    +     K++MIS  +GNLLIKN+   + G Y            + +TV+V    S+ + P  V +  ++ ++  C AT Y +    WL NG    +          S  +H  +RV +     AG+YQC+AE+ DN   RI    Q S  +++ ++ P L  Q P V+   +     +  +     I+C F+  P   + WY D  KIP+  +    T   ++  Y  IA L ++L+ +++ E+  KY G+Y+A  TN  G+A C+T + +     +R   ++T   G +  L CY  +   P   W    K GK   +P T    + ++    +++ + K    G Y C +T N+   S    + IA PP  L  LP    +N      S  C    + D PWY WW F +  +N ++ +  + ++   DL+  ++Y     S+ YT     + K VP F     NK A + IK   +E   L + +C  +NH G    +++     L FK  PP    +++G    LNCSAK +++  +T W   +  N   VN   E   +RI Q  NGTL +KNI+ TDP K  C I P     ++ S+V  I I++PA     P    +      +++C V+G   +L V W YR  D G W+++                P+K      I E   +  S   ++F   T+S+ G+YKC   N   K   E    L ++  P KV+  +E   S S SI I W PP  DG +PI  Y++ +          +  +  FIN++T    + I +LRPF+ Y++++ AEN VG GE   I + TQ   PE PV +L A S   D++ + WE+P     NG   HYQVC  +I D++   + + +W              N  VK  C  V  +T  ++V +L  FT +  RVI  N++G SP  Y  +RTLED P+  P  + C      + L WNPP     NGV+ GY V+Y+  +K+ +   +   +      L L  L   + Y I +   N  G+GPPS  I CTT EA P+ P  +KA    N C ++ W    K +G I  Y +      + ++     +  K Y S  LC     +  +V V A     G  K V    +  GILS   +I V + S V+L CE   P  +    W  +   I G       + SN SL I  + +    +Y C  +S+ I Y ++   S     + P I   + + N I + W+S G+     PI+ F +   N     S+ +     +R+  + N+ CG+ + + + + N  G S  + + + +T G+ P I D+  I  +  I   S   NL AF PG  C A  + +++  +S+G+     + V K ++  +L    C+ +  LHP T Y +++ A N  G
Sbjct:   20 PPTVTKELQHTITVFDNQRFTLECGIEGTPRPDYQWYVSTPWGEDTNLNIADIQFQNISSGDQYYLEINRNKSTKKFFKI-MYYCSAQNPLGILHSKKVIVEKVTRPDSIDIKYTSHIVYEGEKFVVTCHIDHDLWSNMFKFIQWEVR--DDKSRMHIINKTEGRYSVITSTKKPQLHIRNVTKVDFAKWKFRCIFESGAHKKDIHSGYLTKIPYYDYVFPQYLSNK--------CYDGETISVTSGSDLELPWCSIPITFEVMWFKVDSLNNLETEIREDNPKYRMISRRYGNLLIKNVTKNDAGIYKVRTTGKSKLIKIFYTVKVDETASISLSPLKVISEPSKQIEFNCSAT-YSKSQFHWLHNGKRVVTGYDDNNIDISSSNNHSILRVKSARISVAGIYQCIAEA-DNELKRISEYRQLSASLLLTKVPPYLSKQIPRVEKGTNITLIQISKNSKPKTIECVFSANPRPNIDWYHDSTKIPITPLFNIETKEDFKSVYNFIARLTVNLN-LINQEDIIKYAGQYQATATNSLGEASCSTFVLMDIPLELRLPKNLTAISGKDYLLTCYFAAMDVPQFSWDHQTKSGKWESMPSTRRTKMIDNNHKLLLKDLIKPEDEGIYRCTATFNSETKSAITYLNIAIPP-KLQKLPSKQEINT---LNSQICSVDIKVDKPWYVWWTFTKYSNNETILIEPDQFV---DLEYSVQYP----SKSYTYIDQPI-KDVPKFAYQYANKGAHLIIKERNSETSALGKFTCHARNHIGYTNWSVEDIFLRLEFKIIPPSTSEVIVGNDLYLNCSAKESDLNPQTRWRISNGKNYTDVNDKKEIFNNRIFQYENGTLAMKNIQETDPTKLFCFIIPSKKNFDVRSQVAYIDIRIPARTRTWPQQRFVVAGKSFNMSCIVYGHTKDLKVTWFYRSNDIGQWENIYRTCIYSLENACIHQYPLKNRNFNPISEPINATYSVAHLEFLEPTESISGQYKCQVRNAFNKRYDETQTNLIIISKPSKVIFDSEQRLSTSTSIEIQWKPPLKDGHRPIKGYILKYSELPIHLEKNIEGKPLFINSST--LFMKINNLRPFRTYNVSVAAENEVGVGEPNVIEVTTQESKPEKPVRSLKAISTFPDEILVTWETPEPYYQNGKITHYQVCYQKIDDAK---IAQLSW-------------SNDNVK--CEQVHANT--VSVNKLPQFTNFGIRVIASNSMGHSPPAYAKVRTLEDLPQAPPTDLTCKINQQQIQLYWNPPVFEKINGVLIGYAVSYYKPNKYGDESNMNTIIVRGSDSLLLDKLEPYTGYSIHVMAMNRKGMGPPSLRIMCTTAEAKPEAPEIVKAVKINNTCWQIVWLHTPKPHGKILLYCVTIDRRVDALL-CQPPDWSKRYNSMPLCDLN-SAYSDVEVFARNKHDGASKKVPSFKDYGGILSIGGTINVDDGSSVLLLCE-TLPSYDKSTFWKKDGSTIIGNENSNMKIYSNNSLEIKPVEKYVNHVYTCSTESDSIEYIINVIDSSDATLRPPIIADYETTENSIFITWKSGGTTNVVAPISGFNLEWTNLYTKESKTVSFDGKVRTFYLNNVTCGSEFRIKIRSFNTEGKSPYSHVKKLRTLGTPPIIADSKAILPLKNIESKSALLNLNAFAPGENCSALYFKIEVSLTSKGSINNGELVVNKTLSIYELENKCCYRLVGLHPMTIYKFNVTAYNSAG 1690          
BLAST of Down syndrome cell adhesion molecule vs. Planmine SMEST
Match: SMESG000024214.1 (SMESG000024214.1)

HSP 1 Score: 598.971 bits (1543), Expect = 3.431e-178
Identity = 495/1722 (28.75%), Postives = 793/1722 (46.05%), Query Frame = 3
Query:  201 PKLINVQKSFVTTMTDHSR--VYCTATGNPSPKIKWYYET-----TQRNV----FTEVNDPDRFVVGTNGDMDIFIQANIEVIYCKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRNIYTDIDVKS--------HDWISPKRLEDNSKIDFTSICQNIE-VRVIKGSTLELPWCSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNA---DTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTT--YRLPYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAK-GKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLNNLKISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKY--NEKLHLSQISCVVQNHAGTIRKTIQISIDNLVFKESPPLDYSIVLGQSFALNCSAKPTNIQLKTNWFXXXXXXXXXXXXXXX---XRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEI-SKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGD-DELDVKW-YRKED-GNWDSL----------------PVKR-----IKE--KSKVSRFFVKFESVTDSLFGEYKCVASNEHRKNGVERIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWK---------LVTENWFINATTKETSITIEDLRPFKEYDIAIVAENSVGYGEEATIIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSPAKYVAIRTLEDKPEGTPIQVLCSPKANFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNV--KETHLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIKAYFYQN-CLKVSWTPPIKANGHIREYIIVFSFEPNNMITVSSRENDKPYYSWELCSEQICSNCNVSVLAVTTMKGPRKTVNVLSNKMGILSFXXXXXXXXXXXXXLYCEVAFPDENIYYLWTHNDKDIYG-----QGVQSNGSLVINSMAESDQGIYKCKVKSEEITYNVST-KSISLVPQTPYIEITKVSTNHIALLWRSNGSPKTEYPINQFLVVIQNANGSSSRELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSNPA-ISQAQTRGSIPEIPDTSNI--VTEIGPHSMCFNLRAFRPGRGCPANKYILKLWPSSEGNHQESGVSVWKVVNDSDLNQIPCFNVTDLHPNTDYVYSIEASNMVG 5129
