Kinesin protein

Overview
NameKinesin protein
Smed IDSMED30022095
Length (bp)2305
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022095

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testisSMED30022095h1SMcG0001952 Contig5275uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30022095h1SMcG0001952 Contig5275newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30022095h1SMcG0003657 Contig5275uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30022095h1SMcG0003657 Contig5275newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Kinesin protein vs. Ensembl Human
Match: KIFC3 (kinesin family member C3 [Source:HGNC Symbol;Acc:HGNC:6326])

HSP 1 Score: 240.35 bits (612), Expect = 2.096e-68
Identity = 139/344 (40.41%), Postives = 200/344 (58.14%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIRPQPRTFLKITSEDKL------IIVGDCLPEKITKHWYGKASKCFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLLN-ICDTRMQWKYRLFLSMVEIYQEDVRDILADKTSASVKIM--SNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQKP-SYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFG--INAMQVAP 2194
            HN+L  L GNIRV  R+RP       +T ED         +  D   + I    +      F  D+VF P++ Q +VF+ V  L+TSC+DG+NVCI AYGQTG+GKT+TM GT + PG+N+RA+  L + + +    W+Y + +S  EIY E +RD+L  +    ++I    +   ++ + GLTE +V+  +DI K F+ G  NRT   T LN  SSRSH ++++ V G +      + G L L DLAGSE V KSGA G R  EA  INKSL+ LG V  +LR+ Q    +R +KLTYLL+ +L GDSK L+ V V    +N  ETL ++ F   + ++++ P
Sbjct:  297 HNELVRLKGNIRVIARVRP-------VTKEDGEGPEATNAVTFDADDDSIIHLLHKGKPVSFELDKVFSPQASQQDVFQEVQALVTSCIDGFNVCIFAYGQTGAGKTYTMEGTAENPGINQRALQLLFSEVQEKASDWEYTITVSAAEIYNEVLRDLLGKEPQEKLEIRLCPDGSGQLYVPGLTEFQVQSVDDINKVFEFGHTNRTTEFTNLNEHSSRSHALLIVTVRGVDCSTGLRTTGKLNLVDLAGSERVGKSGAEGSRLREAQHINKSLSALGDVIAALRSRQGHVPFRNSKLTYLLQDSLSGDSKTLMVVQVSPVEKNTSETLYSLKFAERVRSVELGP 633          
BLAST of Kinesin protein vs. Ensembl Human
Match: KIFC3 (kinesin family member C3 [Source:HGNC Symbol;Acc:HGNC:6326])

HSP 1 Score: 240.35 bits (612), Expect = 2.096e-68
Identity = 139/344 (40.41%), Postives = 200/344 (58.14%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIRPQPRTFLKITSEDKL------IIVGDCLPEKITKHWYGKASKCFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLLN-ICDTRMQWKYRLFLSMVEIYQEDVRDILADKTSASVKIM--SNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQKP-SYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFG--INAMQVAP 2194
            HN+L  L GNIRV  R+RP       +T ED         +  D   + I    +      F  D+VF P++ Q +VF+ V  L+TSC+DG+NVCI AYGQTG+GKT+TM GT + PG+N+RA+  L + + +    W+Y + +S  EIY E +RD+L  +    ++I    +   ++ + GLTE +V+  +DI K F+ G  NRT   T LN  SSRSH ++++ V G +      + G L L DLAGSE V KSGA G R  EA  INKSL+ LG V  +LR+ Q    +R +KLTYLL+ +L GDSK L+ V V    +N  ETL ++ F   + ++++ P
Sbjct:  297 HNELVRLKGNIRVIARVRP-------VTKEDGEGPEATNAVTFDADDDSIIHLLHKGKPVSFELDKVFSPQASQQDVFQEVQALVTSCIDGFNVCIFAYGQTGAGKTYTMEGTAENPGINQRALQLLFSEVQEKASDWEYTITVSAAEIYNEVLRDLLGKEPQEKLEIRLCPDGSGQLYVPGLTEFQVQSVDDINKVFEFGHTNRTTEFTNLNEHSSRSHALLIVTVRGVDCSTGLRTTGKLNLVDLAGSERVGKSGAEGSRLREAQHINKSLSALGDVIAALRSRQGHVPFRNSKLTYLLQDSLSGDSKTLMVVQVSPVEKNTSETLYSLKFAERVRSVELGP 633          
BLAST of Kinesin protein vs. Ensembl Human
Match: KIFC3 (kinesin family member C3 [Source:HGNC Symbol;Acc:HGNC:6326])

HSP 1 Score: 240.35 bits (612), Expect = 2.096e-68
Identity = 139/344 (40.41%), Postives = 200/344 (58.14%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIRPQPRTFLKITSEDKL------IIVGDCLPEKITKHWYGKASKCFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLLN-ICDTRMQWKYRLFLSMVEIYQEDVRDILADKTSASVKIM--SNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQKP-SYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFG--INAMQVAP 2194
            HN+L  L GNIRV  R+RP       +T ED         +  D   + I    +      F  D+VF P++ Q +VF+ V  L+TSC+DG+NVCI AYGQTG+GKT+TM GT + PG+N+RA+  L + + +    W+Y + +S  EIY E +RD+L  +    ++I    +   ++ + GLTE +V+  +DI K F+ G  NRT   T LN  SSRSH ++++ V G +      + G L L DLAGSE V KSGA G R  EA  INKSL+ LG V  +LR+ Q    +R +KLTYLL+ +L GDSK L+ V V    +N  ETL ++ F   + ++++ P
Sbjct:  297 HNELVRLKGNIRVIARVRP-------VTKEDGEGPEATNAVTFDADDDSIIHLLHKGKPVSFELDKVFSPQASQQDVFQEVQALVTSCIDGFNVCIFAYGQTGAGKTYTMEGTAENPGINQRALQLLFSEVQEKASDWEYTITVSAAEIYNEVLRDLLGKEPQEKLEIRLCPDGSGQLYVPGLTEFQVQSVDDINKVFEFGHTNRTTEFTNLNEHSSRSHALLIVTVRGVDCSTGLRTTGKLNLVDLAGSERVGKSGAEGSRLREAQHINKSLSALGDVIAALRSRQGHVPFRNSKLTYLLQDSLSGDSKTLMVVQVSPVEKNTSETLYSLKFAERVRSVELGP 633          
BLAST of Kinesin protein vs. Ensembl Human
Match: KIFC3 (kinesin family member C3 [Source:HGNC Symbol;Acc:HGNC:6326])

HSP 1 Score: 240.35 bits (612), Expect = 4.085e-68
Identity = 139/344 (40.41%), Postives = 200/344 (58.14%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIRPQPRTFLKITSEDKL------IIVGDCLPEKITKHWYGKASKCFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLLN-ICDTRMQWKYRLFLSMVEIYQEDVRDILADKTSASVKIM--SNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQKP-SYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFG--INAMQVAP 2194
            HN+L  L GNIRV  R+RP       +T ED         +  D   + I    +      F  D+VF P++ Q +VF+ V  L+TSC+DG+NVCI AYGQTG+GKT+TM GT + PG+N+RA+  L + + +    W+Y + +S  EIY E +RD+L  +    ++I    +   ++ + GLTE +V+  +DI K F+ G  NRT   T LN  SSRSH ++++ V G +      + G L L DLAGSE V KSGA G R  EA  INKSL+ LG V  +LR+ Q    +R +KLTYLL+ +L GDSK L+ V V    +N  ETL ++ F   + ++++ P
Sbjct:  334 HNELVRLKGNIRVIARVRP-------VTKEDGEGPEATNAVTFDADDDSIIHLLHKGKPVSFELDKVFSPQASQQDVFQEVQALVTSCIDGFNVCIFAYGQTGAGKTYTMEGTAENPGINQRALQLLFSEVQEKASDWEYTITVSAAEIYNEVLRDLLGKEPQEKLEIRLCPDGSGQLYVPGLTEFQVQSVDDINKVFEFGHTNRTTEFTNLNEHSSRSHALLIVTVRGVDCSTGLRTTGKLNLVDLAGSERVGKSGAEGSRLREAQHINKSLSALGDVIAALRSRQGHVPFRNSKLTYLLQDSLSGDSKTLMVVQVSPVEKNTSETLYSLKFAERVRSVELGP 670          
BLAST of Kinesin protein vs. Ensembl Human
Match: KIFC3 (kinesin family member C3 [Source:HGNC Symbol;Acc:HGNC:6326])

HSP 1 Score: 239.195 bits (609), Expect = 5.929e-67
Identity = 139/344 (40.41%), Postives = 200/344 (58.14%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIRPQPRTFLKITSEDKL------IIVGDCLPEKITKHWYGKASKCFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLLN-ICDTRMQWKYRLFLSMVEIYQEDVRDILADKTSASVKIM--SNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQKP-SYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFG--INAMQVAP 2194
            HN+L  L GNIRV  R+RP       +T ED         +  D   + I    +      F  D+VF P++ Q +VF+ V  L+TSC+DG+NVCI AYGQTG+GKT+TM GT + PG+N+RA+  L + + +    W+Y + +S  EIY E +RD+L  +    ++I    +   ++ + GLTE +V+  +DI K F+ G  NRT   T LN  SSRSH ++++ V G +      + G L L DLAGSE V KSGA G R  EA  INKSL+ LG V  +LR+ Q    +R +KLTYLL+ +L GDSK L+ V V    +N  ETL ++ F   + ++++ P
Sbjct:  436 HNELVRLKGNIRVIARVRP-------VTKEDGEGPEATNAVTFDADDDSIIHLLHKGKPVSFELDKVFSPQASQQDVFQEVQALVTSCIDGFNVCIFAYGQTGAGKTYTMEGTAENPGINQRALQLLFSEVQEKASDWEYTITVSAAEIYNEVLRDLLGKEPQEKLEIRLCPDGSGQLYVPGLTEFQVQSVDDINKVFEFGHTNRTTEFTNLNEHSSRSHALLIVTVRGVDCSTGLRTTGKLNLVDLAGSERVGKSGAEGSRLREAQHINKSLSALGDVIAALRSRQGHVPFRNSKLTYLLQDSLSGDSKTLMVVQVSPVEKNTSETLYSLKFAERVRSVELGP 772          
BLAST of Kinesin protein vs. Ensembl Celegans
Match: klp-3 (Kinesin-like protein klp-3 [Source:UniProtKB/Swiss-Prot;Acc:P45962])

HSP 1 Score: 228.794 bits (582), Expect = 2.191e-65
Identity = 133/334 (39.82%), Postives = 196/334 (58.68%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIRPQPRTFLKITSEDKLIIVGDCLPEKIT--KHWYGKASKCFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLLNICDTRM-QWKYRLFLSMVEIYQEDVRDILADKTSASVKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQKP-SYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFGINAMQV 2188
            HN+L EL GNIRV+ RIRPQ       T   K ++V D +   +    +  G        D+V      Q ++F  V  +ITSC+DGYNVCI AYG TGSGKT+TM G V  PG+N+RAI +L      R    KY + ++M+EIY E +RD+L + ++ ++ I   ++    + GL E  V    ++ +   +G KN+ VA+T  NI SSRSH+IV + V   N I   T++G L L DLAGSE V+++ ATG+   EA  INKSL+ LG V  +LR +QK   +R  +LT +L+ +L GDSK L+ V++  + ++  E++ +++F     QV
Sbjct:  236 HNQLVELNGNIRVFYRIRPQ---LASETDNQKPVVVIDEMDNGVVHVSNTTGTRKTSAGADKVIPTDFSQDQIFNEVSPIITSCIDGYNVCIFAYGHTGSGKTYTMDGPVTMPGINQRAIMQLFETAKERTGDIKYDIKVAMMEIYNEKIRDLL-NTSNTNLAIRQTEEGRSSIPGLEEVSVNSAEEVTETLARGRKNKAVAATEANIESSRSHVIVRVLVSATNLITKATTVGRLNLVDLAGSERVSQTNATGQLLKEAQAINKSLSELGNVVLALRQNQKHIPFRNCQLTRILEDSLNGDSKTLVIVHLSPDAKSLNESISSVNFAEKIGQV 565          
BLAST of Kinesin protein vs. Ensembl Celegans
Match: klp-15 (Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc:P91400])

HSP 1 Score: 171.014 bits (432), Expect = 6.647e-45
Identity = 114/331 (34.44%), Postives = 175/331 (52.87%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIRPQPRTFLKITSEDKLIIVGDCLPEKITKHWYGKASKCFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMM-GTVQEPGVNRRAIYRLLNICDTR----MQWKYRLFLSMVEIYQEDVRDILADKTSASVKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQKP-SYRETKLTYLLKPTLG-GDSKCLLFVNVRCEPENAEETLRAIHFG 2170
            HN + +L G IRV  R+RP     +K  ++     +     + I  +   K      F++VF P   Q EVF  V+E I S + GYNV ++AYGQTGSGKTHTM  G  +E G+  RA   L    ++R    + WK+   LS +E+Y     D+L+D+    +++    D  + + GL+EH +   +D+ +     +  R  A+T  N +SSRSH + + K+         ++   L L DLAGSE   +SG +G++F E T IN+SL+ L       R+ +   SYR++KLT +L   LG G+SK ++ VN+    E A E+ R+I F 
Sbjct:  239 HNDVVDLRGQIRVAVRVRP----LIKSEADASSSAIEYPAIDTIRINEGSKPGIVVKFEKVFTPVFSQKEVFANVEEFIRSSLHGYNVGLIAYGQTGSGKTHTMRGGNGEEEGIIPRAAAFLF--AESRKLESLGWKFDFSLSFLEVYNNVAYDLLSDRAVVQLRL---NDQTVSMIGLSEHTISNVSDVARLLRVADGGRKTAATKCNESSSRSHAVYMWKITAHQPSTGISTSCQLKLVDLAGSERAKESGVSGDQFKEMTNINQSLSILQMCISQQRSQKGHVSYRDSKLTQVLMDCLGRGNSKTMVVVNLNPCNEQATESKRSIEFA 560          
BLAST of Kinesin protein vs. Ensembl Celegans
Match: klp-15 (Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc:P91400])

HSP 1 Score: 171.014 bits (432), Expect = 6.647e-45
Identity = 114/331 (34.44%), Postives = 175/331 (52.87%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIRPQPRTFLKITSEDKLIIVGDCLPEKITKHWYGKASKCFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMM-GTVQEPGVNRRAIYRLLNICDTR----MQWKYRLFLSMVEIYQEDVRDILADKTSASVKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQKP-SYRETKLTYLLKPTLG-GDSKCLLFVNVRCEPENAEETLRAIHFG 2170
            HN + +L G IRV  R+RP     +K  ++     +     + I  +   K      F++VF P   Q EVF  V+E I S + GYNV ++AYGQTGSGKTHTM  G  +E G+  RA   L    ++R    + WK+   LS +E+Y     D+L+D+    +++    D  + + GL+EH +   +D+ +     +  R  A+T  N +SSRSH + + K+         ++   L L DLAGSE   +SG +G++F E T IN+SL+ L       R+ +   SYR++KLT +L   LG G+SK ++ VN+    E A E+ R+I F 
Sbjct:  239 HNDVVDLRGQIRVAVRVRP----LIKSEADASSSAIEYPAIDTIRINEGSKPGIVVKFEKVFTPVFSQKEVFANVEEFIRSSLHGYNVGLIAYGQTGSGKTHTMRGGNGEEEGIIPRAAAFLF--AESRKLESLGWKFDFSLSFLEVYNNVAYDLLSDRAVVQLRL---NDQTVSMIGLSEHTISNVSDVARLLRVADGGRKTAATKCNESSSRSHAVYMWKITAHQPSTGISTSCQLKLVDLAGSERAKESGVSGDQFKEMTNINQSLSILQMCISQQRSQKGHVSYRDSKLTQVLMDCLGRGNSKTMVVVNLNPCNEQATESKRSIEFA 560          
BLAST of Kinesin protein vs. Ensembl Celegans
Match: klp-11 (Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc:E5QCG4])

HSP 1 Score: 172.555 bits (436), Expect = 1.222e-44
Identity = 108/291 (37.11%), Postives = 165/291 (56.70%), Query Frame = 2
Query: 1349 KASKCFIFDRVFGPKSDQIEVFEAV-DELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEP---GVNRRAIYRLLNICDTRMQWKYRLFLSMVEIYQEDVRDILADKTSASVKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKV----YGEN-RIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQKP--SYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFGINAMQV 2188
            + SK F FD ++   S Q +++E    +L+ S ++GYN  I AYGQTG+GKTHTM G   +P   GV  + I  +          +Y +  S +EIYQE++RD+L  +++  ++I    D  + ++ LT    +   +I +   +G  +R+V  T +N  SSRSH I ++ V     GE+   H+T  +G L L DLAGSE  +K+GATGERF EAT IN SL+ LG V  +L + +     YR++KLT LL+ +LGG+SK ++   +     N EETL  + +   A  +
Sbjct:   55 EPSKDFTFDAIYDENSTQSDLYEETFRDLVDSVLNGYNATIFAYGQTGTGKTHTMEGKSSDPEQRGVIYKCIDHIFEHMAASHNQEYLVRASYLEIYQEELRDLLEAESNKKLEIKERPDGGVYVKDLTSKLTRTVGEIHEVMIRGNGHRSVGRTNMNEHSSRSHAIFIITVECSRIGEDGESHIT--VGRLNLVDLAGSERQSKTGATGERFKEATKINLSLSALGNVISALVDAKSAHIPYRDSKLTRLLQDSLGGNSKTVMVACIGPASYNFEETLGTLRYANRAKNI 343          
BLAST of Kinesin protein vs. Ensembl Celegans
Match: unc-116 (Kinesin heavy chain [Source:UniProtKB/Swiss-Prot;Acc:P34540])

HSP 1 Score: 171.4 bits (433), Expect = 3.284e-44
Identity = 115/332 (34.64%), Postives = 175/332 (52.71%), Query Frame = 2
Query: 1229 IRVYCRIRPQPRT-------FL-KITSEDKLIIVGDCLPEKITKHWYGKASKCFIFDRVFGPKSDQIEVFE-AVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVN---RRAIYRLLN-ICDTRMQWKYRLFLSMVEIYQEDVRDILADKTSASVKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQKP--SYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFGINA 2179
            ++V+CRIRP  +T       FL K  SED + + G                K ++FD+VF P + Q +V++ A   ++   + GYN  + AYGQT SGKTHTM G + + G++    R +  + N I       ++ + +S  EIY E +RD+L D    ++ I  +++    ++G TE  V   +++ +  + G+ NR VA T +N  SSRSH + L+ V  E++       G L L DLAGSE V+K+GA G    EA  INKSLT LG V  +L    K    YR++KLT +L+ +LGG+S+  + +       N  ET   + FG  A
Sbjct:   12 VQVFCRIRPLNKTEEKNADRFLPKFPSEDSISLGG----------------KVYVFDKVFKPNTTQEQVYKGAAYHIVQDVLSGYNGTVFAYGQTSSGKTHTMEGVIGDNGLSGIIPRIVADIFNHIYSMDENLQFHIKVSYYEIYNEKIRDLL-DPEKVNLSIHEDKNRVPYVKGATERFVGGPDEVLQAIEDGKSNRMVAVTNMNEHSSRSHSVFLITVKQEHQTTKKQLTGKLYLVDLAGSEKVSKTGAQGTVLEEAKNINKSLTALGIVISALAEGTKSHVPYRDSKLTRILQESLGGNSRTTVIICASPSHFNEAETKSTLLFGARA 326          
BLAST of Kinesin protein vs. Ensembl Fly
Match: ncd (gene:FBgn0002924 transcript:FBtr0344976)

HSP 1 Score: 192.971 bits (489), Expect = 8.145e-52
Identity = 124/333 (37.24%), Postives = 185/333 (55.56%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIRP-----QPRTFLKITSEDKLIIVGDCLPEKITKHWYGKASKCFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLLN-ICDTR-MQWKYRLFLSMVEIYQEDVRDILA-DKTSASVKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQKP-SYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFG 2170
            HN + +L GNIRV+CRIRP     + R     T  D+  +    + +   K   G+  + F FD+VF P S Q ++FE V  LI S +DGYN+CI AYGQTGSGKT+TM G  +  GV  R +  L + I   R + W+Y +  + +EIY E + D+L+ ++    +++  N  ++I +  +TE  V   N +       + NR  AST  N  SSRSH +  L++ G +      S+G++ L DLAGSE    S  T  R  E   IN+SL+ L  V  +L   Q    YR +KLT+LL P+LGG+SK L+F+NV    +  +E+++++ F 
Sbjct:  339 HNTVMDLRGNIRVFCRIRPPLESEENRMCCTWTYHDESTVELQSI-DAQAKSKMGQ--QIFSFDQVFHPLSSQSDIFEMVSPLIQSALDGYNICIFAYGQTGSGKTYTMDGVPESVGVIPRTVDLLFDSIRGYRNLGWEYEIKATFLEIYNEVLYDLLSNEQKDMEIRMAKNNKNDIYVSNITEETVLDPNHLRHLMHTAKMNRATASTAGNERSSRSHAVTKLELIGRHAEKQEISVGSINLVDLAGSE----SPKTSTRMTETKNINRSLSELTNVILALLQKQDHIPYRNSKLTHLLMPSLGGNSKTLMFINVSPFQDCFQESVKSLRFA 664          
BLAST of Kinesin protein vs. Ensembl Fly
Match: ncd (gene:FBgn0002924 transcript:FBtr0085534)

HSP 1 Score: 192.971 bits (489), Expect = 8.145e-52
Identity = 124/333 (37.24%), Postives = 185/333 (55.56%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIRP-----QPRTFLKITSEDKLIIVGDCLPEKITKHWYGKASKCFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLLN-ICDTR-MQWKYRLFLSMVEIYQEDVRDILA-DKTSASVKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQKP-SYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFG 2170
            HN + +L GNIRV+CRIRP     + R     T  D+  +    + +   K   G+  + F FD+VF P S Q ++FE V  LI S +DGYN+CI AYGQTGSGKT+TM G  +  GV  R +  L + I   R + W+Y +  + +EIY E + D+L+ ++    +++  N  ++I +  +TE  V   N +       + NR  AST  N  SSRSH +  L++ G +      S+G++ L DLAGSE    S  T  R  E   IN+SL+ L  V  +L   Q    YR +KLT+LL P+LGG+SK L+F+NV    +  +E+++++ F 
Sbjct:  339 HNTVMDLRGNIRVFCRIRPPLESEENRMCCTWTYHDESTVELQSI-DAQAKSKMGQ--QIFSFDQVFHPLSSQSDIFEMVSPLIQSALDGYNICIFAYGQTGSGKTYTMDGVPESVGVIPRTVDLLFDSIRGYRNLGWEYEIKATFLEIYNEVLYDLLSNEQKDMEIRMAKNNKNDIYVSNITEETVLDPNHLRHLMHTAKMNRATASTAGNERSSRSHAVTKLELIGRHAEKQEISVGSINLVDLAGSE----SPKTSTRMTETKNINRSLSELTNVILALLQKQDHIPYRNSKLTHLLMPSLGGNSKTLMFINVSPFQDCFQESVKSLRFA 664          
BLAST of Kinesin protein vs. Ensembl Fly
Match: Klp61F (gene:FBgn0004378 transcript:FBtr0072733)

HSP 1 Score: 193.356 bits (490), Expect = 7.430e-51
Identity = 131/358 (36.59%), Postives = 200/358 (55.87%), Query Frame = 2
Query: 1226 NIRVYCRIRPQPRTFLKITSEDKLIIVGDCLPEKITKHWY-GKASKCFIFDRVFGPKSDQIEVFEAV-DELITSCVDGYNVCIMAYGQTGSGKTHTMMGTV-----------QEPGVNRRAIYRLLNICDTRMQWKYRLFLSMVEIYQEDVRDILADKTSASVKIM--SNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVY-------GENRIHLTTSMGTLTLCDLAGSENVTKSG-ATGERFNEATCINKSLTTLGRVFDSL--RNHQKPSYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFGINA--MQVAPEKAQQRSK 2218
            NI+VY R+RP       I S + + +VG    E +T+H    K +K F FDR FGP+S Q +V+  V   LI   ++GYN  + AYGQTG+GKTHTM+G              + G+  RA+  L +     M+ +Y + +S +E+Y E++ D+L+   +  ++I   S +   +++QGL E  V  ++D++K  +KG++ R  A+TL+N  SSRSH +  + V+       GE+ + +    G L L DLAGSENV+K+G   G R  E   IN+SL TLGRV  +L  R    P YRE+KLT LL+ +LGG +K  +   +    ++ EETL  + +   A  +Q  PE  Q+ +K
Sbjct:   19 NIQVYVRVRPLNSRERCIRSAEVVDVVGP--REVVTRHTLDSKLTKKFTFDRSFGPESKQCDVYSVVVSPLIEEVLNGYNCTVFAYGQTGTGKTHTMVGNETAELKSSWEDDSDIGIIPRALSHLFDELRM-MEVEYTMRISYLELYNEELCDLLSTDDTTKIRIFDDSTKKGSVIIQGLEEIPVHSKDDVYKLLEKGKERRKTATTLMNAQSSRSHTVFSIVVHIRENGIEGEDMLKI----GKLNLVDLAGSENVSKAGNEKGIRVRETVNINQSLLTLGRVITALVDRAPHVP-YRESKLTRLLQESLGGRTKTSIIATISPGHKDIEETLSTLEYAHRAKNIQNKPEVNQKLTK 368          
BLAST of Kinesin protein vs. Ensembl Fly
Match: Khc (gene:FBgn0001308 transcript:FBtr0087184)

HSP 1 Score: 181.03 bits (458), Expect = 6.330e-47
Identity = 117/331 (35.35%), Postives = 183/331 (55.29%), Query Frame = 2
Query: 1226 NIRVYCRIRPQPRTFLKITSEDKLIIVGDCLPEKITKHWYGKASKCFIFDRVFGPKSDQIEVF-EAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLLN-----ICDTRMQWKYRLFLSMVEIYQEDVRDILADKTSASVKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQKP--SYRETKLTYLLKPTLGGDSKCLLFVNVRCEPE--NAEETLRAIHFGINAMQV 2188
            +I+V CR RP   +  K  S  K ++     P  + ++    A K ++FD+VF P + Q +V+ EA   ++T  + GYN  I AYGQT SGKTHTM G + +  V +  I R++N     I    +  ++ + +S  EIY + +RD+L D +  ++ +  +++    ++G TE  V    D+F+  ++G+ NR +A T +N  SSRSH + L+ V  EN  +     G L L DLAGSE V+K+GA G   +EA  INKSL+ LG V  +L +  K    YR++KLT +L+ +LGG+++  + +   C P   N  ET   + FG  A  V
Sbjct:   12 SIKVVCRFRPLNDSEEKAGS--KFVV---KFPNNVEENCISIAGKVYLFDKVFKPNASQEKVYNEAAKSIVTDVLAGYNGTIFAYGQTSSGKTHTMEGVIGD-SVKQGIIPRIVNDIFNHIYAMEVNLEFHIKVSYYEIYMDKIRDLL-DVSKVNLSVHEDKNRVPYVKGATERFVSSPEDVFEVIEEGKSNRHIAVTNMNEHSSRSHSVFLINVKQENLENQKKLSGKLYLVDLAGSEKVSKTGAEGTVLDEAKNINKSLSALGNVISALADGNKTHIPYRDSKLTRILQESLGGNARTTIVIC--CSPASFNESETKSTLDFGRRAKTV 333          
BLAST of Kinesin protein vs. Ensembl Fly
Match: Klp64D (gene:FBgn0004380 transcript:FBtr0077157)

HSP 1 Score: 165.622 bits (418), Expect = 1.341e-42
Identity = 111/343 (32.36%), Postives = 177/343 (51.60%), Query Frame = 2
Query: 1205 KLQELIGNIRVYCRIRPQPRTFLKITSEDKLIIVGDCLPEKIT----KHWYGKASKCFIFDRVFGPKSDQIEVF-EAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEP---GVNRRAIYRLL-NICDTRMQWKYRLFLSMVEIYQEDVRDILADKTSASVKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKV----YGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQKP--SYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFGINAMQV 2188
            +L + I N+RV  R RP  +  L   +   + +  D +   IT         +  K + FD VF   S+Q++++ +    ++   ++GYN  I+AYGQTG+GKT+TM G    P   G+   A   +  +I   +   K+ + +S +EIY E+VRD+L      S+++    D  + ++ L+ + V   +D+      G KNR V +T +N  SSRSH I  + V     GE  +     MG L L DLAGSE  +K+ A+G+R  EAT IN SL+ LG V  +L + +     YR +KLT LL+ +LGG+SK ++   +     N  ET+  + +   A  +
Sbjct:   13 QLDDEIENVRVVVRTRPMDKNELSAGALSAISV--DKINRAITVMKPNATANEPPKTYYFDNVFDGGSNQMDLYVDTARPIVDKVLEGYNGTILAYGQTGTGKTYTMSGNPDSPQTKGIIPNAFAHIFGHIAKAKENQKFLVRVSYMEIYNEEVRDLLGKDVGKSLEVKERPDIGVFVKDLSGYVVHNADDLENIMRLGNKNRAVGATKMNQESSRSHAIFSITVERSELGEGDVQ-HVRMGKLQLVDLAGSERQSKTQASGQRLKEATKINLSLSVLGNVISALVDGKSTHIPYRNSKLTRLLQDSLGGNSKTVMCATISPADSNYMETISTLRYASRAKNI 352          
BLAST of Kinesin protein vs. Ensembl Zebrafish
Match: kifc3 (kinesin family member C3 [Source:ZFIN;Acc:ZDB-GENE-030131-3724])

HSP 1 Score: 253.062 bits (645), Expect = 2.955e-73
Identity = 141/346 (40.75%), Postives = 201/346 (58.09%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIRPQPRTFLKITSEDKLIIVGDCLPEKITKHWYGKASKCFIF--DRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLLN-ICDTRMQWKYRLFLSMVEIYQEDVRDILADKTSA--SVKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRN-HQKPSYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFG--INAMQVAPEKAQQR 2212
            HN+L  L GNIRV CR+RP             L+      PE     +     K   F  D+VF  ++ Q EVF+ V  L+TSC+DG+NVCI AYGQTGSGKT+TM G  ++PG+N+RA+  L + + + +  W Y++ +SMVEIY E +R++L D  +    +K+  +   ++ + GL+E  V+   DI K FD G  NR  A T LN  SSRSH ++++ V G N      + G L L DLAGSE + KSGA G R  EA CINKSL+ LG V +SLR+ H    +R ++LTYLL+ +L GDSK L+ V V     N  E++ ++ F   +  +++ P  +  R
Sbjct:  315 HNELVRLKGNIRVLCRVRPVCAGEADAADTKNLVTFD---PEDDAVLYLSNKGKLMTFELDKVFTTQATQEEVFQEVQSLVTSCIDGFNVCIFAYGQTGSGKTYTMEGIPEDPGINQRALRLLFSEVSEKKPDWDYKITVSMVEIYNETLRNLLGDNPNEKLDIKMCPDGSGQLYVPGLSEFTVESVEDINKVFDLGHMNRATACTNLNEHSSRSHALLIITVAGFNSSTGHRTSGKLNLVDLAGSERIAKSGAEGSRLREAQCINKSLSALGDVINSLRSKHSHVPFRNSRLTYLLQDSLSGDSKTLMMVQVSPLESNISESVCSLKFAQRVRTVEIGPSSSSSR 657          
BLAST of Kinesin protein vs. Ensembl Zebrafish
Match: kifc3 (kinesin family member C3 [Source:ZFIN;Acc:ZDB-GENE-030131-3724])

HSP 1 Score: 253.062 bits (645), Expect = 1.158e-72
Identity = 143/347 (41.21%), Postives = 202/347 (58.21%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIRPQPRTFLKITSEDKLIIVGDCLPEKITKHWYGKASKCFIF--DRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLL--NICDTRMQWKYRLFLSMVEIYQEDVRDILADKTSA--SVKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRN-HQKPSYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFG--INAMQVAPEKAQQR 2212
            HN+L  L GNIRV CR+RP             L+      PE     +     K   F  D+VF  ++ Q EVF+ V  L+TSC+DG+NVCI AYGQTGSGKT+TM G  ++PG+N+RA+ RLL   + + +  W Y++ +SMVEIY E +R++L D  +    +K+  +   ++ + GL+E  V+   DI K FD G  NR  A T LN  SSRSH ++++ V G N      + G L L DLAGSE + KSGA G R  EA CINKSL+ LG V +SLR+ H    +R ++LTYLL+ +L GDSK L+ V V     N  E++ ++ F   +  +++ P  +  R
Sbjct:  344 HNELVRLKGNIRVLCRVRPVCAGEADAADTKNLVTFD---PEDDAVLYLSNKGKLMTFELDKVFTTQATQEEVFQEVQSLVTSCIDGFNVCIFAYGQTGSGKTYTMEGIPEDPGINQRAL-RLLFSEVSEKKPDWDYKITVSMVEIYNETLRNLLGDNPNEKLDIKMCPDGSGQLYVPGLSEFTVESVEDINKVFDLGHMNRATACTNLNEHSSRSHALLIITVAGFNSSTGHRTSGKLNLVDLAGSERIAKSGAEGSRLREAQCINKSLSALGDVINSLRSKHSHVPFRNSRLTYLLQDSLSGDSKTLMMVQVSPLESNISESVCSLKFAQRVRTVEIGPSSSSSR 686          
BLAST of Kinesin protein vs. Ensembl Zebrafish
Match: kifc3 (kinesin family member C3 [Source:ZFIN;Acc:ZDB-GENE-030131-3724])

HSP 1 Score: 253.062 bits (645), Expect = 1.625e-72
Identity = 141/346 (40.75%), Postives = 201/346 (58.09%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIRPQPRTFLKITSEDKLIIVGDCLPEKITKHWYGKASKCFIF--DRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLLN-ICDTRMQWKYRLFLSMVEIYQEDVRDILADKTSA--SVKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRN-HQKPSYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFG--INAMQVAPEKAQQR 2212
            HN+L  L GNIRV CR+RP             L+      PE     +     K   F  D+VF  ++ Q EVF+ V  L+TSC+DG+NVCI AYGQTGSGKT+TM G  ++PG+N+RA+  L + + + +  W Y++ +SMVEIY E +R++L D  +    +K+  +   ++ + GL+E  V+   DI K FD G  NR  A T LN  SSRSH ++++ V G N      + G L L DLAGSE + KSGA G R  EA CINKSL+ LG V +SLR+ H    +R ++LTYLL+ +L GDSK L+ V V     N  E++ ++ F   +  +++ P  +  R
Sbjct:  368 HNELVRLKGNIRVLCRVRPVCAGEADAADTKNLVTFD---PEDDAVLYLSNKGKLMTFELDKVFTTQATQEEVFQEVQSLVTSCIDGFNVCIFAYGQTGSGKTYTMEGIPEDPGINQRALRLLFSEVSEKKPDWDYKITVSMVEIYNETLRNLLGDNPNEKLDIKMCPDGSGQLYVPGLSEFTVESVEDINKVFDLGHMNRATACTNLNEHSSRSHALLIITVAGFNSSTGHRTSGKLNLVDLAGSERIAKSGAEGSRLREAQCINKSLSALGDVINSLRSKHSHVPFRNSRLTYLLQDSLSGDSKTLMMVQVSPLESNISESVCSLKFAQRVRTVEIGPSSSSSR 710          
BLAST of Kinesin protein vs. Ensembl Zebrafish
Match: kifc3 (kinesin family member C3 [Source:ZFIN;Acc:ZDB-GENE-030131-3724])

HSP 1 Score: 252.677 bits (644), Expect = 2.307e-72
Identity = 141/346 (40.75%), Postives = 201/346 (58.09%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIRPQPRTFLKITSEDKLIIVGDCLPEKITKHWYGKASKCFIF--DRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLLN-ICDTRMQWKYRLFLSMVEIYQEDVRDILADKTSA--SVKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRN-HQKPSYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFG--INAMQVAPEKAQQR 2212
            HN+L  L GNIRV CR+RP             L+      PE     +     K   F  D+VF  ++ Q EVF+ V  L+TSC+DG+NVCI AYGQTGSGKT+TM G  ++PG+N+RA+  L + + + +  W Y++ +SMVEIY E +R++L D  +    +K+  +   ++ + GL+E  V+   DI K FD G  NR  A T LN  SSRSH ++++ V G N      + G L L DLAGSE + KSGA G R  EA CINKSL+ LG V +SLR+ H    +R ++LTYLL+ +L GDSK L+ V V     N  E++ ++ F   +  +++ P  +  R
Sbjct:  372 HNELVRLKGNIRVLCRVRPVCAGEADAADTKNLVTFD---PEDDAVLYLSNKGKLMTFELDKVFTTQATQEEVFQEVQSLVTSCIDGFNVCIFAYGQTGSGKTYTMEGIPEDPGINQRALRLLFSEVSEKKPDWDYKITVSMVEIYNETLRNLLGDNPNEKLDIKMCPDGSGQLYVPGLSEFTVESVEDINKVFDLGHMNRATACTNLNEHSSRSHALLIITVAGFNSSTGHRTSGKLNLVDLAGSERIAKSGAEGSRLREAQCINKSLSALGDVINSLRSKHSHVPFRNSRLTYLLQDSLSGDSKTLMMVQVSPLESNISESVCSLKFAQRVRTVEIGPSSSSSR 714          
BLAST of Kinesin protein vs. Ensembl Zebrafish
Match: si:ch211-257p13.3 (si:ch211-257p13.3 [Source:ZFIN;Acc:ZDB-GENE-110914-108])