            P  +  +     T+ D+ R  + C   G P P  +WY  T     T  N+    F  ++  D++ +  N +        I + YC AQN LG + SK + V+K      + ++  +  V   +K V+ C +   + + ++    WE+R   D  ++  I KTEGR+SVI  ++ PQLHIRNVTK DF+  + RCI  +     D+ S        +D++ P+ L +         C + E + V  GS LELPWCS+P   ++ W+   ++++    +     K++MIS  +GNLLIKN+   + G Y            + +TV+V    S+ + P  V +  ++ ++  C AT Y +    WL NG    +          S  +H  +RV +     AG+YQC+AE+ DN   RI    Q S  +++ ++ P L  Q P V+   +     +  +     I+C F+  P   + WY D  KIP+  +    T   ++  Y  IA L ++L+ +++ E+  KY G+Y+A  TN  G+A C+T + +     +R   ++T   G +  L CY  +   P   W    K GK   +P T    + ++    +++ + K    G Y C +T N+   S    + IA PP  L  LP    +N      S  C    + D PWY WW F +  +N ++ +  + ++   DL+  ++Y     S+ YT     + K VP F     NK A + IK   +E   L + +C  +NH G    +++     L FK  PP    +++G    LNCSAK +++  +T W   +  N   VN   E   +RI Q  NGTL +KNI+ TDP K  C I P     ++ S+V  I I++PA     P    +      +++C V+G   +L V W YR  D G W+++                P+K      I E   +  S   ++F   T+S+ G+YKC   N   K   E    L ++  P KV+  +E   S S SI I W PP  DG +PI  Y++ +          +  +  FIN++T    + I +LRPF+ Y++++ AEN VG GE   I + TQ   PE PV +L A S   D++ + WE+P     NG   HYQVC  +I D++   + + +W              N  VK  C  V  +T  ++V +L  FT +  RVI  N++G SP  Y  +RTLED P+  P  + C      + L WNPP     NGV+ GY V+Y+  +K+ +   +   +      L L  L   + Y I +   N  G+GPPS  I CTT EA P+ P  +KA    N C ++ W    K +G I  Y +      + ++     +  K Y S  LC     +  +V V A     G  K V    +  GILS   +I V + S V+L CE   P  +    W  +   I G       + SN SL I  + +    +Y C  +S+ I Y ++   S     + P I   + + N I + W+S G+     PI+ F +   N     S+ +     +R+  + N+ CG+ + + + + N  G S  + + + +T G+ P I D+  I  +  I   S   NL AF PG  C A  + +++  +S+G+     + V K ++  +L    C+ +  LHP T Y +++ A N  G
Sbjct:   38 PPTVTKELQHTITVFDNQRFTLECGIEGTPRPDYQWYVSTPWGEDTNLNIADIQFQNISSGDQYYLEINRNKSTKKFFKI-MYYCSAQNPLGILHSKKVIVEKVTRPDSIDIKYTSHIVYEGEKFVVTCHIDHDLWSNMFKFIQWEVR--DDKSRMHIINKTEGRYSVITSTKKPQLHIRNVTKVDFAKWKFRCIFESGAHKKDIHSGYLTKIPYYDYVFPQYLSNK--------CYDGETISVTSGSDLELPWCSIPITFEVMWFKVDSLNNLETEIREDNPKYRMISRRYGNLLIKNVTKNDAGIYKVRTTGKSKLIKIFYTVKVDETASISLSPLKVISEPSKQIEFNCSAT-YSKSQFHWLHNGKRVVTGYDDNNIDISSSNNHSILRVKSARISVAGIYQCIAEA-DNELKRISEYRQLSASLLLTKVPPYLSKQIPRVEKGTNITLIQISKNSKPKTIECVFSANPRPNIDWYHDSTKIPITPLFNIETKEDFKSVYNFIARLTVNLN-LINQEDIIKYAGQYQATATNSLGEASCSTFVLMDIPLELRLPKNLTAISGKDYLLTCYFAAMDVPQFSWDHQTKSGKWESMPSTRRTKMIDNNHKLLLKDLIKPEDEGIYRCTATFNSETKSAITYLNIAIPP-KLQKLPSKQEINT---LNSQICSVDIKVDKPWYVWWTFTKYSNNETILIEPDQFV---DLEYSVQYP----SKSYTYIDQPI-KDVPKFAYQYANKGAHLIIKERNSETSALGKFTCHARNHIGYTNWSVEDIFLRLEFKIIPPSTSEVIVGNDLYLNCSAKESDLNPQTRWRISNGKNYTDVNDKKEIFNNRIFQYENGTLAMKNIQETDPTKLFCFIIPSKKNFDVRSQVAYIDIRIPARTRTWPQQRFVVAGKSFNMSCIVYGHTKDLKVTWFYRSNDIGQWENIYRTCIYSLENACIHQYPLKNRNFNPISEPINATYSVAHLEFLEPTESISGQYKCQVRNAFNKRYDETQTNLIIISKPSKVIFDSEQRLSTSTSIEIQWKPPLKDGHRPIKGYILKYSELPIHLEKNIEGKPLFINSST--LFMKINNLRPFRTYNVSVAAENEVGVGEPNVIEVTTQESKPEKPVRSLKAISTFPDEILVTWETPEPYYQNGKITHYQVCYQKIDDAK---IAQLSW-------------SNDNVK--CEQVHANT--VSVNKLPQFTNFGIRVIASNSMGHSPPAYAKVRTLEDLPQAPPTDLTCKINQQQIQLYWNPPVFEKINGVLIGYAVSYYKPNKYGDESNMNTIIVRGSDSLLLDKLEPYTGYSIHVMAMNRKGMGPPSLRIMCTTAEAKPEAPEIVKAVKINNTCWQIVWLHTPKPHGKILLYCVTIDRRVDALL-CQPPDWSKRYNSMPLCDLN-SAYSDVEVFARNKHDGASKKVPSFKDYGGILSIGGTINVDDGSSVLLLCE-TLPSYDKSTFWKKDGSTIIGNENSNMKIYSNNSLEIKPVEKYVNHVYTCSTESDSIEYIINVIDSSDATLRPPIIADYETTENSIFITWKSGGTTNVVAPISGFNLEWTNLYTKESKTVSFDGKVRTFYLNNVTCGSEFRIKIRSFNTEGKSPYSHVKKLRTLGTPPIIADSKAILPLKNIESKSALLNLNAFAPGENCSALYFKIEVSLTSKGSINNGELVVNKTLSIYELENKCCYRLVGLHPMTIYKFNVTAYNSAG 1708          
BLAST of Down syndrome cell adhesion molecule vs. Planmine SMEST
Match: SMESG000024214.1 (SMESG000024214.1)

HSP 1 Score: 535.798 bits (1379), Expect = 4.378e-160