HSP 1 Score: 231.491 bits (589), Expect = 1.111e-64
Identity = 138/333 (41.44%), Postives = 188/333 (56.46%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIRPQPRTFLKITSEDK------LIIVGDCLPEKITKHWYGKASKCFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLLNICDTRMQ-WKYRLFLSMVEIYQEDVRDILA-DKTSASVKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQKP-SYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFG 2170
            H +L EL GNIRV CR++P       +  ED+      +++  D   E           K F  D+VF P++ Q EVF+ ++ LITSC+DGY+VCI AYGQTGSGKT+TM GTV+ PG+N+RA+  L N  + R   W Y + +S VEIY E +RD+L+ D     +KI  +   ++ + GL   EVK    I K      KNR    T +N  SSRSH ++ + V G +      + G L L DLAGSE V KSGA GER  EA  IN+SL  LG V  +L+ HQ    +R ++LTYLL+ +LG  +K  + V V     N  ETL ++ F 
Sbjct:  448 HEQLVELKGNIRVLCRVKP-------VLKEDQHEEGQAVVVTTDPNNESALIVLSKGKVKNFELDKVFHPQATQEEVFQEIEPLITSCIDGYHVCIFAYGQTGSGKTYTMEGTVENPGINQRALKHLFNEIEERKDMWTYTVSVSSVEIYNEVLRDLLSKDGEKLDIKINPDGTGQLHVPGLRVLEVKNFQHIKKILAIARKNRITFGTQMNQHSSRSHALLTVTVLGTDLASGAKTTGKLNLVDLAGSERVWKSGAEGERLKEAQNINRSLLALGDVIQALKAHQTHIPFRNSRLTYLLQDSLGKGNKTAMVVQVSSLESNVGETLCSLKFA 773          
BLAST of Kinesin protein vs. Ensembl Xenopus
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:548839])

HSP 1 Score: 251.136 bits (640), Expect = 2.493e-74
Identity = 145/334 (43.41%), Postives = 196/334 (58.68%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIRPQPRTFLKITSEDKLIIVGDCL----PEKITKHWYGKASK--CFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLLNICDTRM-QWKYRLFLSMVEIYQEDVRDILADKTSAS--VKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQKP-SYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFG 2170
            HN+L  L GNIRV  R+RP       IT+ED +    + +    P+     +  +  K   F  D+VF P + Q EVF  V  LITSC+DGY+VCI+AYGQTGSGKT++M G   +PG+N+RA++ LL+    R   W++ L +SMVEIY E +RD+L    S S  +KI+     E+ +  LT+ +V+   DI K  + G K R    T LN  SSRSH +++L   G        S G L L DLAGSE V++SGA GER  EA CIN+SL+ LG VF +LR+ Q    YR +KLTYLL+  L  D K LL + V    +N  E+L ++ FG
Sbjct:  141 HNQLVRLRGNIRVLTRVRP-------ITTEDGVGPGAENVVNFDPDDDGVLYVAQKGKEMSFELDKVFKPSATQEEVFREVSPLITSCLDGYSVCILAYGQTGSGKTYSMEGIPSDPGINQRALHLLLSEVKERSNSWEHELSVSMVEIYNETLRDLLGSDPSNSLEIKILPGSVGELYVPNLTQRQVQSMEDINKILELGHKQRATEHTNLNTHSSRSHALLILTAKGRETSTGICSTGKLYLVDLAGSERVSRSGAAGERLREAQCINRSLSALGDVFSALRSQQGHIPYRNSKLTYLLQEPLSRDGKALLLLQVSPAEKNINESLCSLRFG 467          
BLAST of Kinesin protein vs. Ensembl Xenopus
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:548839])

HSP 1 Score: 253.447 bits (646), Expect = 6.051e-72
Identity = 145/334 (43.41%), Postives = 196/334 (58.68%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIRPQPRTFLKITSEDKLIIVGDCL----PEKITKHWYGKASK--CFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLLNICDTRM-QWKYRLFLSMVEIYQEDVRDILADKTSAS--VKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQKP-SYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFG 2170
            HN+L  L GNIRV  R+RP       IT+ED +    + +    P+     +  +  K   F  D+VF P + Q EVF  V  LITSC+DGY+VCI+AYGQTGSGKT++M G   +PG+N+RA++ LL+    R   W++ L +SMVEIY E +RD+L    S S  +KI+     E+ +  LT+ +V+   DI K  + G K R    T LN  SSRSH +++L   G        S G L L DLAGSE V++SGA GER  EA CIN+SL+ LG VF +LR+ Q    YR +KLTYLL+  L  D K LL + V    +N  E+L ++ FG
Sbjct:  476 HNQLVRLRGNIRVLTRVRP-------ITTEDGVGPGAENVVNFDPDDDGVLYVAQKGKEMSFELDKVFKPSATQEEVFREVSPLITSCLDGYSVCILAYGQTGSGKTYSMEGIPSDPGINQRALHLLLSEVKERSNSWEHELSVSMVEIYNETLRDLLGSDPSNSLEIKILPGSVGELYVPNLTQRQVQSMEDINKILELGHKQRATEHTNLNTHSSRSHALLILTAKGRETSTGICSTGKLYLVDLAGSERVSRSGAAGERLREAQCINRSLSALGDVFSALRSQQGHIPYRNSKLTYLLQEPLSRDGKALLLLQVSPAEKNINESLCSLRFG 802          
BLAST of Kinesin protein vs. Ensembl Xenopus
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:548839])

HSP 1 Score: 252.677 bits (644), Expect = 1.051e-71
Identity = 145/334 (43.41%), Postives = 196/334 (58.68%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIRPQPRTFLKITSEDKLIIVGDCL----PEKITKHWYGKASK--CFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLLNICDTRM-QWKYRLFLSMVEIYQEDVRDILADKTSAS--VKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQKP-SYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFG 2170
            HN+L  L GNIRV  R+RP       IT+ED +    + +    P+     +  +  K   F  D+VF P + Q EVF  V  LITSC+DGY+VCI+AYGQTGSGKT++M G   +PG+N+RA++ LL+    R   W++ L +SMVEIY E +RD+L    S S  +KI+     E+ +  LT+ +V+   DI K  + G K R    T LN  SSRSH +++L   G        S G L L DLAGSE V++SGA GER  EA CIN+SL+ LG VF +LR+ Q    YR +KLTYLL+  L  D K LL + V    +N  E+L ++ FG
Sbjct:  469 HNQLVRLRGNIRVLTRVRP-------ITTEDGVGPGAENVVNFDPDDDGVLYVAQKGKEMSFELDKVFKPSATQEEVFREVSPLITSCLDGYSVCILAYGQTGSGKTYSMEGIPSDPGINQRALHLLLSEVKERSNSWEHELSVSMVEIYNETLRDLLGSDPSNSLEIKILPGSVGELYVPNLTQRQVQSMEDINKILELGHKQRATEHTNLNTHSSRSHALLILTAKGRETSTGICSTGKLYLVDLAGSERVSRSGAAGERLREAQCINRSLSALGDVFSALRSQQGHIPYRNSKLTYLLQEPLSRDGKALLLLQVSPAEKNINESLCSLRFG 795          
BLAST of Kinesin protein vs. Ensembl Xenopus
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:548839])

HSP 1 Score: 251.906 bits (642), Expect = 4.218e-71
Identity = 145/334 (43.41%), Postives = 196/334 (58.68%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIRPQPRTFLKITSEDKLIIVGDCL----PEKITKHWYGKASK--CFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLLNICDTRM-QWKYRLFLSMVEIYQEDVRDILADKTSAS--VKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQKP-SYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFG 2170
            HN+L  L GNIRV  R+RP       IT+ED +    + +    P+     +  +  K   F  D+VF P + Q EVF  V  LITSC+DGY+VCI+AYGQTGSGKT++M G   +PG+N+RA++ LL+    R   W++ L +SMVEIY E +RD+L    S S  +KI+     E+ +  LT+ +V+   DI K  + G K R    T LN  SSRSH +++L   G        S G L L DLAGSE V++SGA GER  EA CIN+SL+ LG VF +LR+ Q    YR +KLTYLL+  L  D K LL + V    +N  E+L ++ FG
Sbjct:  543 HNQLVRLRGNIRVLTRVRP-------ITTEDGVGPGAENVVNFDPDDDGVLYVAQKGKEMSFELDKVFKPSATQEEVFREVSPLITSCLDGYSVCILAYGQTGSGKTYSMEGIPSDPGINQRALHLLLSEVKERSNSWEHELSVSMVEIYNETLRDLLGSDPSNSLEIKILPGSVGELYVPNLTQRQVQSMEDINKILELGHKQRATEHTNLNTHSSRSHALLILTAKGRETSTGICSTGKLYLVDLAGSERVSRSGAAGERLREAQCINRSLSALGDVFSALRSQQGHIPYRNSKLTYLLQEPLSRDGKALLLLQVSPAEKNINESLCSLRFG 869          
BLAST of Kinesin protein vs. Ensembl Xenopus
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:548839])

HSP 1 Score: 251.906 bits (642), Expect = 1.219e-70
Identity = 145/334 (43.41%), Postives = 196/334 (58.68%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIRPQPRTFLKITSEDKLIIVGDCL----PEKITKHWYGKASK--CFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLLNICDTRM-QWKYRLFLSMVEIYQEDVRDILADKTSAS--VKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQKP-SYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFG 2170
            HN+L  L GNIRV  R+RP       IT+ED +    + +    P+     +  +  K   F  D+VF P + Q EVF  V  LITSC+DGY+VCI+AYGQTGSGKT++M G   +PG+N+RA++ LL+    R   W++ L +SMVEIY E +RD+L    S S  +KI+     E+ +  LT+ +V+   DI K  + G K R    T LN  SSRSH +++L   G        S G L L DLAGSE V++SGA GER  EA CIN+SL+ LG VF +LR+ Q    YR +KLTYLL+  L  D K LL + V    +N  E+L ++ FG
Sbjct:  640 HNQLVRLRGNIRVLTRVRP-------ITTEDGVGPGAENVVNFDPDDDGVLYVAQKGKEMSFELDKVFKPSATQEEVFREVSPLITSCLDGYSVCILAYGQTGSGKTYSMEGIPSDPGINQRALHLLLSEVKERSNSWEHELSVSMVEIYNETLRDLLGSDPSNSLEIKILPGSVGELYVPNLTQRQVQSMEDINKILELGHKQRATEHTNLNTHSSRSHALLILTAKGRETSTGICSTGKLYLVDLAGSERVSRSGAAGERLREAQCINRSLSALGDVFSALRSQQGHIPYRNSKLTYLLQEPLSRDGKALLLLQVSPAEKNINESLCSLRFG 966          
BLAST of Kinesin protein vs. Ensembl Mouse
Match: Kifc3 (kinesin family member C3 [Source:MGI Symbol;Acc:MGI:109202])

HSP 1 Score: 236.498 bits (602), Expect = 3.222e-67
Identity = 139/344 (40.41%), Postives = 199/344 (57.85%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIRPQPRTFLKITSEDKL------IIVGDCLPEKITKHWYGKASKCFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLLN-ICDTRMQWKYRLFLSMVEIYQEDVRDILADKTSASVKIM--SNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQKP-SYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFG--INAMQVAP 2194
            HN+L  L GNIRV  R+RP       +T ED         +  D   + I    +      F  D+VF P + Q +VF+ V  LITSC+DG+NVCI AYGQTG+GKT+TM GT + PG+N+RA+  L + + +    W+Y + +S  EIY E +RD+L  +    ++I    +   ++ + GLTE +V+  +DI K F+ G  NRT   T LN  SSRSH ++++ V G +      + G L L DLAGSE V KSGA G R  EA  IN+SL+ LG V  +LR+ Q    +R +KLTYLL+ +L GDSK L+ V V    +N  ETL ++ F   + ++++ P
Sbjct:  297 HNELVRLKGNIRVIARVRP-------VTKEDGEGPEATNAVTFDPDDDSIIHLLHKGKPVSFELDKVFSPWASQQDVFQEVQALITSCIDGFNVCIFAYGQTGAGKTYTMEGTPENPGINQRALQLLFSEVQEKASDWQYNITVSAAEIYNEVLRDLLGKEPQEKLEIRLCPDGSGQLYVPGLTEFQVQSVDDINKVFEFGYNNRTTEFTNLNEHSSRSHALLIVTVRGVDCSTGLRTTGKLNLVDLAGSERVGKSGAEGNRLREAQHINRSLSALGDVIAALRSRQGHVPFRNSKLTYLLQDSLSGDSKTLMVVQVSPVEKNTSETLYSLRFAERVRSVELGP 633          
BLAST of Kinesin protein vs. Ensembl Mouse
Match: Kifc3 (kinesin family member C3 [Source:MGI Symbol;Acc:MGI:109202])

HSP 1 Score: 235.728 bits (600), Expect = 8.492e-67
Identity = 139/344 (40.41%), Postives = 199/344 (57.85%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIRPQPRTFLKITSEDKL------IIVGDCLPEKITKHWYGKASKCFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLLN-ICDTRMQWKYRLFLSMVEIYQEDVRDILADKTSASVKIM--SNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQKP-SYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFG--INAMQVAP 2194
            HN+L  L GNIRV  R+RP       +T ED         +  D   + I    +      F  D+VF P + Q +VF+ V  LITSC+DG+NVCI AYGQTG+GKT+TM GT + PG+N+RA+  L + + +    W+Y + +S  EIY E +RD+L  +    ++I    +   ++ + GLTE +V+  +DI K F+ G  NRT   T LN  SSRSH ++++ V G +      + G L L DLAGSE V KSGA G R  EA  IN+SL+ LG V  +LR+ Q    +R +KLTYLL+ +L GDSK L+ V V    +N  ETL ++ F   + ++++ P
Sbjct:  319 HNELVRLKGNIRVIARVRP-------VTKEDGEGPEATNAVTFDPDDDSIIHLLHKGKPVSFELDKVFSPWASQQDVFQEVQALITSCIDGFNVCIFAYGQTGAGKTYTMEGTPENPGINQRALQLLFSEVQEKASDWQYNITVSAAEIYNEVLRDLLGKEPQEKLEIRLCPDGSGQLYVPGLTEFQVQSVDDINKVFEFGYNNRTTEFTNLNEHSSRSHALLIVTVRGVDCSTGLRTTGKLNLVDLAGSERVGKSGAEGNRLREAQHINRSLSALGDVIAALRSRQGHVPFRNSKLTYLLQDSLSGDSKTLMVVQVSPVEKNTSETLYSLRFAERVRSVELGP 655          
BLAST of Kinesin protein vs. Ensembl Mouse
Match: Kifc3 (kinesin family member C3 [Source:MGI Symbol;Acc:MGI:109202])

HSP 1 Score: 235.728 bits (600), Expect = 5.448e-66
Identity = 139/344 (40.41%), Postives = 199/344 (57.85%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIRPQPRTFLKITSEDKL------IIVGDCLPEKITKHWYGKASKCFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLLN-ICDTRMQWKYRLFLSMVEIYQEDVRDILADKTSASVKIM--SNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQKP-SYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFG--INAMQVAP 2194
            HN+L  L GNIRV  R+RP       +T ED         +  D   + I    +      F  D+VF P + Q +VF+ V  LITSC+DG+NVCI AYGQTG+GKT+TM GT + PG+N+RA+  L + + +    W+Y + +S  EIY E +RD+L  +    ++I    +   ++ + GLTE +V+  +DI K F+ G  NRT   T LN  SSRSH ++++ V G +      + G L L DLAGSE V KSGA G R  EA  IN+SL+ LG V  +LR+ Q    +R +KLTYLL+ +L GDSK L+ V V    +N  ETL ++ F   + ++++ P
Sbjct:  434 HNELVRLKGNIRVIARVRP-------VTKEDGEGPEATNAVTFDPDDDSIIHLLHKGKPVSFELDKVFSPWASQQDVFQEVQALITSCIDGFNVCIFAYGQTGAGKTYTMEGTPENPGINQRALQLLFSEVQEKASDWQYNITVSAAEIYNEVLRDLLGKEPQEKLEIRLCPDGSGQLYVPGLTEFQVQSVDDINKVFEFGYNNRTTEFTNLNEHSSRSHALLIVTVRGVDCSTGLRTTGKLNLVDLAGSERVGKSGAEGNRLREAQHINRSLSALGDVIAALRSRQGHVPFRNSKLTYLLQDSLSGDSKTLMVVQVSPVEKNTSETLYSLRFAERVRSVELGP 770          
BLAST of Kinesin protein vs. Ensembl Mouse
Match: Kifc3 (kinesin family member C3 [Source:MGI Symbol;Acc:MGI:109202])

HSP 1 Score: 221.861 bits (564), Expect = 2.708e-61
Identity = 140/353 (39.66%), Postives = 197/353 (55.81%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIRPQPRTFLKITSEDKLIIVGDCLPEKITKHWYGKASKCFIFDRVFGPKSDQI---------------EVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLLN-ICDTRMQWKYRLFLSMVEIYQEDVRDILADKTSASVKIM--SNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQKP-SYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFG--INAMQVAP 2194
            HN+L  L GNIRV  R+RP       +T ED     G+  PE         A+    FD    P  D I               +VF+ V  LITSC+DG+NVCI AYGQTG+GKT+TM GT + PG+N+RA+  L + + +    W+Y + +S  EIY E +RD+L  +    ++I    +   ++ + GLTE +V+  +DI K F+ G  NRT   T LN  SSRSH ++++ V G +      + G L L DLAGSE V KSGA G R  EA  IN+SL+ LG V  +LR+ Q    +R +KLTYLL+ +L GDSK L+ V V    +N  ETL ++ F   + ++++ P
Sbjct:  398 HNELVRLKGNIRVIARVRP-------VTKED-----GEG-PE---------ATNAVTFD----PDDDSIIHLLHKGKPVSFELDKVFQEVQALITSCIDGFNVCIFAYGQTGAGKTYTMEGTPENPGINQRALQLLFSEVQEKASDWQYNITVSAAEIYNEVLRDLLGKEPQEKLEIRLCPDGSGQLYVPGLTEFQVQSVDDINKVFEFGYNNRTTEFTNLNEHSSRSHALLIVTVRGVDCSTGLRTTGKLNLVDLAGSERVGKSGAEGNRLREAQHINRSLSALGDVIAALRSRQGHVPFRNSKLTYLLQDSLSGDSKTLMVVQVSPVEKNTSETLYSLRFAERVRSVELGP 724          
BLAST of Kinesin protein vs. Ensembl Mouse
Match: Kifc1 (kinesin family member C1 [Source:MGI Symbol;Acc:MGI:109596])

HSP 1 Score: 203.371 bits (516), Expect = 7.804e-56
Identity = 134/363 (36.91%), Postives = 177/363 (48.76%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIRP-----------------------QPRTFLKITSEDKLIIVGDCLPEKITKHWYGKASKCFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQ-EP---GVNRRAIYRLLNICD--TRMQWKYRLFLSMVEIYQEDVRDILADKTSAS------VKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATG----ERFNEATCINKSLTTLGRVFDSLRNHQKP-SYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHF 2167
            HN+LQEL GNIRV+CR+RP                        P T L ++  D         P    +H        F FDRVF P S Q EVFE +  L+ S +DGY VCI AYGQTGSGKT TM G  + +P   G+  RA+  L ++    +   W Y    S VEIY E VRD+LA            ++  S   +E+ +       V CE ++        +NR VA T  N  SSRSH +  L++ GE+          L L DLAGSE +      G    +R  E   IN SL+TLG V  +L N +    YR +KLTYLL+ +LGG +K L+FVN+    EN  E+L ++ F
Sbjct:  239 HNQLQELKGNIRVFCRVRPVLEGESTPSPGFLVFPPGPAGPSDPPTGLSLSRSDDRRSTLTGAPAPTVRH-------DFSFDRVFPPGSKQEEVFEEIAMLVQSALDGYPVCIFAYGQTGSGKTFTMEGGPRGDPQLEGLIPRAMRHLFSVAQEMSGQGWTYSFVASYVEIYNETVRDLLATGPRKGQGGECEIRRASPGSEELTVTNARYVPVSCEKEVEALLHLAHQNRAVAHTAQNKRSSRSHSVFQLQISGEHAARGLQCGAPLNLVDLAGSERLDPGLHLGPGERDRLRETQAINSSLSTLGLVIMALSNKESHVPYRNSKLTYLLQNSLGGSAKMLMFVNISPLEENVSESLNSLRF 594          
BLAST of Kinesin protein vs. UniProt/SwissProt
Match: sp|Q9BVG8|KIFC3_HUMAN (Kinesin-like protein KIFC3 OS=Homo sapiens OX=9606 GN=KIFC3 PE=1 SV=4)

HSP 1 Score: 239.195 bits (609), Expect = 2.847e-66
Identity = 139/344 (40.41%), Postives = 200/344 (58.14%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIRPQPRTFLKITSEDKL------IIVGDCLPEKITKHWYGKASKCFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLLN-ICDTRMQWKYRLFLSMVEIYQEDVRDILADKTSASVKIM--SNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQKP-SYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFG--INAMQVAP 2194
            HN+L  L GNIRV  R+RP       +T ED         +  D   + I    +      F  D+VF P++ Q +VF+ V  L+TSC+DG+NVCI AYGQTG+GKT+TM GT + PG+N+RA+  L + + +    W+Y + +S  EIY E +RD+L  +    ++I    +   ++ + GLTE +V+  +DI K F+ G  NRT   T LN  SSRSH ++++ V G +      + G L L DLAGSE V KSGA G R  EA  INKSL+ LG V  +LR+ Q    +R +KLTYLL+ +L GDSK L+ V V    +N  ETL ++ F   + ++++ P
Sbjct:  436 HNELVRLKGNIRVIARVRP-------VTKEDGEGPEATNAVTFDADDDSIIHLLHKGKPVSFELDKVFSPQASQQDVFQEVQALVTSCIDGFNVCIFAYGQTGAGKTYTMEGTAENPGINQRALQLLFSEVQEKASDWEYTITVSAAEIYNEVLRDLLGKEPQEKLEIRLCPDGSGQLYVPGLTEFQVQSVDDINKVFEFGHTNRTTEFTNLNEHSSRSHALLIVTVRGVDCSTGLRTTGKLNLVDLAGSERVGKSGAEGSRLREAQHINKSLSALGDVIAALRSRQGHVPFRNSKLTYLLQDSLSGDSKTLMVVQVSPVEKNTSETLYSLKFAERVRSVELGP 772          
BLAST of Kinesin protein vs. UniProt/SwissProt
Match: sp|F4J2M6|KN14L_ARATH (Kinesin-like protein KIN-14L OS=Arabidopsis thaliana OX=3702 GN=KIN14L PE=3 SV=2)

HSP 1 Score: 239.195 bits (609), Expect = 1.163e-65
Identity = 148/357 (41.46%), Postives = 208/357 (58.26%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIRP----QPRTFLKITSEDKLIIVGDCLPEKITKHWYGKASKCFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMG----TVQEPGVNRRAIYRLLNICDTRMQ-WKYRLFLSMVEIYQEDVRDILADKTSASVKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLC----DLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSL--RNHQKPSYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFG--INAMQVAPEKAQQRSK 2218
            +N +Q+L GNIRVYCR+RP    +    +    +D  + V D  P K     Y  A K F F++VFGP + Q +VF     LI S +DGYNVCI AYGQTGSGKT+TM G    +  E G+N  A+  L  ICD R     Y +++ MVEIY E VRD+LA+ +S  ++  S+ DD + L   T H V    D+ +  + GE NR V+ST +N  SSRSH I ++ V G++     TS GTL  C    DLAGSE V KS  TG+R  EA  INKSL+ LG V  +L  +N   P YR +KLT LL+ +LGG +K L+F ++  E ++  ET+  + F   ++ +++   +A + ++
Sbjct:  354 YNMVQDLKGNIRVYCRVRPIFNSEMDGVIDYIGKDGSLFVLD--PSK----PYKDARKTFQFNQVFGPTATQDDVFRETQPLIRSVMDGYNVCIFAYGQTGSGKTYTMSGPPGRSATEMGINYLALSDLFLICDRRKDMMTYEIYVQMVEIYNEQVRDLLAENSSY-IRTCSSDDDGLSLPDATMHSVNSTKDVLQLMEAGEVNRAVSSTSMNNRSSRSHSIFMVHVRGKD-----TSGGTLRSCLHLVDLAGSERVDKSEVTGDRLKEAQYINKSLSCLGDVISALAQKNSHIP-YRNSKLTLLLQDSLGGQAKTLMFAHLSPEEDSFGETISTLKFAQRVSTVELGAARAHKETR 697          
BLAST of Kinesin protein vs. UniProt/SwissProt
Match: sp|O35231|KIFC3_MOUSE (Kinesin-like protein KIFC3 OS=Mus musculus OX=10090 GN=Kifc3 PE=1 SV=4)

HSP 1 Score: 235.728 bits (600), Expect = 3.811e-65
Identity = 139/344 (40.41%), Postives = 199/344 (57.85%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIRPQPRTFLKITSEDKL------IIVGDCLPEKITKHWYGKASKCFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLLN-ICDTRMQWKYRLFLSMVEIYQEDVRDILADKTSASVKIM--SNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQKP-SYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFG--INAMQVAP 2194
            HN+L  L GNIRV  R+RP       +T ED         +  D   + I    +      F  D+VF P + Q +VF+ V  LITSC+DG+NVCI AYGQTG+GKT+TM GT + PG+N+RA+  L + + +    W+Y + +S  EIY E +RD+L  +    ++I    +   ++ + GLTE +V+  +DI K F+ G  NRT   T LN  SSRSH ++++ V G +      + G L L DLAGSE V KSGA G R  EA  IN+SL+ LG V  +LR+ Q    +R +KLTYLL+ +L GDSK L+ V V    +N  ETL ++ F   + ++++ P
Sbjct:  434 HNELVRLKGNIRVIARVRP-------VTKEDGEGPEATNAVTFDPDDDSIIHLLHKGKPVSFELDKVFSPWASQQDVFQEVQALITSCIDGFNVCIFAYGQTGAGKTYTMEGTPENPGINQRALQLLFSEVQEKASDWQYNITVSAAEIYNEVLRDLLGKEPQEKLEIRLCPDGSGQLYVPGLTEFQVQSVDDINKVFEFGYNNRTTEFTNLNEHSSRSHALLIVTVRGVDCSTGLRTTGKLNLVDLAGSERVGKSGAEGNRLREAQHINRSLSALGDVIAALRSRQGHVPFRNSKLTYLLQDSLSGDSKTLMVVQVSPVEKNTSETLYSLRFAERVRSVELGP 770          
BLAST of Kinesin protein vs. UniProt/SwissProt
Match: sp|Q5JKW1|KN14C_ORYSJ (Kinesin-like protein KIN-14C OS=Oryza sativa subsp. japonica OX=39947 GN=KIN14C PE=2 SV=1)

HSP 1 Score: 236.884 bits (603), Expect = 7.118e-65
Identity = 150/358 (41.90%), Postives = 214/358 (59.78%), Query Frame = 2
Query: 1202 NKLQELIGNIRVYCRIRP-QPRTFLKITSEDKLIIVGDCL---PEKITKHWYGKASKCFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMG---TVQEPGVNRRAIYRLLNICDTRMQ-WKYRLFLSMVEIYQEDVRDILA-DKTSASVKIMS-NQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSL--RNHQKPSYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFG--INAMQVAPEKAQQRSKFRKTL 2233
            N++QEL GNIRVYCR+RP  P    K+T+ D +   G+ L   P K  K  Y    + F F++VFG  S Q EVF  +  LI S +DG+NVCI AYGQTGSGKT+TM G   + ++ GVN RA+  L +I  +R   + Y + + MVEIY E VRD+L+ D     + I S +Q + +++   + H VK  +D+    + G+ NR V ST LN  SSRSH I+ + V G +  + +TS G L L DLAGSE V +S ATG+R  EA  INKSL+ LG V  SL  +N   P YR +KLT +L+ +LGG +K L+FV +  + E+  ET+  + F   ++ +++   ++ +  K  K L
Sbjct:  464 NEVQELKGNIRVYCRVRPFLPGQDGKLTAIDYIGENGEILIANPSKQGKEGY----RMFKFNKVFGTHSSQAEVFSDIQPLIRSVLDGFNVCIFAYGQTGSGKTYTMSGPGTSREDWGVNYRALNDLFDISLSRKNAFSYEVGVQMVEIYNEQVRDLLSNDIAQKRLGIWSTSQPNGLVVPDASLHPVKSTSDVLDLMEIGQSNRAVGSTALNERSSRSHSILTVHVRGLDVKNGSTSRGCLHLIDLAGSERVERSEATGDRLKEAQHINKSLSALGDVIFSLAQKNAHVP-YRNSKLTQVLQSSLGGQAKTLMFVQINPDIESYSETISTLKFAERVSGVELGAARSNREGKDIKEL 816          
BLAST of Kinesin protein vs. UniProt/SwissProt
Match: sp|P46864|KN14M_ARATH (Kinesin-like protein KIN-14M OS=Arabidopsis thaliana OX=3702 GN=KIN14M PE=1 SV=1)

HSP 1 Score: 232.261 bits (591), Expect = 2.479e-64
Identity = 141/358 (39.39%), Postives = 195/358 (54.47%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIRP---------QPRTFLKITSEDKLIIVGDCLPEKITKHWYGKASKCFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEP---GVNRRAIYRLLNICDT-RMQ-WKYRLFLSMVEIYQEDVRDILADKTSA----------SVKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSL-RNHQKPSYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFG--INAMQVA 2191
            HN +QEL GNIRV+CR+RP         + +T    TS + L    D L            S CF FD+VF P + Q +VF  + +L+ S +DGY VCI AYGQTGSGKT+TMMG    P   G+  R + ++     + R Q WKY L +SM+EIY E +RD+L+    A             I  +      +  LT  +V+    +    D   +NR+V  T +N  SSRSH +  LK+ G N        G L L DLAGSE ++KSG+TG+R  E   INKSL++LG V  +L +      +R +KLTYLL+P LGGDSK L+FVN+  EP +  E+L ++ F   +NA ++ 
Sbjct:  378 HNTIQELKGNIRVFCRVRPLLSGENSSEEAKTISYPTSLEALGRGIDLL--------QNGQSHCFTFDKVFVPSASQEDVFVEISQLVQSALDGYKVCIFAYGQTGSGKTYTMMGRPGNPDEKGLIPRCLEQIFQTRQSLRSQGWKYELQVSMLEIYNETIRDLLSTNKEAVRADNGVSPQKYAIKHDASGNTHVVELTVVDVRSSKQVSFLLDHAARNRSVGKTAMNEQSSRSHFVFTLKISGFNESTEQQVQGVLNLIDLAGSERLSKSGSTGDRLKETQAINKSLSSLGDVIFALAKKEDHVPFRNSKLTYLLQPCLGGDSKTLMFVNITPEPSSTGESLCSLRFAARVNACEIG 727          
BLAST of Kinesin protein vs. TrEMBL
Match: A0A0R3VVJ9 (Kinesin motor domain-containing protein OS=Taenia asiatica OX=60517 PE=3 SV=1)

HSP 1 Score: 350.517 bits (898), Expect = 5.657e-110
Identity = 176/335 (52.54%), Postives = 220/335 (65.67%), Query Frame = 2
Query: 1358 KCFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLLNICDTRMQWKYRLFLSMVEIYQEDVRDILA----DKTSAS-------------------------------------------------VKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQKPSYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFGINAMQVAPEKA 2203
            KCFIFD+VFGP + Q  V+  VD+ I SCVDG+NVCIMAYGQTGSGKTHTM+G+ Q+PGVNRRAI RLL +  +R  W Y+L +SM+E+YQE+V D+L     DK S                                                   V+++S ++DE++LQ L E  V+ E D+ +  + GEK R+  +T LN  SSRSH+++LL+V GE+ ++ T S GTL L DLAGSENV KSG+ G RF EATCINKSL+ L RVFDSLR   KP+YRETKLTYLLKPTLGGD+KCL+ VNVR EPEN +ETLRAI FG  A+QVAP K+
Sbjct:   33 KCFIFDKVFGPDAQQQAVYREVDDSIISCVDGFNVCIMAYGQTGSGKTHTMVGSAQDPGVNRRAIKRLLQLSKSRKHWTYQLSMSMLEVYQEEVFDLLVGGAVDKPSGGDCVNGDLRSVHGLDLSTQSRQFSPTGFMTSTSGNSFAQPRLSQQRRLSMVRLLSTREDELVLQNLIEKTVESEEDMLQLLELGEKRRSTGATRLNTNSSRSHMLLLLRVTGEHTVNKTQSRGTLILADLAGSENVGKSGSVGRRFQEATCINKSLSCLARVFDSLRKRLKPAYRETKLTYLLKPTLGGDAKCLVLVNVRSEPENLDETLRAIQFGQGALQVAPWKS 367          
BLAST of Kinesin protein vs. TrEMBL
Match: A0A3P6NF00 (Kinesin motor domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS1416 PE=3 SV=1)

HSP 1 Score: 350.517 bits (898), Expect = 5.842e-110
Identity = 176/335 (52.54%), Postives = 220/335 (65.67%), Query Frame = 2
Query: 1358 KCFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLLNICDTRMQWKYRLFLSMVEIYQEDVRDILA----DKTSAS-------------------------------------------------VKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQKPSYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFGINAMQVAPEKA 2203
            KCFIFD+VFGP + Q  V+  VD+ I SCVDG+NVCIMAYGQTGSGKTHTM+G+ Q+PGVNRRAI RLL +  +R  W Y+L +SM+E+YQE+V D+L     DK S                                                   V+++S ++DE++LQ L E  V+ E D+ +  + GEK R+  +T LN  SSRSH+++LL+V GE+ ++ T S GTL L DLAGSENV KSG+ G RF EATCINKSL+ L RVFDSLR   KP+YRETKLTYLLKPTLGGD+KCL+ VNVR EPEN +ETLRAI FG  A+QVAP K+
Sbjct:   33 KCFIFDKVFGPDAQQQAVYREVDDSIISCVDGFNVCIMAYGQTGSGKTHTMVGSAQDPGVNRRAIKRLLQLSKSRKHWTYQLSMSMLEVYQEEVFDLLVGGAVDKPSGGDCVNGDLRSVHGLDLSTQSRQFSPTGFMTSTSGNSFAQPRLSQQRRLSMVRLLSTREDELVLQNLIEKTVESEEDMLQLLELGEKRRSTGATRLNTNSSRSHMLLLLRVTGEHTVNKTQSRGTLILADLAGSENVGKSGSVGRRFQEATCINKSLSCLARVFDSLRKRLKPAYRETKLTYLLKPTLGGDAKCLVLVNVRSEPENLDETLRAIQFGQGALQVAPWKS 367          
BLAST of Kinesin protein vs. TrEMBL
Match: A0A4S2M1T2 (Kinesin motor domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003343 PE=3 SV=1)