Identity = 445/1520 (29.28%), Postives = 699/1520 (45.99%), Query Frame = 3
Query:  201 PKLINVQKSFVTTMTDHSR--VYCTATGNPSPKIKWYYET-----TQRNV----FTEVNDPDRFVVGTNGDMDIFIQANIEVIYCKAQNELGTVRSKTITVQKWIDHKDVKVRCETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEGRFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRNIYTDIDVKS--------HDWISPKRLEDNSKIDFTSICQNIE-VRVIKGSTLELPWCSMPNNQKIAWYWSSAVSSRRHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTHTVRVMINVSVDIKPTVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNSSKSFETDTNFSRTSHITIRVNA---DTAGVYQCLAESRDNAENRILSEDQKSVFVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTVAWYLDDKKIPMVNVLIPNTT--YRLPYTVIATLQIDLSAMMSIEEKWKYGGEYRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGLKPTIEWFRDAK-GKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNSTLNNLKISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDLPWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGAALPKGVPNFVRYQHNKIAQIWIKY--NEKLHLSQISCVVQNHAGTIRKTIQISIDNLVFKESPPLDYSIVLGQSFALNCSAKPTNIQLKTNWFXXXXXXXXXXXXXXX---XRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEI-SKVVKIAIKVPATILNMPDVIDMKRNYENSLNCTVHGD-DELDVKW-YRKED-GNWDSL----------------PVKR-----IKE--KSKVSRFFVKFESVTDSLFGEYKCVASNEHRKNGVERIILLNVVDVPGKVVIKNEXXXXXXXXXXXXWNPPNSDGKKPITRYLVSWK---------LVTENWFINATTKETSITIEDLRPFKEYDIAIVAENSVGYGEEATIIIKTQADAPEGPVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLEKFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFRVILVNNVGFSPAKYVAIRTLEDKPEGTPIQVLCSPKANFLFLEWNPPPQNVTNGVISGYEVTYFSDDKHEEPDKLMKNV--KETHLKLYNLSANSKYIIQIRVKNNIGLGPPSEPINCTTNEAAPDPPNEIKAYFYQN-CLKVSWTPPIKANGHIREYIIVFSFEPNNMITVSSRENDKPYYSWELCSEQICSNCNVSVLAVTTMKGPRKTVNVLSNKMGILSFXXXXXXXXXXXXXLYCEVAFPDENIYYLWTHNDKDIYG-----QGVQSNGSLVINSMAESDQGIYKCKVKSEEITY 4535
            P  +  +     T+ D+ R  + C   G P P  +WY  T     T  N+    F  ++  D++ +  N +        I + YC AQN LG + SK + V+K      + ++  +  V   +K V+ C +   + + ++    WE+R   D  ++  I KTEGR+SVI  ++ PQLHIRNVTK DF+  + RCI  +     D+ S        +D++ P+ L +         C + E + V  GS LELPWCS+P   ++ W+   ++++    +     K++MIS  +GNLLIKN+   + G Y            + +TV+V    S+ + P  V +  ++ ++  C AT Y +    WL NG    +          S  +H  +RV +     AG+YQC+AE+ DN   RI    Q S  +++ ++ P L  Q P V+   +     +  +     I+C F+  P   + WY D  KIP+  +    T   ++  Y  IA L ++L+ +++ E+  KY G+Y+A  TN  G+A C+T + +     +R   ++T   G +  L CY  +   P   W    K GK   +P T    + ++    +++ + K    G Y C +T N+   S    + IA PP  L  LP    +N      S  C    + D PWY WW F +  +N ++ +  + ++   DL+  ++Y     S+ YT     + K VP F     NK A + IK   +E   L + +C  +NH G    +++     L FK  PP    +++G    LNCSAK +++  +T W   +  N   VN   E   +RI Q  NGTL +KNI+ TDP K  C I P     ++ S+V  I I++PA     P    +      +++C V+G   +L V W YR  D G W+++                P+K      I E   +  S   ++F   T+S+ G+YKC   N   K   E    L ++  P KV+  +E   S S SI I W PP  DG +PI  Y++ +          +  +  FIN++T    + I +LRPF+ Y++++ AEN VG GE   I + TQ   PE PV +L A S   D++ + WE+P     NG   HYQVC  +I D++   + + +W              N  VK  C  V  +T  ++V +L  FT +  RVI  N++G SP  Y  +RTLED P+  P  + C      + L WNPP     NGV+ GY V+Y+  +K+ +   +   +      L L  L   + Y I +   N  G+GPPS  I CTT EA P+ P  +KA    N C ++ W    K +G I  Y +      + ++     +  K Y S  LC     +  +V V A     G  K V    +  GILS   +I V + S V+L CE   P  +    W  +   I G       + SN SL I  + +    +Y C  +S+ I Y
Sbjct:   38 PPTVTKELQHTITVFDNQRFTLECGIEGTPRPDYQWYVSTPWGEDTNLNIADIQFQNISSGDQYYLEINRNKSTKKFFKI-MYYCSAQNPLGILHSKKVIVEKVTRPDSIDIKYTSHIVYEGEKFVVTCHIDHDLWSNMFKFIQWEVR--DDKSRMHIINKTEGRYSVITSTKKPQLHIRNVTKVDFAKWKFRCIFESGAHKKDIHSGYLTKIPYYDYVFPQYLSNK--------CYDGETISVTSGSDLELPWCSIPITFEVMWFKVDSLNNLETEIREDNPKYRMISRRYGNLLIKNVTKNDAGIYKVRTTGKSKLIKIFYTVKVDETASISLSPLKVISEPSKQIEFNCSAT-YSKSQFHWLHNGKRVVTGYDDNNIDISSSNNHSILRVKSARISVAGIYQCIAEA-DNELKRISEYRQLSASLLLTKVPPYLSKQIPRVEKGTNITLIQISKNSKPKTIECVFSANPRPNIDWYHDSTKIPITPLFNIETKEDFKSVYNFIARLTVNLN-LINQEDIIKYAGQYQATATNSLGEASCSTFVLMDIPLELRLPKNLTAISGKDYLLTCYFAAMDVPQFSWDHQTKSGKWESMPSTRRTKMIDNNHKLLLKDLIKPEDEGIYRCTATFNSETKSAITYLNIAIPP-KLQKLPSKQEINT---LNSQICSVDIKVDKPWYVWWTFTKYSNNETILIEPDQFV---DLEYSVQYP----SKSYTYIDQPI-KDVPKFAYQYANKGAHLIIKERNSETSALGKFTCHARNHIGYTNWSVEDIFLRLEFKIIPPSTSEVIVGNDLYLNCSAKESDLNPQTRWRISNGKNYTDVNDKKEIFNNRIFQYENGTLAMKNIQETDPTKLFCFIIPSKKNFDVRSQVAYIDIRIPARTRTWPQQRFVVAGKSFNMSCIVYGHTKDLKVTWFYRSNDIGQWENIYRTCIYSLENACIHQYPLKNRNFNPISEPINATYSVAHLEFLEPTESISGQYKCQVRNAFNKRYDETQTNLIIISKPSKVIFDSEQRLSTSTSIEIQWKPPLKDGHRPIKGYILKYSELPIHLEKNIEGKPLFINSST--LFMKINNLRPFRTYNVSVAAENEVGVGEPNVIEVTTQESKPEKPVRSLKAISTFPDEILVTWETPEPYYQNGKITHYQVCYQKIDDAK---IAQLSW-------------SNDNVK--CEQVHANT--VSVNKLPQFTNFGIRVIASNSMGHSPPAYAKVRTLEDLPQAPPTDLTCKINQQQIQLYWNPPVFEKINGVLIGYAVSYYKPNKYGDESNMNTIIVRGSDSLLLDKLEPYTGYSIHVMAMNRKGMGPPSLRIMCTTAEAKPEAPEIVKAVKINNTCWQIVWLHTPKPHGKILLYCVTIDRRVDALL-CQPPDWSKRYNSMPLCDLN-SAYSDVEVFARNKHDGASKKVPSFKDYGGILSIGGTINVDDGSSVLLLCE-TLPSYDKSTFWKKDGSTIIGNENSNMKIYSNNSLEIKPVEKYVNHVYTCSTESDSIEY 1506          