HSP 1 Score: 363.999 bits (933), Expect = 2.798e-107
Identity = 269/707 (38.05%), Postives = 363/707 (51.34%), Query Frame = 2
Query:  620 KLWKKHYCTLLDAFDIVYKDCQLL--------------------------NKLRNSKTEYDKITL---TIMNKSLFNE--FQVVFGKYLQRCELKNIIQNTNIGFNMSTAFLIDVIAQCRIFRGELERLTATKDRLFYILKTAKDQRSKLKSYVSNLRNDLRCLLAKMKLIQK----------------------------------NEVNEVVCTTISKTID---PISGVLTQNEKQ---------DFQXXXXXXXXXXXXXXXXXXXXHNKLQELIGNIRVYCRIRPQ------------P-RTFLKITSEDKLIIVGDCL----PEKITKHW----------------------YGK---ASKCFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLLNICDTRMQWKYRLFLSMVEIYQEDVRDILAD--KTSASVKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEK----NRTVASTL-------------LNITSSRSHLIVL-----LKVYGE-------------------------NRIHL--------------TTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQKPSYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFGINAMQVAP 2194
            +LWK+ Y +LL+A D+VYKD QLL                          +KL   +T      L        S  +E   Q++    +Q    +++ +     F +S  FL DVIAQ RI R +L+R  A +DRL Y+L+ A++QRS LK Y    R  L  L  K++++++                                  +E+   +   I  + D   P+   L  N++Q         + Q++I  LER+LKEEE RRK+LHN++QEL GNIRV+CR+RP+            P + +L+++S+DKL+   + L    P +    W                      Y     + KCFIFDR FGP S Q +V++ VD+LI SC+DGYNVCIMAYGQTGSGKT+TMMGT   PGVNRRAI  L   C+ R QW Y +++SMVEIYQEDV D+L D  + + S    S Q      Q  +  + +  +D  K+     +    NR  +STL             + I S+    +VL      +V+ E                         +R HL              TTS G+LTL DLAGSENVTKSG+TGERF EA CINKSL++LGRVFD+LR  QKP+YRETKLTYLL+P LGG+SKCLLFV +R EPE+AEET RAI+FG  A+QV P
Sbjct:  368 QLWKRRYHSLLNAIDLVYKDHQLLYYVSREGLFECVSTAPAIPAIPFPRGSKLPTPQTLPSHTQLCNGAADPASQLSERVTQLLIRMGIQETRREDLHRLWPCSFLISVGFLSDVIAQRRILRTDLDRRLALRDRLLYVLRQAREQRSMLKQYAVKQRELLTTLTDKLEVVRRRHYPVSPIQDQPSSIDDGLVNNIDSPFVDCGNVESEMTNRISLPIENSSDISEPVKTELDSNDQQGVNYRHRHSELQQQIAILERVLKEEETRRKRLHNRIQELTGNIRVFCRLRPEDSELPGNGDSTNPLKPYLRVSSDDKLLFCSETLRELLPTQSRAPWSKTGCAARTLPNTAVTATPSGIYANMVGSPKCFIFDRAFGPSSTQDDVYQEVDDLIISCIDGYNVCIMAYGQTGSGKTYTMMGTPDNPGVNRRAIRSLFERCNKRKQWAYSIWMSMVEIYQEDVFDLLGDALQKTKSAGSESKQLSPSRTQSTSREQQQVNSDTDKWKQSTPRSSWANRPSSSTLGFSSGRPVRRRGSVRIMSNNLDGVVLQNLLEREVHNEEETFHYLELAEKQRRVGATRLNICSSRSHLVILLKINGENKFHLTTSRGSLTLADLAGSENVTKSGSTGERFIEAACINKSLSSLGRVFDALRRQQKPAYRETKLTYLLRPNLGGESKCLLFVALRTEPEHAEETWRAINFGQGALQVVP 1074          
BLAST of Kinesin protein vs. TrEMBL
Match: S4RZ05 (Kinesin motor domain-containing protein OS=Petromyzon marinus OX=7757 PE=3 SV=1)

HSP 1 Score: 291.197 bits (744), Expect = 1.234e-87
Identity = 162/342 (47.37%), Postives = 211/342 (61.70%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIRPQPRTFLKITSEDKLIIVGDCLP---EKITKHWYGKASKCFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLLNICDTRMQWKYRLFLSMVEIYQEDVRDILADKTSASVKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQ-KPSYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFGINAMQVAPEKAQQR 2212
            H++L EL GNIRV+CR RP         + D  +   +  P   E +     GK +  F FD+VF P + Q +VF     LITSCVDGYNVCI+AYGQTGSGKTHTMMGT   PGVN R++  LLNIC  R   KY L +SM+EIY E VRD+L    S  +++   Q   + + GLT   V  E DI +  +   K+RTVAST +NI SSRSHL+  L + G + +  + S G+L L DLAGSE ++++ ATG+R  EA  INKSLT+LG+VF +LRN      YR +KLT+LL+P LGG++K  +FV V  +  N  ETL  + FG +  QVA   A QR
Sbjct:   53 HDQLTELRGNIRVFCRGRPG--------APDGGVPGLEFSPSAGEVLVMQSEGKTTS-FAFDQVFPPNATQEQVFADTLPLITSCVDGYNVCILAYGQTGSGKTHTMMGTSNAPGVNVRSVKELLNICKERHNVKYTLKISMLEIYNETVRDLLGKPGSGPLEV-RGQARSVTVPGLTTTIVTSEEDIVRVMETAHKHRTVASTKMNIHSSRSHLLTTLSLEGLDVVSGSASHGSLILGDLAGSERISRTEATGQRLVEAAAINKSLTSLGQVFLALRNGSLHVPYRNSKLTHLLQPALGGNAKACVFVTVSADDANRGETLSTLQFGSSIRQVALGAAAQR 384          
BLAST of Kinesin protein vs. TrEMBL
Match: T1G4Y9 (Kinesin-like protein OS=Helobdella robusta OX=6412 GN=20216137 PE=3 SV=1)

HSP 1 Score: 290.426 bits (742), Expect = 1.490e-87
Identity = 162/338 (47.93%), Postives = 218/338 (64.50%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIRPQPRTFLKITSEDKLIIVGDCLPEKITKHWYGKASKCFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLLNICDTRMQWKYRLFLSMVEIYQEDVRDILADKTSASVKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQ-KPSYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFGINAMQVAPEKAQQ 2209
            +N+LQEL GNIRV+ R R   R      S+  L  +GD       +     + K F FD+VF PKS Q EV+E    +I SCVDGYNVCI+AYGQTGSGKT TM G   +PGVN R++  LLN+C+ R    Y L  SM+EIY E V D+L+D T   +++ + Q  +I++ GL E +VK   DI +    G KNR+VA+T +N  SSRSHLI ++ V G+++     S GTLTLCDLAGSE V+K+ ATG+R  EA  INKSL++LG+VF +L+  Q    YR +KLT++L+P+LGGD+K  LFV V  + EN  ET+  + FG NA QV   +A++
Sbjct:   36 YNELQELRGNIRVFLRCRYDSR------SQCCLKFLGD------NEVLAPNSKKPFTFDKVFSPKSSQEEVYEDARAVIMSCVDGYNVCILAYGQTGSGKTFTMQGPANDPGVNVRSLKELLNVCEQRENVTYNLKASMIEIYNETVHDLLSD-TVNPLEVRA-QGTKIVMPGLIEMQVKSLQDIDQIMKLGSKNRSVAATKMNSQSSRSHLIFMVTVEGQDKTTGACSTGTLTLCDLAGSERVSKTEATGQRLVEAAAINKSLSSLGQVFTALKTGQLHVPYRNSKLTHILQPSLGGDAKACLFVMVSPDIENLSETVSTMQFGSNAQQVQLGQAKK 359          
BLAST of Kinesin protein vs. Ensembl Cavefish
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:103041085])

HSP 1 Score: 256.144 bits (653), Expect = 2.961e-73
Identity = 141/354 (39.83%), Postives = 206/354 (58.19%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIRP--------QPRTFLKITSEDKLIIVGDCLPEKITKHWYGKASKCFIF--DRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLLN-ICDTRMQWKYRLFLSMVEIYQEDVRDILADKTSA--SVKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRN-HQKPSYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFG--INAMQVAPEKAQQR 2212
            HN+L  L GNIRV+CR+RP          +T +   S+D  ++            +     K   F  D+VF P+  Q EVF+ V  L+TSC+DG+NVCI AYGQTGSGKT+TM G  ++PG+N+RA+  L + + + +  W Y + +SMVEIY E +R++L D  S    +K+  +   ++ + GLTE  V+   DI + F+ G  NR  A T LN  SSRSH ++++ V G N      + G L L DLAGSE + KSGA G R  EA CINKSL+ LG V ++LR+ H    +R ++LTYLL+ +L GDSK L+ V V     N  E++ ++ F   +  +++ P  + +R
Sbjct:  430 HNELVRLKGNIRVFCRVRPVCQDEAESDSKTMVSFDSDDDAVL------------YLSNKGKLMTFELDKVFPPQITQDEVFQEVQSLVTSCIDGFNVCIFAYGQTGSGKTYTMEGVPEDPGINQRALRLLFSEVSEKKPDWDYNITVSMVEIYNETLRNLLGDNPSEKLDIKMCPDGSGQLYVPGLTEFSVESVEDINRVFELGHMNRATACTNLNEHSSRSHALLIITVAGFNSSTGHRTSGKLNLVDLAGSERIAKSGAEGSRLREAQCINKSLSALGDVINALRSRHSHVPFRNSRLTYLLQDSLSGDSKTLMVVQVSPLESNISESVCSLKFAQRVRTVELGPSSSSRR 771          
BLAST of Kinesin protein vs. Ensembl Cavefish
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:103041085])

HSP 1 Score: 256.144 bits (653), Expect = 5.943e-73
Identity = 143/355 (40.28%), Postives = 207/355 (58.31%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIRP--------QPRTFLKITSEDKLIIVGDCLPEKITKHWYGKASKCFIF--DRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLL--NICDTRMQWKYRLFLSMVEIYQEDVRDILADKTSA--SVKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRN-HQKPSYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFG--INAMQVAPEKAQQR 2212
            HN+L  L GNIRV+CR+RP          +T +   S+D  ++            +     K   F  D+VF P+  Q EVF+ V  L+TSC+DG+NVCI AYGQTGSGKT+TM G  ++PG+N+RA+ RLL   + + +  W Y + +SMVEIY E +R++L D  S    +K+  +   ++ + GLTE  V+   DI + F+ G  NR  A T LN  SSRSH ++++ V G N      + G L L DLAGSE + KSGA G R  EA CINKSL+ LG V ++LR+ H    +R ++LTYLL+ +L GDSK L+ V V     N  E++ ++ F   +  +++ P  + +R
Sbjct:  490 HNELVRLKGNIRVFCRVRPVCQDEAESDSKTMVSFDSDDDAVL------------YLSNKGKLMTFELDKVFPPQITQDEVFQEVQSLVTSCIDGFNVCIFAYGQTGSGKTYTMEGVPEDPGINQRAL-RLLFSEVSEKKPDWDYNITVSMVEIYNETLRNLLGDNPSEKLDIKMCPDGSGQLYVPGLTEFSVESVEDINRVFELGHMNRATACTNLNEHSSRSHALLIITVAGFNSSTGHRTSGKLNLVDLAGSERIAKSGAEGSRLREAQCINKSLSALGDVINALRSRHSHVPFRNSRLTYLLQDSLSGDSKTLMVVQVSPLESNISESVCSLKFAQRVRTVELGPSSSSRR 831          
BLAST of Kinesin protein vs. Ensembl Cavefish
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:103041085])

HSP 1 Score: 255.373 bits (651), Expect = 8.295e-72
Identity = 143/355 (40.28%), Postives = 207/355 (58.31%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIRP--------QPRTFLKITSEDKLIIVGDCLPEKITKHWYGKASKCFIF--DRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLL--NICDTRMQWKYRLFLSMVEIYQEDVRDILADKTSA--SVKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRN-HQKPSYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFG--INAMQVAPEKAQQR 2212
            HN+L  L GNIRV+CR+RP          +T +   S+D  ++            +     K   F  D+VF P+  Q EVF+ V  L+TSC+DG+NVCI AYGQTGSGKT+TM G  ++PG+N+RA+ RLL   + + +  W Y + +SMVEIY E +R++L D  S    +K+  +   ++ + GLTE  V+   DI + F+ G  NR  A T LN  SSRSH ++++ V G N      + G L L DLAGSE + KSGA G R  EA CINKSL+ LG V ++LR+ H    +R ++LTYLL+ +L GDSK L+ V V     N  E++ ++ F   +  +++ P  + +R
Sbjct:  663 HNELVRLKGNIRVFCRVRPVCQDEAESDSKTMVSFDSDDDAVL------------YLSNKGKLMTFELDKVFPPQITQDEVFQEVQSLVTSCIDGFNVCIFAYGQTGSGKTYTMEGVPEDPGINQRAL-RLLFSEVSEKKPDWDYNITVSMVEIYNETLRNLLGDNPSEKLDIKMCPDGSGQLYVPGLTEFSVESVEDINRVFELGHMNRATACTNLNEHSSRSHALLIITVAGFNSSTGHRTSGKLNLVDLAGSERIAKSGAEGSRLREAQCINKSLSALGDVINALRSRHSHVPFRNSRLTYLLQDSLSGDSKTLMVVQVSPLESNISESVCSLKFAQRVRTVELGPSSSSRR 1004          
BLAST of Kinesin protein vs. Ensembl Cavefish
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:103041085])

HSP 1 Score: 255.373 bits (651), Expect = 9.348e-72
Identity = 143/355 (40.28%), Postives = 207/355 (58.31%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIRP--------QPRTFLKITSEDKLIIVGDCLPEKITKHWYGKASKCFIF--DRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLL--NICDTRMQWKYRLFLSMVEIYQEDVRDILADKTSA--SVKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRN-HQKPSYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFG--INAMQVAPEKAQQR 2212
            HN+L  L GNIRV+CR+RP          +T +   S+D  ++            +     K   F  D+VF P+  Q EVF+ V  L+TSC+DG+NVCI AYGQTGSGKT+TM G  ++PG+N+RA+ RLL   + + +  W Y + +SMVEIY E +R++L D  S    +K+  +   ++ + GLTE  V+   DI + F+ G  NR  A T LN  SSRSH ++++ V G N      + G L L DLAGSE + KSGA G R  EA CINKSL+ LG V ++LR+ H    +R ++LTYLL+ +L GDSK L+ V V     N  E++ ++ F   +  +++ P  + +R
Sbjct:  675 HNELVRLKGNIRVFCRVRPVCQDEAESDSKTMVSFDSDDDAVL------------YLSNKGKLMTFELDKVFPPQITQDEVFQEVQSLVTSCIDGFNVCIFAYGQTGSGKTYTMEGVPEDPGINQRAL-RLLFSEVSEKKPDWDYNITVSMVEIYNETLRNLLGDNPSEKLDIKMCPDGSGQLYVPGLTEFSVESVEDINRVFELGHMNRATACTNLNEHSSRSHALLIITVAGFNSSTGHRTSGKLNLVDLAGSERIAKSGAEGSRLREAQCINKSLSALGDVINALRSRHSHVPFRNSRLTYLLQDSLSGDSKTLMVVQVSPLESNISESVCSLKFAQRVRTVELGPSSSSRR 1016          
BLAST of Kinesin protein vs. Ensembl Cavefish
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:103041085])

HSP 1 Score: 254.988 bits (650), Expect = 1.005e-71
Identity = 141/354 (39.83%), Postives = 206/354 (58.19%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIRP--------QPRTFLKITSEDKLIIVGDCLPEKITKHWYGKASKCFIF--DRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLLN-ICDTRMQWKYRLFLSMVEIYQEDVRDILADKTSA--SVKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRN-HQKPSYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFG--INAMQVAPEKAQQR 2212
            HN+L  L GNIRV+CR+RP          +T +   S+D  ++            +     K   F  D+VF P+  Q EVF+ V  L+TSC+DG+NVCI AYGQTGSGKT+TM G  ++PG+N+RA+  L + + + +  W Y + +SMVEIY E +R++L D  S    +K+  +   ++ + GLTE  V+   DI + F+ G  NR  A T LN  SSRSH ++++ V G N      + G L L DLAGSE + KSGA G R  EA CINKSL+ LG V ++LR+ H    +R ++LTYLL+ +L GDSK L+ V V     N  E++ ++ F   +  +++ P  + +R
Sbjct:  675 HNELVRLKGNIRVFCRVRPVCQDEAESDSKTMVSFDSDDDAVL------------YLSNKGKLMTFELDKVFPPQITQDEVFQEVQSLVTSCIDGFNVCIFAYGQTGSGKTYTMEGVPEDPGINQRALRLLFSEVSEKKPDWDYNITVSMVEIYNETLRNLLGDNPSEKLDIKMCPDGSGQLYVPGLTEFSVESVEDINRVFELGHMNRATACTNLNEHSSRSHALLIITVAGFNSSTGHRTSGKLNLVDLAGSERIAKSGAEGSRLREAQCINKSLSALGDVINALRSRHSHVPFRNSRLTYLLQDSLSGDSKTLMVVQVSPLESNISESVCSLKFAQRVRTVELGPSSSSRR 1016          
BLAST of Kinesin protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010492.1 (pep scaffold:Pmarinus_7.0:GL478879:14589:34633:-1 gene:ENSPMAG00000009502.1 transcript:ENSPMAT00000010492.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 291.197 bits (744), Expect = 9.481e-92
Identity = 162/342 (47.37%), Postives = 211/342 (61.70%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIRPQPRTFLKITSEDKLIIVGDCLP---EKITKHWYGKASKCFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLLNICDTRMQWKYRLFLSMVEIYQEDVRDILADKTSASVKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQ-KPSYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFGINAMQVAPEKAQQR 2212
            H++L EL GNIRV+CR RP         + D  +   +  P   E +     GK +  F FD+VF P + Q +VF     LITSCVDGYNVCI+AYGQTGSGKTHTMMGT   PGVN R++  LLNIC  R   KY L +SM+EIY E VRD+L    S  +++   Q   + + GLT   V  E DI +  +   K+RTVAST +NI SSRSHL+  L + G + +  + S G+L L DLAGSE ++++ ATG+R  EA  INKSLT+LG+VF +LRN      YR +KLT+LL+P LGG++K  +FV V  +  N  ETL  + FG +  QVA   A QR
Sbjct:   53 HDQLTELRGNIRVFCRGRPG--------APDGGVPGLEFSPSAGEVLVMQSEGKTTS-FAFDQVFPPNATQEQVFADTLPLITSCVDGYNVCILAYGQTGSGKTHTMMGTSNAPGVNVRSVKELLNICKERHNVKYTLKISMLEIYNETVRDLLGKPGSGPLEV-RGQARSVTVPGLTTTIVTSEEDIVRVMETAHKHRTVASTKMNIHSSRSHLLTTLSLEGLDVVSGSASHGSLILGDLAGSERISRTEATGQRLVEAAAINKSLTSLGQVFLALRNGSLHVPYRNSKLTHLLQPALGGNAKACVFVTVSADDANRGETLSTLQFGSSIRQVALGAAAQR 384          
BLAST of Kinesin protein vs. Ensembl Sea Lamprey
Match: kifc3 (kinesin family member C3 [Source:ZFIN;Acc:ZDB-GENE-030131-3724])