The following BLAST results are available for this feature:
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DSCAM1.916e-8324.39DS cell adhesion molecule [Source:HGNC Symbol;Acc:... [more]
DSCAML11.356e-7624.07DS cell adhesion molecule like 1 [Source:HGNC Symb... [more]
DSCAML11.389e-7624.07DS cell adhesion molecule like 1 [Source:HGNC Symb... [more]
DSCAML11.389e-7624.07DS cell adhesion molecule like 1 [Source:HGNC Symb... [more]
DSCAM6.845e-7424.31DS cell adhesion molecule [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rig-43.725e-2227.53pep chromosome:WBcel235:IV:7991410:8004136:-1 gene... [more]
rig-43.725e-2227.53pep chromosome:WBcel235:IV:7991410:8004119:-1 gene... [more]
him-42.742e-1521.39High Incidence of Males (Increased X chromosome lo... [more]
him-42.882e-1521.39High Incidence of Males (Increased X chromosome lo... [more]
him-43.555e-1521.68High Incidence of Males (Increased X chromosome lo... [more]
back to top
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dscam46.665e-7423.56gene:FBgn0263219 transcript:FBtr0333589[more]
Dscam46.665e-7423.56gene:FBgn0263219 transcript:FBtr0333590[more]
Dscam42.554e-7223.41gene:FBgn0263219 transcript:FBtr0299840[more]
Dscam42.554e-7223.41gene:FBgn0263219 transcript:FBtr0299839[more]
Dscam45.910e-7223.41gene:FBgn0263219 transcript:FBtr0299841[more]
back to top
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dscamb1.729e-7223.73Down syndrome cell adhesion molecule b [Source:ZFI... [more]
dscama2.359e-7023.65Down syndrome cell adhesion molecule a [Source:ZFI... [more]
dscama2.704e-7023.65Down syndrome cell adhesion molecule a [Source:ZFI... [more]
dscama3.946e-7023.65Down syndrome cell adhesion molecule a [Source:ZFI... [more]
dscama4.197e-7023.65Down syndrome cell adhesion molecule a [Source:ZFI... [more]
back to top
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ccdc142.751e-8222.92coiled-coil domain containing 14 [Source:Xenbase;A... [more]
ccdc144.016e-8223.67coiled-coil domain containing 14 [Source:Xenbase;A... [more]
ccdc147.041e-8223.73coiled-coil domain containing 14 [Source:Xenbase;A... [more]
ccdc148.622e-8223.73coiled-coil domain containing 14 [Source:Xenbase;A... [more]
ccdc141.580e-8123.15coiled-coil domain containing 14 [Source:Xenbase;A... [more]
back to top
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dscam1.292e-8224.39DS cell adhesion molecule [Source:MGI Symbol;Acc:M... [more]
Dscaml17.768e-7723.77DS cell adhesion molecule like 1 [Source:MGI Symbo... [more]
Sdk12.361e-3028.86sidekick cell adhesion molecule 1 [Source:MGI Symb... [more]
Sdk12.751e-3028.86sidekick cell adhesion molecule 1 [Source:MGI Symb... [more]
Dcc1.633e-2324.30deleted in colorectal carcinoma [Source:MGI Symbol... [more]
back to top
BLAST of Down syndrome cell adhesion molecule vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O60469|DSCAM_HUMAN9.200e-8324.39Down syndrome cell adhesion molecule OS=Homo sapie... [more]
sp|Q8VHZ8|DSCAM_RAT6.481e-8224.45Down syndrome cell adhesion molecule homolog OS=Ra... [more]
sp|Q9ERC8|DSCAM_MOUSE9.036e-8224.39Down syndrome cell adhesion molecule homolog OS=Mu... [more]
sp|F1NY98|DSCAM_CHICK1.012e-8024.37Down syndrome cell adhesion molecule homolog OS=Ga... [more]
sp|E1C8P7|DSCL1_CHICK6.552e-7824.29Down syndrome cell adhesion molecule-like protein ... [more]
back to top
BLAST of Down syndrome cell adhesion molecule vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q1JUB50.000e+050.33Down syndrome cell adhesion molecule OS=Dugesia ja... [more]
A0A068Y1Y75.921e-15725.78Down syndrome cell adhesion molecule OS=Echinococc... [more]
A0A068WUV84.742e-15525.88Down syndrome cell adhesion molecule OS=Echinococc... [more]
A0A5K3FA491.095e-14926.56Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A3R7FKW72.180e-14226.49Down syndrome cell adhesion molecule-like protein ... [more]