HSP 1 Score: 243.047 bits (619), Expect = 4.432e-73
Identity = 140/354 (39.55%), Postives = 199/354 (56.21%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIRPQ---------PRTFLKITSEDKLIIVGDCLPEKITKHWYGKASKCFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTM---MGTVQEPGVNRRAIYRLLNICDTRM-QWKYRLFLSMVEIYQEDVRDILADKTSA--SVKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQKP-SYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFGINAMQVAPEKAQQR 2212
            HN+L EL GNIRV CR+RP            + +++ +ED   +    + ++  +H        F  DRVF P + Q EVF  V +L+TSCVDGYN+CI AYGQTGSGKT+TM    GT + PG+N+RA+  L    + R  +W+Y L LSM+EIY E +RD+L  +      +++  +   E+ + GL +  V    D+ +    G  NR    T +N  SSRSH ++L+ V   N I  T++ G L L DLAGSE + KS A G+R  EA  IN+SL  LG V  +LR  Q    +R +KLTYLL+ +L  +SK L+ + V     +A ET+ ++HF   A  V    A +R
Sbjct:   73 HNQLVELRGNIRVLCRVRPAIEEDGEGTLAHSVVQVDTEDDGAV---HVAQRGRQH-------SFQLDRVFPPHASQEEVFREVQDLVTSCVDGYNICIFAYGQTGSGKTYTMERAQGTAKAPGINQRALQHLFQEMEERQDEWRYTLSLSMLEIYNETLRDLLGSEGHGRLDIRLCPDGSGELCVPGLRQEPVTSLGDVHRLVSLGHSNRATHCTNMNEHSSRSHALILVTVSATNSITGTSTRGRLNLVDLAGSERLAKSRAEGDRLREAQNINRSLAALGDVIQALRAKQAHVPFRNSKLTYLLQDSLARESKTLMVIQVAPAARHAAETICSLHFAQRARAVELGPATRR 416          
BLAST of Kinesin protein vs. Ensembl Sea Lamprey
Match: kif3a (kinesin family member 3A [Source:ZFIN;Acc:ZDB-GENE-050417-71])

HSP 1 Score: 163.31 bits (412), Expect = 2.753e-42
Identity = 103/290 (35.52%), Postives = 161/290 (55.52%), Query Frame = 2
Query: 1349 KASKCFIFDRVFGPKSDQIEVFE-AVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEP---GVNRRAIYRLL-NICDTRMQWKYRLFLSMVEIYQEDVRDILADKTSASVKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVY-GENRI--HLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQKP--SYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFGINAMQV 2188
            +  K F FD VFG +S Q++V+      ++ S ++GYN  I AYGQTG+GKT TM G    P   G+   +   +  +I       ++ + +S +EIY E+V+D+L    +  +++    D  + ++ L+   V   +D+ +    G KNR+V ST +N  SSRSH I  + +   E  +  ++   MG L L DLAGSE  TK+GATG+R  EAT IN SL+TLG V  +L + +     YR +KLT LL+ +LGG+SK ++  N+     N +ET+  + +   A  +
Sbjct:   57 EPPKTFTFDTVFGTESKQVDVYNLTARPIVDSVLEGYNGTIFAYGQTGTGKTFTMEGIRAVPELRGIIPNSFAHIFGHIAKAEGDTRFLVRVSYLEIYNEEVKDLLGKDQTQRLEVKERPDVGVYVKDLSAFVVNNADDMDRIMTLGHKNRSVGSTNMNEHSSRSHAIFTITIECSEKGVDGNMHVRMGKLHLVDLAGSERQTKTGATGQRLKEATKINLSLSTLGNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNI 346          
BLAST of Kinesin protein vs. Ensembl Sea Lamprey
Match: kif3ca (kinesin family member 3Ca [Source:ZFIN;Acc:ZDB-GENE-111214-2])

HSP 1 Score: 161.384 bits (407), Expect = 3.131e-42
Identity = 112/339 (33.04%), Postives = 179/339 (52.80%), Query Frame = 2
Query: 1229 IRVYCRIRP-QPRTFLKITSEDKLIIVGDCLPEKITKHWYGKA--SKCFIFDRVFGPKSDQIEVFE-AVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAI------YRLLNICDTRMQWKYRLFLSMVEIYQEDVRDILADKTSASVKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVY-------GENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQKP--SYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFGINAMQV 2188
            +RV  R RP  PR      S + +I +     +   ++    A  ++ F FD V+G  + Q++++E +   L+ S + G+N  I AYGQTG+GKT+TM G   +P   RR +      +   +I  ++ Q    +  S +EIYQE++RD+L+   S  +++    D  I ++ L+    K   +I      G +NR+V +T +N  SSRSH I ++ V        GE+ I +    G L L DLAGSE   K+GA GER  EAT IN SL+ LG V  +L + +     YR++KLT LL+ +LGG+++ ++  NV     N +E+L  + +   A  +
Sbjct:   20 VRVVVRCRPMNPRE--SAASYESVITIDVRAGQVAIRNPRANADPARTFTFDAVYGGDAKQLDIYEESFRPLVDSVLCGFNGTIFAYGQTGTGKTYTMEGVRSDP--ERRGVIPNSFEHIFTHISRSQNQPVPEVRASYLEIYQEEIRDLLSRDQSRRLELRERPDTGIHVKDLSSFVTKSAREIEHVMGIGNQNRSVGATNMNEHSSRSHAIFVITVECSELGADGESHIRV----GKLNLVDLAGSERQAKTGAQGERLKEATKINLSLSALGNVISALVDGKSTHVPYRDSKLTRLLQDSLGGNARTVMVANVGPASYNYDESLTTLRYANRAKNI 350          
BLAST of Kinesin protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001811.1 (pep scaffold:Pmarinus_7.0:GL477555:33781:61877:1 gene:ENSPMAG00000001600.1 transcript:ENSPMAT00000001811.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 164.081 bits (414), Expect = 4.731e-42
Identity = 118/337 (35.01%), Postives = 174/337 (51.63%), Query Frame = 2
Query: 1226 NIRVYCRIRP--------QPRTFLKITSEDKLIIVGDCLPEKITKHWYGKASKCFIFDRVFGPKSDQIEVFEAVDELITSCV-DGYNVCIMAYGQTGSGKTHTMMGTVQEP---GVNRRAIYRLLN-ICDTRMQWKYRLFLSMVEIYQEDVRDILADKTSASVKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSL----RNHQKPSYRETKLTYLLKPTLGGDSKCLLFVNVRCEPE--NAEETLRAIHFGINA 2179
            NI+V CR+RP          +   K    D +I+                ++K +++D VF P++ Q +V+ A    IT  V +GYN  I AYGQT SGKTHTM G + +P   GV  R +  + + I       ++ + +S  EIY + +RD+L D +  ++ +  +++    ++G TE  V    ++    D+G+ NR VA T +N  SSRSH I L+ V  EN        G L L DLAGSE V+K+GA G   +EA  INKSL+ LG V  +L    R H    YR++K+T +L+ +LGG+  C   V + C P   N  ET   + FG  A
Sbjct:    8 NIKVMCRVRPINNSEEARGDKFIAKFQGNDTVIV----------------SNKPYVYDGVFHPETTQEQVYNACARQITKDVLEGYNGTIFAYGQTASGKTHTMEGVLHDPEHMGVIPRIVKDIFHYIYSMDENLEFHIKVSYFEIYLDKIRDLL-DVSKTNLSVHEDKNRVPYVKGCTERFVSSPEEVMDVIDEGKANRHVAVTNMNEHSSRSHSIFLINVKQENVETEQKLSGKLYLVDLAGSEKVSKTGAEGSVLDEAKNINKSLSALGNVIAALAEGTRTH--VPYRDSKMTRILQDSLGGN--CRTTVIICCSPSIYNEAETKSTLLFGQRA 323          
BLAST of Kinesin protein vs. Ensembl Yeast
Match: KAR3 (Minus-end-directed microtubule motor; functions in mitosis and meiosis, localizes to the spindle pole body and localization is dependent on functional Cik1p, required for nuclear fusion during mating; potential Cdc28p substrate [Source:SGD;Acc:S000006345])

HSP 1 Score: 192.2 bits (487), Expect = 3.492e-52
Identity = 134/362 (37.02%), Postives = 187/362 (51.66%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIRPQPRTFLKITSEDKLIIVGD------CLPEKITKHWYGKASKCFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPG-----VNRRAIYRLLNICDTRMQWKYRLFLSMVEIYQEDVRDIL------ADKTSASVKIMSNQDDEIMLQGLTEH---EVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVF------DSLRNHQKPSYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFG--INAMQVAPEK 2200
            HN+LQEL GNIRVYCRIRP  +      S+  LI V +          ++TK         F FD++F  +   ++VF+ V +L+ S +DGYNVCI AYGQTGSGKT TM+     PG          I+  +N   T+  W Y++    +EIY E++ D+L       + TS  +K     D E     +T     +++ E  +     K  K R+ AST  N  SSRSH I ++ + G N      S GTL L DLAGSE +  S   G+R  E   INKSL+ LG V       DS + H    +R +KLTYLL+ +L GDSK L+FVN+     +  ETL ++ F   +N+ ++   K
Sbjct:  377 HNELQELRGNIRVYCRIRPALKNLE--NSDTSLINVNEFDDNSGVQSMEVTKIQNTAQVHEFKFDKIFDQQDTNVDVFKEVGQLVQSSLDGYNVCIFAYGQTGSGKTFTMLN----PGDGIIPSTISHIFNWINKLKTK-GWDYKVNCEFIEIYNENIVDLLRSDNNNKEDTSIGLKHEIRHDQETKTTTITNVTSCKLESEEMVEIILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNAKTGAHSYGTLNLVDLAGSERINVSQVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRH--IPFRNSKLTYLLQYSLTGDSKTLMFVNISPSSSHINETLNSLRFASKVNSTRLVSRK 729          
BLAST of Kinesin protein vs. Ensembl Yeast
Match: KIP3 (Kinesin-related antiparallel sliding motor protein; involved in mitotic spindle positioning; sliding activity promotes bipolar spindle assembly and maintenance of genome stability; inhibits spindle elongation, destabilizing late anaphase spindle microtubules that polymerize beyond the midzone [Source:SGD;Acc:S000003184])

HSP 1 Score: 154.451 bits (389), Expect = 2.210e-39
Identity = 98/287 (34.15%), Postives = 156/287 (54.36%), Query Frame = 2
Query: 1364 FIFDRVFGPKSDQIEVF-EAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLLN-ICDTRMQWKYRLFLSMVEIYQEDVRDILADKT-SASVKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENR-IHLTT--SMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSL------RNHQKPSYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFGINAMQV 2188
            F+FD++F   S Q  V+ E    L+ S +DG+N  + AYG TG GKT+T+ GT  +PG+   A+  L N I D + +  + + LS +EIY E +RD+L  +T S  + I  +  + I +  L+ H      D+     +G  NRT + T  N  SSRSH ++ + +   N+ + LT+  +  TL++ DLAGSE    +   G R +E   IN+SL  LG   ++L      R+   P YR++KLT LLK +LGG+ K ++ V +     + +ETL  + +   A ++
Sbjct:  153 FVFDKLFDETSSQARVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGTPSQPGIIFLAMEELFNKITDLKDEKDFEISLSYLEIYNERIRDLLKPETPSKRLVIREDTQNHIKVANLSYHHPNTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNKLVDLTSQHTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDGSRSCHIP-YRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEI 438          
BLAST of Kinesin protein vs. Ensembl Yeast
Match: KIP1 (Kinesin-related motor protein; required for mitotic spindle assembly, chromosome segregation, and 2 micron plasmid partitioning; functionally redundant with Cin8p for chromosomal but not plasmid functions [Source:SGD;Acc:S000000159])

HSP 1 Score: 154.836 bits (390), Expect = 3.238e-39
Identity = 117/375 (31.20%), Postives = 183/375 (48.80%), Query Frame = 2
Query: 1223 GNIRVYCRIRPQPRTFLKITSEDKLIIVGDCLPEKI----TKHWYGKASKCFIFDRVFGPKSDQIEVFEA-VDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTV---------------QEPGVNRRAIYRLLNICDTRMQWKYRLFLSMVEIYQEDVRDI---------LADKTSASVKIMSNQDD--EIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLL---------KVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQKP-SYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFGINAMQV--APEKAQQRSK 2218
             NI VY R R + +  ++  S   +  +G    E I    +   Y  + K + FD+VFG +SDQ  VF A     I   + GYN  I AYGQTG+GKT+TM G +               +  G+  R +  L     + +  +Y + +S +E+Y E+++D+           +     ++I  N ++   IM++G+ E  +   ++      +G   R VA+T  N  SSRSH +  +         K +G+N+  +   +G L L DLAGSEN+ +SGA  +R  EA  INKSL TLGRV ++L +H     YRE+KLT LL+ +LGG +K  +   +     + EET   + +   A  +   P+  Q  SK
Sbjct:   51 SNIHVYVRCRSRNKREIEEKSSVVISTLGPQGKEIILSNGSHQSYSSSKKTYQFDQVFGAESDQETVFNATAKNYIKEMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDNLLLGEHAGIIPRVLVDLFKELSS-LNKEYSVKISFLELYNENLKDLLSDSEDDDPAVNDPKRQIRIFDNNNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQDSKDHGQNKNFV--KIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSNHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTPQVNQSLSK 422          
BLAST of Kinesin protein vs. Ensembl Yeast
Match: KIP2 (Kinesin-related motor protein involved in mitotic spindle positioning; stabilizes microtubules by targeting Bik1p to the plus end; functions as a microtubule polymerase and catastrophe inhibitor in vitro; Kip2p levels are controlled during the cell cycle [Source:SGD;Acc:S000006076])

HSP 1 Score: 138.658 bits (348), Expect = 1.997e-34
Identity = 118/393 (30.03%), Postives = 167/393 (42.49%), Query Frame = 2
Query: 1247 IRPQPRTFLKITSEDKLIIVGD--CLPEKITKH---------WYGKASKC--------FIFDRVFGPKSDQIEVFEAVDE-LITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAI-YRLLNICDTRMQW--KYRLFLSMVEIYQEDVRDIL-----------------------ADKTSASVKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSL----------------------------RNHQKPS----YRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFGINAMQVA 2191
            IRP+PR+    TS D + +       P   + H         W+    K         F FD VF      +EV+E   + +I   + G+N  I AYG TGSGKT TM G  QE G+   ++ Y   NI +  M    K+ + +S +EIY E + D+L                       ++     +KI  +    + + GLTE   +   ++ ++   G+K+R +  T  N  SSRSH IVL+++   N  + T+   TL+LCDLAGSE  T      ER  E + INKSL  LG V   L                             N   PS    YR++KLT LL+P L GDS       V    + A ET+  + F   A  VA
Sbjct:  107 IRPKPRSVG--TSRDHVGLKSPRYSQPRSNSHHGSNTFVRDPWFITNDKTIVHEEIGEFKFDHVFASHCTNLEVYERTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQELGLIPLSVSYLFTNIMEQSMNGDKKFDVIISYLEIYNERIYDLLESGLEESGSRISTPSRLYMSKSNSNGLGVELKIRDDSQYGVKVIGLTERRCESSEELLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTSTNVKNGTSRSSTLSLCDLAGSERAT---GQQERRKEGSFINKSLLALGTVISKLSADKMNSVGSNIPSPSASGSSSSSGNATNNGTSPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRNDAAAETMNTLRFASRAKNVA 494          
BLAST of Kinesin protein vs. Ensembl Yeast
Match: CIN8 (Kinesin motor protein; involved in mitotic spindle assembly and chromosome segregation [Source:SGD;Acc:S000000787])

HSP 1 Score: 100.523 bits (249), Expect = 3.227e-22
Identity = 63/170 (37.06%), Postives = 97/170 (57.06%), Query Frame = 2
Query: 1685 SNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSL--RNHQKPSYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFGINAMQV 2188
            ++Q + I +Q L E  +    +      KG K+R VAST +N  SSRSH I  + +Y +++  L   +  + L DLAGSEN+ +SGA  +R  EA  IN+SL TLGRV ++L  ++   P +RE+KLT LL+ +LGG++K  L   +      +EET   + +   A  +
Sbjct:  310 NDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELF-RISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIP-FRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNI 477          

HSP 2 Score: 61.2326 bits (147), Expect = 4.550e-10
Identity = 34/115 (29.57%), Postives = 60/115 (52.17%), Query Frame = 2
Query: 1355 SKCFIFDRVFGPKSDQIEVF-EAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQ--------EPGVNRRAIYRLLNICDTRMQWKYRLFLSMVEIYQEDVRDILADKTSAS 1672
            +K +  D+VFGP + Q  +F E    L    + GYN  ++ YG T +GKT+TM G  +          G+  R + +L +  + + Q  Y +  S +E+Y E+++D+L   ++ S
Sbjct:   86 AKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQ-QNDYVVKCSFIELYNEELKDLLDSNSNGS 199          
BLAST of Kinesin protein vs. Ensembl Nematostella
Match: EDO31606 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXF7])

HSP 1 Score: 280.026 bits (715), Expect = 1.389e-82
Identity = 157/342 (45.91%), Postives = 209/342 (61.11%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIRPQPRTFLKIT--SEDKLIIVGDCLPEKITKHWYGKASKCFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLLNICDTRMQWKYRLFLSMVEIYQEDVRDILADKTSASVKIMSNQ--DDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLR-NHQKPSYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFGINAMQVAPEKAQQ 2209
            +NKLQEL GNIRV+CR R  P   + +T  S+ ++  VG                K F+FDRVF P S Q +VFE    LI SCVDGYNVCIMAYGQTG+GKT TMMG    PGVN R+I  LL +C+ R    Y L L+M+E+Y E ++D+L +  S +   +S Q    ++++  LTE +V     I     KG+ NR+V +T +N +SSRSHL+++L + G ++I    +  TLTL DLAGSE ++K+ ATG+R  EA  INKSL+ LG+VF +LR N     YR +KLT LL+ +LGGD K  +FVNV     N  ET+  + FG  A QV   KA Q
Sbjct:  480 YNKLQELRGNIRVFCRCRRDPTVEVAVTFPSDQEIQAVGPS------------GRKTFMFDRVFTPDSTQEQVFEDTLPLIASCVDGYNVCIMAYGQTGAGKTFTMMGPEDNPGVNVRSILELLRVCNERPNVDYTLSLAMLEVYNETLKDLLEEFGSCAGTQLSIQLKGKQVVVPHLTEIQVNSAKAIRTIMAKGDANRSVGATKMNTSSSRSHLVLILHINGVDKISHAITHSTLTLVDLAGSERISKTEATGQRLVEAAAINKSLSALGQVFTALRTNAMHVPYRNSKLTQLLQGSLGGDGKACMFVNVSPAEWNLSETISTLQFGAGAKQVQLGKATQ 809          
BLAST of Kinesin protein vs. Ensembl Nematostella
Match: EDO45950 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRH2])