back to top
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dscamb2.122e-7423.84Down syndrome cell adhesion molecule-like [Source:... [more]
dscaml11.957e-7224.09Down syndrome cell adhesion molecule like 1 [Sourc... [more]
dscamb3.348e-7023.97Down syndrome cell adhesion molecule-like [Source:... [more]
dscama2.554e-6423.11Down syndrome cell adhesion molecule a [Source:ZFI... [more]
sdk2b7.626e-2628.65sidekick cell adhesion molecule 2b [Source:ZFIN;Ac... [more]
back to top
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008186.13.539e-6323.29pep scaffold:Pmarinus_7.0:GL476501:83598:168579:1 ... [more]
neo1b1.783e-2423.51neogenin 1b [Source:ZFIN;Acc:ZDB-GENE-131121-320][more]
ENSPMAT00000003988.11.231e-2026.32pep scaffold:Pmarinus_7.0:GL479628:888:7913:1 gene... [more]
ENSPMAT00000005381.11.295e-1728.71pep scaffold:Pmarinus_7.0:GL480507:730:13780:1 gen... [more]
ENSPMAT00000003996.13.157e-1625.80pep scaffold:Pmarinus_7.0:GL479628:2065:17993:1 ge... [more]
back to top
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO431692.889e-1522.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO490211.174e-1326.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO340573.698e-1322.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412046.047e-1323.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO321516.916e-1229.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Down syndrome cell adhesion molecule vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dscama8.620e-7924.09Down syndrome cell adhesion molecule homolog [Sour... [more]
dscama9.457e-7924.09Down syndrome cell adhesion molecule homolog [Sour... [more]
dscamb3.230e-7023.56Down syndrome cell adhesion molecule [Source:NCBI ... [more]
dscamb5.346e-7023.56Down syndrome cell adhesion molecule [Source:NCBI ... [more]
dscaml11.977e-6723.96Down syndrome cell adhesion molecule-like protein ... [more]
back to top
BLAST of Down syndrome cell adhesion molecule vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000048977.10.000e+098.95SMESG000048977.1[more]
SMESG000048977.10.000e+098.92SMESG000048977.1[more]
SMESG000024214.13.075e-17828.75SMESG000024214.1[more]
SMESG000024214.13.431e-17828.75SMESG000024214.1[more]
SMESG000024214.14.378e-16029.28SMESG000024214.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022101 ID=SMED30022101|Name=Down syndrome cell adhesion molecule|organism=Schmidtea mediterranea sexual|type=transcript|length=6411bp
CTATATAAATCTTATATGAAAATCATCATTATCACTTCAATTATTTATTT
TTGACGACTATGAGATTTTTTATTTTAATTCTATTTAATATATTATGTCA
TTTTATTACCTTCAAAAATGTTAATTCTTTTGATCATAAATCTTTTTTCT
TTTTTTTAAATCGGCATAAAAGATATGCTGAAGAAAGAAATTTAGAGCCT
CCAAAATTAATAAATGTTCAAAAATCGTTTGTAACGACAATGACTGACCA
CAGCAGAGTGTATTGTACGGCAACGGGAAACCCATCACCGAAAATTAAGT
GGTATTACGAAACAACTCAACGAAACGTGTTTACAGAAGTTAACGACCCG
GACAGATTTGTTGTCGGCACAAATGGTGATATGGATATATTTATACAGGC
GAACATAGAAGTGATATATTGCAAGGCACAAAATGAGCTCGGTACAGTCA
GATCAAAAACAATTACTGTTCAAAAATGGATTGACCACAAGGATGTCAAA
GTTCGTTGCGAAACCAAGGAAGTTTCCCTGTACCAAAAGGCAGTCATTAA
CTGTCTGCTTTATCCGACCATGATTGCCTATATTTACTACGTCAGATATT
GGGAGATCCGGTACAAATCTGATTCGAAAAAGGTTCTGAAAATTTACAAG
ACAGAGGGCAGGTTTAGCGTTATTAACAAGAGCCAACCACCCCAATTGCA
CATTCGTAATGTCACCAAGGCAGATTTCTCTGACATGGAGGTCCGGTGCA
TCATGAGGAATATCTACACCGATATCGATGTCAAATCCCATGACTGGATC
TCCCCTAAAAGGTTAGAAGACAACAGTAAAATTGATTTCACATCAATTTG
CCAGAATATCGAAGTTAGGGTGATAAAGGGCTCAACACTGGAGTTACCAT
GGTGCAGTATGCCAAACAACCAGAAAATTGCCTGGTACTGGAGCAGTGCG
GTCTCCTCAAGAAGGCATCTGGTCAATTTGAGTGGGTCCAAATTTAAAAT
GATAAGTGAAGATTTTGGGAATTTGTTGATTAAAAATATCGGAATCGCCG
AAGAGGGTTTCTATTATGCCAGCAATCCAACGGTTCCCAGTAATCCGTAT
CTCACTCACACCGTTCGCGTCATGATCAATGTATCAGTTGACATCAAGCC
GACTGTTGTCAACGCACGCTACAATGAGATTGTTCAGCTTAAATGTGTGG
CCACCGGATATCCAAGGTTAAGTTTGTTATGGCTATTCAACGGCAACGAA
TTCAACAGCAGCAAGTCTTTCGAAACAGATACAAATTTCAGTCGCACGTC
TCACATAACAATTCGTGTTAACGCTGACACGGCTGGCGTTTATCAATGCC
TTGCTGAATCTCGAGATAACGCGGAAAATCGGATATTGAGTGAGGATCAG
AAATCAGTGTTCGTCATTATTGCTGAAATGGCGCCGTTATTGATATGGCA
ATCGCCGCCTGTCCAGCCCTCGTACTCATATGGTACAGGTGTCCTAAAAA
CCGATGGCAGCTCATTCCAGATCCAATGCAAATTCAACCGAGTACCAAAT
GGAACGGTGGCGTGGTACCTTGACGATAAGAAAATCCCGATGGTCAATGT
GTTGATCCCAAACACAACCTACAGACTGCCTTACACCGTCATTGCCACAC
TCCAAATAGATTTGTCGGCAATGATGTCAATTGAAGAAAAATGGAAATAT
GGGGGAGAATATCGAGCTGAAGTCACCAATAAGTATGGGAAAGCTCACTG
TACAACTCTGATATTCGTTACTGACGTGTATATGATCCGAGATTATCCCG
ACATCACATTGACTCACGGTTCCGAGTTGAGATTGAAATGTTACGTCATA
TCGGGATTGAAACCCACTATTGAATGGTTTAGAGATGCAAAAGGCAAGCT
GGTCCGGCTGCCGGAAACCCACACTCAGACAGTCAGTGAAGATGGCCGAC
TGTTTATAATAGAAAAAGTCGATAAAGTCATTCATTCCGGAAAATACATT
TGCAATTCAACATTGAACAACTTAAAGATTTCAAAGACATTTTCAGTTAC
CATAGCAAACCCCCCGATAATGCTGTCAGATCTTCCCGTCTCTATATCTC
TGAATAAGAATTCCGACACGACATCATTAACCTGTCTGCCGAGACATCAA
CCTGACCTGCCTTGGTATGCTTGGTGGGAATTCAAAGAAGCCAAGTCCAA
CCATTCCGTGCCGTTATTATCGAACTCCTATCTCAATAAACATGATCTCA
AGATAGAAATCAAATATCAAAAGATTACAGTCTCAGAGAAATATACCGAT
AATGGAGCAGCTTTACCTAAAGGTGTTCCGAATTTTGTGAGGTATCAACA
CAATAAAATCGCCCAAATATGGATTAAATATAACGAAAAACTTCATTTAT
CCCAAATCAGTTGTGTTGTGCAAAATCATGCTGGAACCATTCGGAAAACC
ATACAAATATCTATAGATAATCTCGTTTTCAAGGAATCTCCTCCACTCGA
TTATTCAATTGTTCTAGGTCAAAGTTTTGCATTAAATTGTTCTGCCAAAC
CAACCAATATTCAACTGAAAACCAATTGGTTTAATGTAGATTCATCGAAT
AACGTTCCGGTAAATTCAACCGTTGAATCAAGAATCCACCAACTGCCAAA
CGGAACATTGGTCGTAAAGAACATTGAATTGACGGATCCGCACAAATTCA
TGTGCATTATCAAGCCAATCGTCGGCAAAGATGAAATCAGTAAAGTAGTA
AAGATTGCAATTAAAGTTCCTGCGACAATTCTCAACATGCCTGACGTTAT
TGACATGAAGCGTAACTATGAGAACTCATTAAACTGCACAGTGCACGGTG
ATGATGAATTGGATGTGAAATGGTACCGAAAAGAAGATGGAAATTGGGAT
TCTCTCCCTGTAAAAAGAATTAAGGAAAAAAGTAAGGTTTCACGGTTTTT
TGTGAAATTCGAGAGCGTCACTGATTCCCTGTTTGGTGAGTACAAGTGCG
TTGCGTCAAATGAGCACAGGAAGAATGGCGTTGAGCGGATAATTCTATTA
AATGTAGTTGATGTTCCTGGCAAAGTAGTGATCAAAAATGAAAGTATTAG
ATCCTTCAGTCGATCTATCGCCATTTCATGGAACCCTCCTAATAGCGATG
GGAAAAAGCCAATTACTCGCTATCTCGTATCTTGGAAATTAGTGACAGAG
AACTGGTTTATAAATGCAACGACAAAAGAAACGTCTATTACAATTGAGGA
TTTGAGACCCTTCAAAGAATACGATATAGCTATCGTTGCTGAGAACAGTG
TTGGTTATGGCGAGGAAGCTACAATAATCATAAAAACTCAAGCTGATGCT
CCCGAGGGACCGGTATTAAATTTACTAGCTACGTCAGTGTCTTTCGATAA
GGTGAAATTGAAATGGGAATCCCCGAATGAGATGCTAATTAATGGAATAA
AAAAGCATTATCAAGTCTGTTCGATGGAGATTTATGATTCTCAAAATCGG
AGTTTAGAAAAATTTGCCTGGCCCTCTCCTAATGATTCAACAACAAGAGT
TGTAGATCAACACAACCATCGGGTAAAGAAAAGTTGCATAAACGTTCCAG
AATCAACACTGGTAATCACCGTAACCGAATTATTAACGTTCACGGAATAC
GCATTTCGTGTCATTCTAGTCAACAACGTCGGGTTCAGTCCTGCAAAGTA
TGTAGCGATTCGGACTTTGGAAGACAAACCCGAAGGAACACCCATTCAGG
TTTTATGTTCACCTAAAGCTAACTTCCTATTTTTGGAATGGAATCCACCA
CCTCAGAATGTGACGAATGGGGTCATTTCTGGGTATGAGGTTACCTACTT
CAGTGATGACAAACACGAAGAGCCTGATAAACTGATGAAAAACGTTAAAG
AAACTCATCTGAAACTATATAATCTATCTGCAAATTCCAAATACATCATT
CAGATTCGAGTTAAGAATAATATAGGATTAGGACCTCCTTCTGAGCCGAT
AAATTGCACTACTAATGAAGCTGCACCTGATCCACCGAATGAAATAAAGG
CATATTTTTATCAAAATTGTTTGAAAGTTTCATGGACTCCTCCTATTAAA
GCAAACGGACATATTCGAGAATATATCATAGTCTTCAGCTTTGAACCTAA
TAATATGATCACGGTATCCTCCCGTGAAAACGATAAGCCTTATTATTCGT
GGGAATTATGTAGCGAGCAAATTTGTAGTAATTGCAATGTGTCTGTCCTA
GCAGTGACAACAATGAAGGGCCCTCGCAAAACTGTAAATGTACTGTCAAA
TAAAATGGGTATTTTGAGTTTTTCACAGAGCATCGTAGTGCAAAATTCAA
GCCAAGTCGTGCTTTATTGTGAAGTAGCATTTCCAGATGAAAACATATAC
TACTTGTGGACACATAATGATAAAGATATTTATGGTCAAGGGGTCCAGTC
AAATGGATCATTAGTTATTAATTCAATGGCAGAGTCCGATCAAGGAATAT
ATAAATGCAAAGTTAAATCAGAAGAAATAACCTACAATGTTTCCACGAAG
TCGATCTCATTAGTTCCTCAAACTCCATACATTGAAATCACCAAAGTCTC
AACCAATCACATTGCTCTGTTGTGGCGATCGAATGGATCACCGAAAACGG
AATATCCAATCAATCAGTTTCTCGTCGTCATACAAAATGCAAATGGCAGT
TCATCAAGGGAGTTGAAAGTTTCGAGTAACATTCGTTCCATCATCATTCC
GAATCTAGAATGTGGCACGCTCTACAATGTGTATTTATATGCTAAAAATA
TCGCCGGTCCGAGTAATCCTGCTATAAGTCAAGCACAGACCCGCGGTTCA
ATACCCGAAATACCCGACACATCTAATATCGTGACTGAAATTGGTCCCCA
TTCAATGTGTTTTAATTTGAGGGCTTTCCGACCAGGTCGGGGCTGCCCTG
CCAATAAATATATACTGAAATTGTGGCCATCAAGTGAAGGCAATCATCAA
GAAAGCGGTGTCTCAGTTTGGAAAGTTGTTAATGATAGTGATCTCAATCA
AATTCCCTGTTTCAACGTCACTGATCTCCACCCGAATACTGATTACGTTT
ACTCAATTGAAGCGTCAAATATGGTTGGTTCACAAAAAGCCAAGGCCCAC
AATAAAACTCGACAAATAGTTTCAACAGCTCCACCTAATATCAACTACAG
CTCACCTCCACTGGCAAGCGAGTTGAAATATATCTTCGTTGCGGCAGTGA
TTTCTGTAATAATATTGTTTGTAATAATTGTGGTTCTCGCACTCTACTGC
ACAAGGAGATCATGTCACACTTATTTTGGAAATAGGAATATCAGTAATAA
TCTCGTCAAACCGCCTATACGCTCCCCGATACCGGTCTCCAATAATAGGA
ACCGAAAGTTACCGACCCCTCCGGATAATAATTTTTACGATAAAGGCAAT
AATATAATCTCCAAGCCCCAGGACAATGAAGAAGACGAAATGCTAACGCC
GTATGCAACCTATGAATCTATTCCCAAACCCGATCCTATGACAAACCGCG
ATAGGCCTAATATGAGCACAAACTATAATACAGGAAGTCAGACTAACTCT
TATCAGTATCCTGAGATGCAGCCACTAGAGGCTTCCAACCCGAAAATGAT
GAACTATCCAAATGATTTAAAGCAGCCTCTTTTAACCCATTCAATAAAAC
ATTCTAGTAAAAAATATGATAAAGGATATTCACGAGGAAATGAATCTTTA
GCAACCTTGAGGCCTCAGACTGTAAGATCAGAAGTTTTAGTGACAATGAA
CAAACATAGAATTCTCCCAGTTATATCAAATGCTCCTGGATCTATGGAGT
CAGAGGCTTACAGACCTAGTTCTAGTTTATGTTCCAGTACAACTGAGAGT
TCGACAAAGGACGAACTTCGTCAATTGTTTGGAAACGCTTCTGGAAACCA
ATTTCCCAGCAGATTGCAAGAGCAAGATGAAGATGGTGCTTCAACAGCTA
GAGGAGGCAACCGAAGTACCCTCATTAACAGGTCACACCATCACATTAAT