HSP 1 Score: 258.84 bits (660), Expect = 2.987e-78
Identity = 147/324 (45.37%), Postives = 200/324 (61.73%), Query Frame = 2
Query: 1202 NKLQELIGNIRVYCRIRPQPRTFLKITSEDKLIIVGDCLPEKITKHWYGKASKCFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLL-NICDTRMQWKYRLFLSMVEIYQEDVRDILADKTSASVKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQKP-SYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHF 2167
            N+L EL GNIRVYCR+RP  R        + +I   D   + I   +   A K F  DRVF P+S Q+EVFE V  L+ SCVDGYNVCI AYGQTGSGKT TM G V  PG+N+RA+  L     D  + W Y++ +S++EIY E +RD+L+   SA + I   ++  + + GL+E EV   +++ + F  G++NR  A T +N  SSRSH ++   V G NR     ++G L L DLAGSE V+KSG+ G R  EA  INKSL++LG V  +L+N      YR +KLTYLL+ +LGGDSK L+ V V    +N  ET+ +++F
Sbjct:   81 NELIELKGNIRVYCRVRPVIREDGAGKPAENVISFDDD-DDAILNVFSRGALKPFEMDRVFQPQSTQVEVFEEVKPLVISCVDGYNVCIFAYGQTGSGKTFTMEGPVSNPGINQRALQHLFTETADRGVDWDYQVTVSVMEIYNEMLRDLLSSDPSAKLDIKQGKEG-LYVPGLSEVEVTNLDEVNEIFQLGKQNRATAFTDMNEHSSRSHALLCATVIGVNRTTGARTIGKLNLVDLAGSERVSKSGSEGARMKEAQNINKSLSSLGDVIHNLKNKSAHVPYRNSKLTYLLQESLGGDSKTLMVVQVAPVEKNVGETVCSLNF 402          
BLAST of Kinesin protein vs. Ensembl Nematostella
Match: EDO34961 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMV5])

HSP 1 Score: 235.728 bits (600), Expect = 1.555e-70
Identity = 138/345 (40.00%), Postives = 209/345 (60.58%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIRPQ-P----RTFLKITSEDK---LIIVGDCLPEKITKHWYGKASKCFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMG---TVQEPGVNRRAIYRLLNICDTRMQ---WKYRLFLSMVEIYQEDVRDILA--DKT-SASVKIMSNQDD---EIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQKP-SYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFG 2170
            HN +QEL GNIRV+CR+RP  P    +  + ++ +D+   + I    LPE +     G +   F FD+VF   S Q +VFE + +L+ S +DGYNVCI AYGQTGSGKT+TM G    ++  G+  R++ ++  +   ++Q   WKY++ +S +EIY E +RD+L   D+T    +K+++  +    ++M+  L   EV+ E+ ++       +NR V +T  N  SSRSH + ++K+ GEN I   +  GTL L DLAGSE + +S A+G+R  E   INKSL+TL  V  +L N +    YR +KLTYLLK +LGG+SK L+FVN+    E+ +ETL ++ F 
Sbjct:   29 HNTIQELKGNIRVFCRVRPPLPNEMNKDLVNVSLQDEGRGIAITPSNLPEDVMATKKGVSKYEFSFDKVFQHTSKQAQVFEEISQLVQSALDGYNVCIFAYGQTGSGKTYTMEGDHNNLEHRGMIPRSMEQVF-LNTHKLQEKGWKYKMDVSFLEIYNETIRDLLGSGDETIKHEIKMVNGSNSTNSQVMVTNLKTFEVEDESQVYSLLKTASQNRAVGATACNERSSRSHSVFIMKLTGENSITEESCSGTLNLVDLAGSERLGQSCASGDRLKETKNINKSLSTLSSVIIALANKEGHVPYRNSKLTYLLKNSLGGNSKSLMFVNISPREESLQETLCSLRFA 372          
BLAST of Kinesin protein vs. Ensembl Nematostella
Match: EDO37229 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGE0])

HSP 1 Score: 184.882 bits (468), Expect = 6.469e-53
Identity = 104/255 (40.78%), Postives = 157/255 (61.57%), Query Frame = 2
Query: 1430 LITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQE--PGVNRRA---IYRLLNICDTRMQWKYRLFLSMVEIYQEDVRDIL--ADKTSASVKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQK-PSYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFG 2170
            LI S VDGYNVCI AYGQTGSGKT TM+G      PG+  RA   IY L  I + + ++ +++++ M+E+Y + + D+L  + + SA + I  ++   + +QG    E   + +++  F++G +NR VAST +N  SSRSHLI+ + +   N +      G L+L DLAGSE   K+GAT E+  EA  INKSL+ LG V  +L + Q+   YR  KLT L++ +LGG++K L+FVNV     N +ET+ ++ + 
Sbjct:    1 LIQSAVDGYNVCIFAYGQTGSGKTFTMIGDRDGNFPGIAPRAMDNIYSL--IEENKKKFSFKIYVYMMELYNDKLIDLLTTSHQDSARLDIKKDKKGMVFVQGSVMLESHSKEELWSIFERGSENRHVASTKMNAESSRSHLILGIIIESTNLVSGAVIKGKLSLVDLAGSERAAKTGATAEQLKEAQSINKSLSALGDVISALSSDQQFIPYRNNKLTMLMQDSLGGNAKTLMFVNVSPADYNTDETVTSLTYA 253          
BLAST of Kinesin protein vs. Ensembl Nematostella
Match: EDO39610 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9N5])

HSP 1 Score: 177.948 bits (450), Expect = 2.580e-49
Identity = 120/338 (35.50%), Postives = 181/338 (53.55%), Query Frame = 2
Query: 1229 IRVYCRIRPQPRTFLKITSEDKLIIVGDCLPEKITKHWYG---KASKCFIFDRVFGPKSDQIEVF-EAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQ---EPGVNRRAIYRLLNICDT---RMQWKYRLFLSMVEIYQEDVRDILADKTSASVKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVY------GENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQKP--SYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFGINAMQV 2188
            +RV  R RP     +K+ +E  +I+  D    + +    G   K  K F FD V+G + +  +++ E V  ++   ++GYN  + AYGQT  GKT TM G+ Q   + G+  R    +LN       R   +Y L +S +EIY E++RD+L   T ++++I  + D  + ++GL+   V C  D+ +  + G  NR+V ST +N  SSRSH I ++ +       GE         G L L DLAGSE  +KSGATGERF EAT IN SL+ LG V  +L + +     YR++KLT LL+ +LGG+SK L+   +     N EETL  + +   A  +
Sbjct:    6 VRVIARCRPLDYNEIKMKTE--IIVSIDSSLRQCSLRKPGDPAKMRKVFTFDGVYGSQCNTEKLYSEIVHPIVDGVLEGYNGTVFAYGQTSCGKTFTMQGSAQPESQVGITPRCCRHILNSMQGKGRRRNREYLLHVSYLEIYNEEIRDLLVKNTRSNLEIKEHPDKGMYVKGLSSITVDCYEDMAEILEIGSANRSVGSTCMNTDSSRSHSIFIIDLQVNVNKGGEGE---CVRNGKLNLVDLAGSERQSKSGATGERFREATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRLLQDSLGGNSKTLMVACISPGSNNYEETLSTLRYAKRAKNI 338          
BLAST of Kinesin protein vs. Ensembl Medaka
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:101166854])

HSP 1 Score: 262.692 bits (670), Expect = 1.359e-75
Identity = 146/337 (43.32%), Postives = 201/337 (59.64%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIRP---------QPRTFLKITSEDKLIIVGDCLPEKITKHWYGKASKCFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLLN-ICDTRMQWKYRLFLSMVEIYQEDVRDILADKTSASVKIMSNQDD--EIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRN-HQKPSYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFG 2170
            HN+L  L GNIRV+CR+RP           +T L   SED  ++    L  K      GK +  F  D++F P++ Q EVF+ V  L+TSC+DG+NVCI AYGQTGSGKT+TM G   +PG+N+RA+  L + + +    W YR+ +S+VEIY E +RD+L +  +  + I  N D   ++ + GLTE  V+   DI + F+ G  NR  A T LN  SSRSH ++++ V G N    T + G L L DLAGSE + KSGA G R  EA CINKSL+ LG V  +LR  H    +R ++LTYLL+ +L GDSK L+ V V   P N  E++ ++ F 
Sbjct:  448 HNELVRLKGNIRVFCRVRPVSQEEQDSADAKTLLSFDSEDDAVLY---LSNK------GK-TMTFELDKIFPPQATQEEVFQEVQSLVTSCIDGFNVCIFAYGQTGSGKTYTMEGVEGDPGINQRALRLLFDEVTEKAPDWDYRITVSLVEIYNETLRDLLRENPTDKLDIKMNPDGSGQLYVPGLTERTVQSPEDINRVFELGHANRATACTNLNEHSSRSHALLIITVSGFNGATGTRTQGRLNLVDLAGSERIGKSGAEGSRLREAQCINKSLSALGDVISALRGKHAHVPFRNSRLTYLLQDSLSGDSKTLMMVQVSPLPGNMSESVCSLKFA 774          
BLAST of Kinesin protein vs. Ensembl Medaka
Match: kifc3 (kinesin family member C3 [Source:NCBI gene;Acc:101166854])

HSP 1 Score: 262.307 bits (669), Expect = 9.218e-75
Identity = 146/337 (43.32%), Postives = 201/337 (59.64%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIRP---------QPRTFLKITSEDKLIIVGDCLPEKITKHWYGKASKCFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLLN-ICDTRMQWKYRLFLSMVEIYQEDVRDILADKTSASVKIMSNQDD--EIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRN-HQKPSYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFG 2170
            HN+L  L GNIRV+CR+RP           +T L   SED  ++    L  K      GK +  F  D++F P++ Q EVF+ V  L+TSC+DG+NVCI AYGQTGSGKT+TM G   +PG+N+RA+  L + + +    W YR+ +S+VEIY E +RD+L +  +  + I  N D   ++ + GLTE  V+   DI + F+ G  NR  A T LN  SSRSH ++++ V G N    T + G L L DLAGSE + KSGA G R  EA CINKSL+ LG V  +LR  H    +R ++LTYLL+ +L GDSK L+ V V   P N  E++ ++ F 
Sbjct:  554 HNELVRLKGNIRVFCRVRPVSQEEQDSADAKTLLSFDSEDDAVLY---LSNK------GK-TMTFELDKIFPPQATQEEVFQEVQSLVTSCIDGFNVCIFAYGQTGSGKTYTMEGVEGDPGINQRALRLLFDEVTEKAPDWDYRITVSLVEIYNETLRDLLRENPTDKLDIKMNPDGSGQLYVPGLTERTVQSPEDINRVFELGHANRATACTNLNEHSSRSHALLIITVSGFNGATGTRTQGRLNLVDLAGSERIGKSGAEGSRLREAQCINKSLSALGDVISALRGKHAHVPFRNSRLTYLLQDSLSGDSKTLMMVQVSPLPGNMSESVCSLKFA 880          
BLAST of Kinesin protein vs. Ensembl Medaka
Match: kifc1 (kinesin family member C1 [Source:NCBI gene;Acc:101167717])

HSP 1 Score: 224.172 bits (570), Expect = 2.463e-63
Identity = 135/339 (39.82%), Postives = 190/339 (56.05%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIRPQPRTFLK-----ITSEDKLIIVGDCLPEKITKHWYGKASKCFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEP--GVNRRAIYRLLNICD--TRMQWKYRLFLSMVEIYQEDVRDIL-----ADKTSASVKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQKP-SYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFG 2170
            HN +QEL GNIRV+CR+RP     L        S+DK I++         K    + +  F FDRVFGP++ Q E+FE +  L+ S +DGYNVC+ AYGQTGSGKT+TM G   +   GV  RA+ ++           W++    S VEIY E +RD+L     + +    ++ M++  +E+ +  LT  +V  E+ +       ++NR+ A T  N  SSRSH +  L + G N     T   TL L DLAGSE + KS + G+RF E T IN SL+ LG V  SL N +    YR +KLTYLL+  LGG+SK L+FVN+  E ++  ETL ++ F 
Sbjct:  275 HNTIQELKGNIRVFCRVRPLVSGGLSKHIQLPASDDKSIVLAKTEESHTGKVADTQKNYNFSFDRVFGPQASQQEIFEEISLLVQSALDGYNVCVFAYGQTGSGKTYTMEGEEYDDTRGVIPRAVQQVFKAGQKLAAQGWEFTFTASFVEIYNETLRDLLYTGKASKRPEHEIRKMAS--NEVTVTNLTYEKVYTEDQVQGLIAVAKRNRSTAQTSQNDRSSRSHSVFQLHIEGVNAGRDVTCKSTLCLVDLAGSERMMKSQSQGDRFKEMTAINSSLSNLGIVITSLANKESHIPYRNSKLTYLLQGCLGGNSKTLMFVNISPESDSFGETLNSLRFA 611          
BLAST of Kinesin protein vs. Ensembl Medaka
Match: si:ch211-257p13.3 (kinesin-like protein KIFC3 [Source:NCBI gene;Acc:101163027])

HSP 1 Score: 228.409 bits (581), Expect = 5.364e-63
Identity = 132/327 (40.37%), Postives = 187/327 (57.19%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIRPQPRTFLKITSEDKLIIVGDCLPEKITKHWYGKASKCFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLLNICDTRMQ-WKYRLFLSMVEIYQEDVRDILA-DKTSASVKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQKP-SYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFG 2170
            H +L EL GNIRV CR++P  +       +  ++ +       +T    GK  + F  D+VF P++ Q E+F+ ++ L+TS +DGY+VCI AYGQTGSGKTHTM GTV+ PG+N+RA+  L +  + R   W Y + +S VEIY E +RD+L+ D     +KI  +   ++ + GL   EV     I K      +NR    T +N  SSRSH ++ + V G +    + + G L L DLAGSE V KSGA GER  EA  IN+SL  LG V  +LR  Q    +R ++LTYLL+ +LG  SK ++ V V     N  ETL ++ F 
Sbjct:  570 HEQLVELKGNIRVLCRVKPVLKEDQHEEGQSVVVAIDPNNESSLTVLTKGKG-RVFELDKVFQPQATQEEIFQEIEPLVTSSIDGYHVCIFAYGQTGSGKTHTMEGTVENPGINQRALKHLFHEIEERKDMWSYNVSVSSVEIYNEVLRDLLSKDGEKLDIKINPDGTGQLHVPGLRVIEVNSFQHIKKILATARRNRITFGTQMNQHSSRSHALLCITVQGTDLATGSKTTGKLNLVDLAGSERVWKSGAEGERLKEAQNINRSLLALGDVIQALRARQTHVPFRNSRLTYLLQDSLGKGSKTVMVVQVSALESNVGETLCSLKFA 895          
BLAST of Kinesin protein vs. Ensembl Medaka
Match: si:dkey-96l17.6 (kinesin-like protein KIN-14E [Source:NCBI gene;Acc:105354761])

HSP 1 Score: 198.749 bits (504), Expect = 3.553e-54
Identity = 116/344 (33.72%), Postives = 187/344 (54.36%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIRPQPRTFLKITSEDKLIIVGDCLPEKITKHWYG----KASKCFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQE--PGVNRRAIYRLLNIC-DTRMQWKYRLFLSMVEIYQEDVRDIL------------ADKTSASVKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLR-NHQKPSYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFG 2170
            +N ++++ G IRV+CR+RP  R        ++    G    EKI  +       +  + F FD+VFG ++ Q EVF+    LI S +DGYNVCI AYGQTGSGKT TM+G   +  PG+  R+   + +I  +   ++++++   M+E+Y + ++D+                 +  V+I   +   +  QG    E     +++  F +   NR +A+T +N+ SSRSHLIV++ V   N  + + S G L+L DLAGSE   K+GA   +  EA  INKSL+ LG V  +L  +     YR +KLT +++ +LGG++K L+ VN+     N +ETL ++ + 
Sbjct:  265 YNMVEDMKGKIRVFCRLRPMNR--------NEAGQGGTAFVEKIDDYSVSVETPRGLREFQFDKVFGAEASQDEVFQDTSRLIQSVIDGYNVCIFAYGQTGSGKTFTMVGDKDQRNPGIMPRSFNAIFDITRENSSKFEFKVSAYMLELYNDRLQDLFISQAAEAQAQTQPSSQTRRVEIKRTRKGVVFAQGAETKEASSAQELYALFQQACANRHIAATKMNVESSRSHLIVVIMVESRNLTNGSISTGKLSLVDLAGSERAAKTGAKDHQLKEANSINKSLSALGDVISALSADLPHVPYRNSKLTQVMQDSLGGNAKTLMIVNISPSESNLDETLTSLIYA 600          
BLAST of Kinesin protein vs. Planmine SMEST
Match: SMESG000003819.1 (SMESG000003819.1)

HSP 1 Score: 1454.5 bits (3764), Expect = 0.000e+0
Identity = 723/723 (100.00%), Postives = 723/723 (100.00%), Query Frame = 2
Query:   80 MASKISLQTNQNENNLHINEFLNAERLELEEPLSECGSSVGSLTMTMTHSTDCAVLNDSEQNINHHYCPVSDSEKNSNESTKNLEKYIKDEYKSGILGASNAWMYYQDEYEQLEKVLQSLQTDIFVFLTDVIQRNYKQKEMIQIENYLPKSCVGSFYKCMNRNESEDGNAGSGKFTLLQFKLWKKHYCTLLDAFDIVYKDCQLLNKLRNSKTEYDKITLTIMNKSLFNEFQVVFGKYLQRCELKNIIQNTNIGFNMSTAFLIDVIAQCRIFRGELERLTATKDRLFYILKTAKDQRSKLKSYVSNLRNDLRCLLAKMKLIQKNEVNEVVCTTISKTIDPISGVLTQNEKQDFQXXXXXXXXXXXXXXXXXXXXHNKLQELIGNIRVYCRIRPQPRTFLKITSEDKLIIVGDCLPEKITKHWYGKASKCFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLLNICDTRMQWKYRLFLSMVEIYQEDVRDILADKTSASVKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQKPSYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFGINAMQVAPEKAQQRSKFRKTLGKITV 2248
            MASKISLQTNQNENNLHINEFLNAERLELEEPLSECGSSVGSLTMTMTHSTDCAVLNDSEQNINHHYCPVSDSEKNSNESTKNLEKYIKDEYKSGILGASNAWMYYQDEYEQLEKVLQSLQTDIFVFLTDVIQRNYKQKEMIQIENYLPKSCVGSFYKCMNRNESEDGNAGSGKFTLLQFKLWKKHYCTLLDAFDIVYKDCQLLNKLRNSKTEYDKITLTIMNKSLFNEFQVVFGKYLQRCELKNIIQNTNIGFNMSTAFLIDVIAQCRIFRGELERLTATKDRLFYILKTAKDQRSKLKSYVSNLRNDLRCLLAKMKLIQKNEVNEVVCTTISKTIDPISGVLTQNEKQDFQKKIEDLERILKEEELRRKKLHNKLQELIGNIRVYCRIRPQPRTFLKITSEDKLIIVGDCLPEKITKHWYGKASKCFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLLNICDTRMQWKYRLFLSMVEIYQEDVRDILADKTSASVKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQKPSYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFGINAMQVAPEKAQQRSKFRKTLGKITV
Sbjct:    1 MASKISLQTNQNENNLHINEFLNAERLELEEPLSECGSSVGSLTMTMTHSTDCAVLNDSEQNINHHYCPVSDSEKNSNESTKNLEKYIKDEYKSGILGASNAWMYYQDEYEQLEKVLQSLQTDIFVFLTDVIQRNYKQKEMIQIENYLPKSCVGSFYKCMNRNESEDGNAGSGKFTLLQFKLWKKHYCTLLDAFDIVYKDCQLLNKLRNSKTEYDKITLTIMNKSLFNEFQVVFGKYLQRCELKNIIQNTNIGFNMSTAFLIDVIAQCRIFRGELERLTATKDRLFYILKTAKDQRSKLKSYVSNLRNDLRCLLAKMKLIQKNEVNEVVCTTISKTIDPISGVLTQNEKQDFQKKIEDLERILKEEELRRKKLHNKLQELIGNIRVYCRIRPQPRTFLKITSEDKLIIVGDCLPEKITKHWYGKASKCFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLLNICDTRMQWKYRLFLSMVEIYQEDVRDILADKTSASVKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQKPSYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFGINAMQVAPEKAQQRSKFRKTLGKITV 723          
BLAST of Kinesin protein vs. Planmine SMEST
Match: SMESG000039007.1 (SMESG000039007.1)