AACACCTTATCCGATGATTCCACACAGCCAGAATCATATTGTGAATCTGG
CTCGAGTGGGGATGACTGTGGAATCAGAAATTTCACTCAAGATCCACCTG
GGCAGCAAGTGATAGCACCGCAAACCATTCGTAACATGAATCTTAGGTGC
AATTCATTACCATATGACACAGCTAACAGGCAGCCATTTATTCAGCAATC
AAATAATTTTACCCTTCAACAGCCAAGAAATCCTTTGCCCGAAGAAGATG
AAGGCGAAGAAGCAAACAATTATACTAATAATTTCGTGGTGGTGTAAATT
ACAGCCAGACTAGTCATATTTAATATTTTTTTAATAGAATACATTTTTGT
TTCTAAAAAAA
back to top

protein sequence of SMED30022101-orf-1

>SMED30022101-orf-1 ID=SMED30022101-orf-1|Name=SMED30022101-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2096bp
MRFFILILFNILCHFITFKNVNSFDHKSFFFFLNRHKRYAEERNLEPPKL
INVQKSFVTTMTDHSRVYCTATGNPSPKIKWYYETTQRNVFTEVNDPDRF
VVGTNGDMDIFIQANIEVIYCKAQNELGTVRSKTITVQKWIDHKDVKVRC
ETKEVSLYQKAVINCLLYPTMIAYIYYVRYWEIRYKSDSKKVLKIYKTEG
RFSVINKSQPPQLHIRNVTKADFSDMEVRCIMRNIYTDIDVKSHDWISPK
RLEDNSKIDFTSICQNIEVRVIKGSTLELPWCSMPNNQKIAWYWSSAVSS
RRHLVNLSGSKFKMISEDFGNLLIKNIGIAEEGFYYASNPTVPSNPYLTH
TVRVMINVSVDIKPTVVNARYNEIVQLKCVATGYPRLSLLWLFNGNEFNS
SKSFETDTNFSRTSHITIRVNADTAGVYQCLAESRDNAENRILSEDQKSV
FVIIAEMAPLLIWQSPPVQPSYSYGTGVLKTDGSSFQIQCKFNRVPNGTV
AWYLDDKKIPMVNVLIPNTTYRLPYTVIATLQIDLSAMMSIEEKWKYGGE
YRAEVTNKYGKAHCTTLIFVTDVYMIRDYPDITLTHGSELRLKCYVISGL
KPTIEWFRDAKGKLVRLPETHTQTVSEDGRLFIIEKVDKVIHSGKYICNS
TLNNLKISKTFSVTIANPPIMLSDLPVSISLNKNSDTTSLTCLPRHQPDL
PWYAWWEFKEAKSNHSVPLLSNSYLNKHDLKIEIKYQKITVSEKYTDNGA
ALPKGVPNFVRYQHNKIAQIWIKYNEKLHLSQISCVVQNHAGTIRKTIQI
SIDNLVFKESPPLDYSIVLGQSFALNCSAKPTNIQLKTNWFNVDSSNNVP
VNSTVESRIHQLPNGTLVVKNIELTDPHKFMCIIKPIVGKDEISKVVKIA
IKVPATILNMPDVIDMKRNYENSLNCTVHGDDELDVKWYRKEDGNWDSLP
VKRIKEKSKVSRFFVKFESVTDSLFGEYKCVASNEHRKNGVERIILLNVV
DVPGKVVIKNESIRSFSRSIAISWNPPNSDGKKPITRYLVSWKLVTENWF
INATTKETSITIEDLRPFKEYDIAIVAENSVGYGEEATIIIKTQADAPEG
PVLNLLATSVSFDKVKLKWESPNEMLINGIKKHYQVCSMEIYDSQNRSLE
KFAWPSPNDSTTRVVDQHNHRVKKSCINVPESTLVITVTELLTFTEYAFR
VILVNNVGFSPAKYVAIRTLEDKPEGTPIQVLCSPKANFLFLEWNPPPQN
VTNGVISGYEVTYFSDDKHEEPDKLMKNVKETHLKLYNLSANSKYIIQIR
VKNNIGLGPPSEPINCTTNEAAPDPPNEIKAYFYQNCLKVSWTPPIKANG
HIREYIIVFSFEPNNMITVSSRENDKPYYSWELCSEQICSNCNVSVLAVT
TMKGPRKTVNVLSNKMGILSFSQSIVVQNSSQVVLYCEVAFPDENIYYLW
THNDKDIYGQGVQSNGSLVINSMAESDQGIYKCKVKSEEITYNVSTKSIS
LVPQTPYIEITKVSTNHIALLWRSNGSPKTEYPINQFLVVIQNANGSSSR
ELKVSSNIRSIIIPNLECGTLYNVYLYAKNIAGPSNPAISQAQTRGSIPE
IPDTSNIVTEIGPHSMCFNLRAFRPGRGCPANKYILKLWPSSEGNHQESG
VSVWKVVNDSDLNQIPCFNVTDLHPNTDYVYSIEASNMVGSQKAKAHNKT
RQIVSTAPPNINYSSPPLASELKYIFVAAVISVIILFVIIVVLALYCTRR
SCHTYFGNRNISNNLVKPPIRSPIPVSNNRNRKLPTPPDNNFYDKGNNII
SKPQDNEEDEMLTPYATYESIPKPDPMTNRDRPNMSTNYNTGSQTNSYQY
PEMQPLEASNPKMMNYPNDLKQPLLTHSIKHSSKKYDKGYSRGNESLATL
RPQTVRSEVLVTMNKHRILPVISNAPGSMESEAYRPSSSLCSSTTESSTK
DELRQLFGNASGNQFPSRLQEQDEDGASTARGGNRSTLINRSHHHINNTL
SDDSTQPESYCESGSSGDDCGIRNFTQDPPGQQVIAPQTIRNMNLRCNSL
PYDTANRQPFIQQSNNFTLQQPRNPLPEEDEGEEANNYTNNFVVV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR033029DSCAML1
IPR036179Ig-like_dom_sf
IPR036116FN3_sf
IPR003599Ig_sub
IPR003961FN3_dom
IPR003598Ig_sub2
IPR013783Ig-like_fold
IPR013098Ig_I-set
IPR007110Ig-like_dom
Vocabulary: biological process
TermDefinition
GO:0007155cell adhesion
GO:0007417central nervous system development
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003961Fibronectin type IIISMARTSM00060FN3_2coord: 1613..1706
e-value: 0.53
score: 19.3
coord: 1113..1224
e-value: 7.4E-6
score: 35.5
coord: 1017..1098
e-value: 2.1E-6
score: 37.3
coord: 1337..1420
e-value: 30.0
score: 7.3
coord: 1236..1322
e-value: 0.0036
score: 26.5
coord: 1514..1599
e-value: 0.24
score: 20.5
IPR003961Fibronectin type IIIPFAMPF00041fn3coord: 1031..1100
e-value: 2.3E-10
score: 40.7
coord: 1251..1325
e-value: 1.0E-9
score: 38.6
coord: 1522..1599
e-value: 5.6E-6
score: 26.6
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 1336..1431
score: 8.852
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 1616..1723
score: 8.789
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 1239..1335
score: 20.032
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 1016..1114
score: 18.122
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 1516..1615
score: 13.192
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 1115..1237
score: 7.969
IPR003961Fibronectin type IIICDDcd00063FN3coord: 1639..1704
e-value: 0.00588966
score: 35.9351
IPR003961Fibronectin type IIICDDcd00063FN3coord: 1015..1104
e-value: 8.20274E-12
score: 61.3583
IPR003961Fibronectin type IIICDDcd00063FN3coord: 1251..1332
e-value: 2.30506E-11
score: 59.8175
IPR003961Fibronectin type IIICDDcd00063FN3coord: 1114..1233
e-value: 4.79138E-4
score: 39.0167
IPR003961Fibronectin type IIICDDcd00063FN3coord: 1522..1604
e-value: 4.9693E-6
score: 44.7947
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 826..916
e-value: 6.4
score: 13.1
coord: 593..680
e-value: 2.7
score: 16.4
coord: 489..585
e-value: 31.0
score: 7.2
coord: 1436..1518
e-value: 4.6E-5
score: 32.8
coord: 378..469
e-value: 3.5
score: 15.4
coord: 925..1014
e-value: 0.37
score: 19.9
IPR003598Immunoglobulin subtype 2SMARTSM00408igc2_5coord: 1442..1504
e-value: 0.019
score: 23.6
coord: 931..1001
e-value: 0.1
score: 16.7
coord: 599..669
e-value: 0.31
score: 12.0
coord: 384..451
e-value: 0.19
score: 14.1
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 1431..1511
e-value: 4.0E-10
score: 41.6
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 589..685
e-value: 1.2E-8
score: 36.8
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 1513..1611
e-value: 9.3E-11
score: 43.7
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 1331..1429
e-value: 8.1E-7
score: 31.1
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 1612..1720
e-value: 3.4E-5
score: 26.1
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 818..915
e-value: 1.7E-8
score: 36.2
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 916..1021
e-value: 1.1E-9
score: 40.4
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 492..588
e-value: 2.7E-5
score: 26.3
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 1109..1233
e-value: 3.1E-16
score: 61.4
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 363..455
e-value: 4.7E-10
score: 41.5
coord: 50..153
e-value: 1.4E-7
score: 33.6
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 1022..1108
e-value: 1.1E-15
score: 59.6
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 1234..1330
e-value: 2.5E-17
score: 65.0
IPR013098Immunoglobulin I-setPFAMPF07679I-setcoord: 925..1002
e-value: 1.5E-6
score: 28.2
coord: 593..679
e-value: 2.2E-5
score: 24.5
NoneNo IPR availablePFAMPF13927Ig_3coord: 1436..1500
e-value: 1.1E-7
score: 32.3
coord: 376..447
e-value: 1.1E-7
score: 32.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2010..2031
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1944..1995
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1943..1995
NoneNo IPR availablePANTHERPTHR13817TITINcoord: 80..689
NoneNo IPR availablePANTHERPTHR13817TITINcoord: 793..1744
NoneNo IPR availableCDDcd00096Igcoord: 1447..1502
e-value: 1.39961E-4
score: 39.9181
NoneNo IPR availableCDDcd00096Igcoord: 389..447
e-value: 7.64188E-7
score: 46.4664
NoneNo IPR availableCDDcd00096Igcoord: 937..1002
e-value: 2.18787E-5
score: 42.2293
NoneNo IPR availableTMHMMTMhelixcoord: 1738..1760
NoneNo IPR availableTMHMMTMhelixcoord: 175..197
NoneNo IPR availableTMHMMTMhelixcoord: 10..32
IPR033029Down syndrome cell adhesion molecule-like protein 1PANTHERPTHR13817:SF54DOWN SYNDROME CELL ADHESION MOLECULE-LIKE PROTEIN 1 HOMOLOGcoord: 793..1744
IPR033029Down syndrome cell adhesion molecule-like protein 1PANTHERPTHR13817:SF54DOWN SYNDROME CELL ADHESION MOLECULE-LIKE PROTEIN 1 HOMOLOGcoord: 80..689
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 834..908
score: 6.887
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 918..1012
score: 8.865
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 585..678
score: 9.174
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 1419..1514
score: 11.86
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 360..458
score: 10.608
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 62..150
score: 8.992
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 496..585
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 363..449
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 590..685
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 925..1019
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 60..148
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 1434..1521
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 823..911
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 1229..1342
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 1322..1415
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 1027..1160
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 1517..1705