HSP 1 Score: 479.559 bits (1233), Expect = 3.211e-160
Identity = 264/485 (54.43%), Postives = 343/485 (70.72%), Query Frame = 2
Query:  830 NIGFNMSTAFLIDVIAQCRIFRGELERLTATKDRLFYILKTAKDQRSKLKSYVSNLRNDLRCLLAKMKLIQKNEVNEVVCTTI-SKTIDPISGVLTQ---------------NEKQDFQXXXXXXXXXXXXXXXXXXXXHNKLQELIGNIRVYCRIRPQPRTFLKITSEDKLIIVGDCLPEKITKHWYGKASKCFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLLNICDTRMQWKYRLFLSMVEIYQEDVRDILADKTSAS---------VKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQKPSYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFGINAMQVAPEKAQQ 2209
            +I   ++  FL D+I     ++ EL +    K+RLFY+LK AKDQR++LK YV+NLR+++R    K++     E  E++ T I S + D +S ++                 NE+  F+ +I +LE+I+KEEE RRK LHNK QELIGNIRVYCRIRP     LK++++DKLI+  D L EKI+K   G   KCFIFD+V+    DQ  V+ +VD LITSCVDGYNVCIMAYGQTGSGKT+TM+G+ ++PG+N+R+I +LL++C +R QWKY+L LS+ EIYQE++ D+L   T +          +K+ SN+D EI+LQGL+E EV+ E  I++    GE NR V STLLNI SSRSHLI+ +K+ G + +   TS GTLTLCDLAGSEN+ KSGATG RF EAT INKSLTTLGRVFDSLR +QKP+YRE+KLT++LKPTLGGDSKCLLFVNVR E EN  ETL  ++FG NAMQV PEK + 
Sbjct:  163 DIIVTVTEPFLNDLITNYTNYKNELNQQMIVKERLFYVLKRAKDQRARLKIYVNNLRDEIRYAEKKLR-----ETAEIMNTKILSNSTDDVSSMMEDSRNLDVNHLKPNSELNERSYFENRINELEKIIKEEETRRKLLHNKFQELIGNIRVYCRIRPSENCCLKVSNDDKLIVPIDNLSEKISKSL-GTHVKCFIFDKVYNTNCDQETVYASVDSLITSCVDGYNVCIMAYGQTGSGKTYTMVGSDEDPGINKRSIKQLLSLCSSRNQWKYKLTLSISEIYQEEIYDLLKVPTVSEPSNTTKNNQIKVFSNKDSEIILQGLSEMEVEDEAAIYELLKIGEINRKVGSTLLNIASSRSHLILFIKISGTSEVQGITSRGTLTLCDLAGSENICKSGATGTRFQEATSINKSLTTLGRVFDSLRKNQKPAYRESKLTHILKPTLGGDSKCLLFVNVRSESENVHETLGTLYFGQNAMQVMPEKCKH 641          
BLAST of Kinesin protein vs. Planmine SMEST
Match: SMESG000003085.1 (SMESG000003085.1)

HSP 1 Score: 287.345 bits (734), Expect = 7.415e-85
Identity = 155/334 (46.41%), Postives = 213/334 (63.77%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIR--PQPRTFLKITSEDKLIIVGDCLPEKITKHWYGKASKCFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLLNICDTRMQWKYRLFLSMVEIYQEDVRDILADKTSASVKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQ-KPSYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFGINAMQVA 2191
            +N+LQEL GNIRV+ RIR  P+ ++F+K   +D  +     L   ITK         F FD++F   S Q  V+  V  +ITSC DGYNV I+AYGQTGSGKT+TM GT  E GVN++AI  LL IC  R    Y L ++MVEIY E+V+D+L+ K   +V++ +     + + G+T   VK  NDI K  + G  NR VA T +N +SSRSHLIV + + G + +    + G L + DLAGSE V+K+ A+G R  EA  INKSLT+LG+VF +LR +Q    YR +KLT++L+P+LGGD+K  LFVN+  +  N +E+L ++ FG NA QVA
Sbjct:  383 YNQLQELRGNIRVFVRIRADPKSKSFIKAIDDDITL----SLSNGITKQ--------FQFDKIFAEDSKQEAVYAEVSPIITSCADGYNVTILAYGQTGSGKTYTMQGTSSEVGVNKKAIEELLEICSKRKSVNYELSVTMVEIYNENVQDLLSPKVE-TVELRATGTHSVSVMGVTSLPVKTSNDIIKIMNLGNSNRKVAETKMNSSSSRSHLIVTVNLTGIDNLSGLVTKGQLNMVDLAGSERVSKTDASGARLTEAAFINKSLTSLGQVFQALRTNQLHIPYRNSKLTHILEPSLGGDAKACLFVNISPDEANIQESLSSLQFGSNARQVA 703          
BLAST of Kinesin protein vs. Planmine SMEST
Match: SMESG000003085.1 (SMESG000003085.1)

HSP 1 Score: 287.345 bits (734), Expect = 8.430e-85
Identity = 155/334 (46.41%), Postives = 213/334 (63.77%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIR--PQPRTFLKITSEDKLIIVGDCLPEKITKHWYGKASKCFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLLNICDTRMQWKYRLFLSMVEIYQEDVRDILADKTSASVKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQ-KPSYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFGINAMQVA 2191
            +N+LQEL GNIRV+ RIR  P+ ++F+K   +D  +     L   ITK         F FD++F   S Q  V+  V  +ITSC DGYNV I+AYGQTGSGKT+TM GT  E GVN++AI  LL IC  R    Y L ++MVEIY E+V+D+L+ K   +V++ +     + + G+T   VK  NDI K  + G  NR VA T +N +SSRSHLIV + + G + +    + G L + DLAGSE V+K+ A+G R  EA  INKSLT+LG+VF +LR +Q    YR +KLT++L+P+LGGD+K  LFVN+  +  N +E+L ++ FG NA QVA
Sbjct:  383 YNQLQELRGNIRVFVRIRADPKSKSFIKAIDDDITL----SLSNGITKQ--------FQFDKIFAEDSKQEAVYAEVSPIITSCADGYNVTILAYGQTGSGKTYTMQGTSSEVGVNKKAIEELLEICSKRKSVNYELSVTMVEIYNENVQDLLSPKVE-TVELRATGTHSVSVMGVTSLPVKTSNDIIKIMNLGNSNRKVAETKMNSSSSRSHLIVTVNLTGIDNLSGLVTKGQLNMVDLAGSERVSKTDASGARLTEAAFINKSLTSLGQVFQALRTNQLHIPYRNSKLTHILEPSLGGDAKACLFVNISPDEANIQESLSSLQFGSNARQVA 703          
BLAST of Kinesin protein vs. Planmine SMEST
Match: SMESG000003085.1 (SMESG000003085.1)

HSP 1 Score: 286.574 bits (732), Expect = 2.598e-84
Identity = 152/334 (45.51%), Postives = 214/334 (64.07%), Query Frame = 2
Query: 1199 HNKLQELIGNIRVYCRIR--PQPRTFLKITSEDKLIIVGDCLPEKITKHWYGKASKCFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKTHTMMGTVQEPGVNRRAIYRLLNICDTRMQWKYRLFLSMVEIYQEDVRDILADKTSASVKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVASTLLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATGERFNEATCINKSLTTLGRVFDSLRNHQ-KPSYRETKLTYLLKPTLGGDSKCLLFVNVRCEPENAEETLRAIHFGINAMQVA 2191
            +N+LQEL GNIRV+ RIR  P+ ++F+K   +D  + + + +            +K F FD++F   S Q  V+  V  +ITSC DGYNV I+AYGQTGSGKT+TM GT  E GVN++AI  LL IC  R    Y L ++MVEIY E+V+D+L+ K   +V++ +     + + G+T   VK  NDI K  + G  NR VA T +N +SSRSHLIV + + G + +    + G L + DLAGSE V+K+ A+G R  EA  INKSLT+LG+VF +LR +Q    YR +KLT++L+P+LGGD+K  LFVN+  +  N +E+L ++ FG NA QVA
Sbjct:  383 YNQLQELRGNIRVFVRIRADPKSKSFIKAIDDDITLSLSNGI------------TKQFQFDKIFAEDSKQEAVYAEVSPIITSCADGYNVTILAYGQTGSGKTYTMQGTSSEVGVNKKAIEELLEICSKRKSVNYELSVTMVEIYNENVQDLLSPKVE-TVELRATGTHSVSVMGVTSLPVKTSNDIIKIMNLGNSNRKVAETKMNSSSSRSHLIVTVNLTGIDNLSGLVTKGQLNMVDLAGSERVSKTDASGARLTEAAFINKSLTSLGQVFQALRTNQLHIPYRNSKLTHILEPSLGGDAKACLFVNISPDEANIQESLSSLQFGSNARQVA 703          
The following BLAST results are available for this feature:
BLAST of Kinesin protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIFC32.096e-6840.41kinesin family member C3 [Source:HGNC Symbol;Acc:H... [more]
KIFC32.096e-6840.41kinesin family member C3 [Source:HGNC Symbol;Acc:H... [more]
KIFC32.096e-6840.41kinesin family member C3 [Source:HGNC Symbol;Acc:H... [more]
KIFC34.085e-6840.41kinesin family member C3 [Source:HGNC Symbol;Acc:H... [more]
KIFC35.929e-6740.41kinesin family member C3 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Kinesin protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
klp-32.191e-6539.82Kinesin-like protein klp-3 [Source:UniProtKB/Swis... [more]
klp-156.647e-4534.44Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc... [more]
klp-156.647e-4534.44Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc... [more]
klp-111.222e-4437.11Kinesin-like protein [Source:UniProtKB/TrEMBL;Acc... [more]
unc-1163.284e-4434.64Kinesin heavy chain [Source:UniProtKB/Swiss-Prot;... [more]
back to top
BLAST of Kinesin protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ncd8.145e-5237.24gene:FBgn0002924 transcript:FBtr0344976[more]
ncd8.145e-5237.24gene:FBgn0002924 transcript:FBtr0085534[more]
Klp61F7.430e-5136.59gene:FBgn0004378 transcript:FBtr0072733[more]
Khc6.330e-4735.35gene:FBgn0001308 transcript:FBtr0087184[more]
Klp64D1.341e-4232.36gene:FBgn0004380 transcript:FBtr0077157[more]
back to top
BLAST of Kinesin protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kifc32.955e-7340.75kinesin family member C3 [Source:ZFIN;Acc:ZDB-GENE... [more]
kifc31.158e-7241.21kinesin family member C3 [Source:ZFIN;Acc:ZDB-GENE... [more]
kifc31.625e-7240.75kinesin family member C3 [Source:ZFIN;Acc:ZDB-GENE... [more]
kifc32.307e-7240.75kinesin family member C3 [Source:ZFIN;Acc:ZDB-GENE... [more]
si:ch211-257p13.31.111e-6441.44si:ch211-257p13.3 [Source:ZFIN;Acc:ZDB-GENE-110914... [more]
back to top
BLAST of Kinesin protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kifc32.493e-7443.41kinesin family member C3 [Source:NCBI gene;Acc:548... [more]
kifc36.051e-7243.41kinesin family member C3 [Source:NCBI gene;Acc:548... [more]
kifc31.051e-7143.41kinesin family member C3 [Source:NCBI gene;Acc:548... [more]
kifc34.218e-7143.41kinesin family member C3 [Source:NCBI gene;Acc:548... [more]
kifc31.219e-7043.41kinesin family member C3 [Source:NCBI gene;Acc:548... [more]
back to top
BLAST of Kinesin protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kifc33.222e-6740.41kinesin family member C3 [Source:MGI Symbol;Acc:MG... [more]
Kifc38.492e-6740.41kinesin family member C3 [Source:MGI Symbol;Acc:MG... [more]
Kifc35.448e-6640.41kinesin family member C3 [Source:MGI Symbol;Acc:MG... [more]
Kifc32.708e-6139.66kinesin family member C3 [Source:MGI Symbol;Acc:MG... [more]
Kifc17.804e-5636.91kinesin family member C1 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Kinesin protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9BVG8|KIFC3_HUMAN2.847e-6640.41Kinesin-like protein KIFC3 OS=Homo sapiens OX=9606... [more]
sp|F4J2M6|KN14L_ARATH1.163e-6541.46Kinesin-like protein KIN-14L OS=Arabidopsis thalia... [more]
sp|O35231|KIFC3_MOUSE3.811e-6540.41Kinesin-like protein KIFC3 OS=Mus musculus OX=1009... [more]
sp|Q5JKW1|KN14C_ORYSJ7.118e-6541.90Kinesin-like protein KIN-14C OS=Oryza sativa subsp... [more]
sp|P46864|KN14M_ARATH2.479e-6439.39Kinesin-like protein KIN-14M OS=Arabidopsis thalia... [more]
back to top
BLAST of Kinesin protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3VVJ95.657e-11052.54Kinesin motor domain-containing protein OS=Taenia ... [more]
A0A3P6NF005.842e-11052.54Kinesin motor domain-containing protein OS=Taenia ... [more]
A0A4S2M1T22.798e-10738.05Kinesin motor domain-containing protein OS=Opistho... [more]
S4RZ051.234e-8747.37Kinesin motor domain-containing protein OS=Petromy... [more]
T1G4Y91.490e-8747.93Kinesin-like protein OS=Helobdella robusta OX=6412... [more]
back to top
BLAST of Kinesin protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kifc32.961e-7339.83kinesin family member C3 [Source:NCBI gene;Acc:103... [more]
kifc35.943e-7340.28kinesin family member C3 [Source:NCBI gene;Acc:103... [more]
kifc38.295e-7240.28kinesin family member C3 [Source:NCBI gene;Acc:103... [more]
kifc39.348e-7240.28kinesin family member C3 [Source:NCBI gene;Acc:103... [more]
kifc31.005e-7139.83kinesin family member C3 [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Kinesin protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010492.19.481e-9247.37pep scaffold:Pmarinus_7.0:GL478879:14589:34633:-1 ... [more]
kifc34.432e-7339.55kinesin family member C3 [Source:ZFIN;Acc:ZDB-GENE... [more]
kif3a2.753e-4235.52kinesin family member 3A [Source:ZFIN;Acc:ZDB-GENE... [more]
kif3ca3.131e-4233.04kinesin family member 3Ca [Source:ZFIN;Acc:ZDB-GEN... [more]
ENSPMAT00000001811.14.731e-4235.01pep scaffold:Pmarinus_7.0:GL477555:33781:61877:1 g... [more]
back to top
BLAST of Kinesin protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
KAR33.492e-5237.02Minus-end-directed microtubule motor; functions in... [more]
KIP32.210e-3934.15Kinesin-related antiparallel sliding motor protein... [more]
KIP13.238e-3931.20Kinesin-related motor protein; required for mitoti... [more]
KIP21.997e-3430.03Kinesin-related motor protein involved in mitotic ... [more]
CIN83.227e-2237.06Kinesin motor protein; involved in mitotic spindle... [more]
back to top
BLAST of Kinesin protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO316061.389e-8245.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO459502.987e-7845.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO349611.555e-7040.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO372296.469e-5340.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO396102.580e-4935.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Kinesin protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kifc31.359e-7543.32kinesin family member C3 [Source:NCBI gene;Acc:101... [more]
kifc39.218e-7543.32kinesin family member C3 [Source:NCBI gene;Acc:101... [more]
kifc12.463e-6339.82kinesin family member C1 [Source:NCBI gene;Acc:101... [more]
si:ch211-257p13.35.364e-6340.37kinesin-like protein KIFC3 [Source:NCBI gene;Acc:1... [more]
si:dkey-96l17.63.553e-5433.72kinesin-like protein KIN-14E [Source:NCBI gene;Acc... [more]
back to top
BLAST of Kinesin protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000003819.10.000e+0100.00SMESG000003819.1[more]
SMESG000039007.13.211e-16054.43SMESG000039007.1[more]
SMESG000003085.17.415e-8546.41SMESG000003085.1[more]
SMESG000003085.18.430e-8546.41SMESG000003085.1[more]
SMESG000003085.12.598e-8445.51SMESG000003085.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022095 ID=SMED30022095|Name=Kinesin protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2305bp
TGTCAAGATCGATTCGATTGATCAAATATTCCATTTACTAATAAATGTAA
TATACCTTTCTCCTGTAAATCTTCATAAGATGGCATCGAAAATTTCTTTA
CAAACAAACCAAAATGAGAACAATTTGCACATAAACGAATTCCTCAACGC
AGAAAGATTGGAATTGGAAGAACCGTTATCGGAATGTGGATCGAGTGTGG
GAAGTTTGACAATGACCATGACCCATTCAACCGACTGTGCGGTTCTCAAT
GATTCCGAGCAAAACATCAATCATCATTATTGTCCAGTCAGCGATAGCGA
GAAAAACTCCAATGAATCTACAAAAAATCTAGAAAAATATATTAAAGATG
AATATAAATCCGGAATTTTAGGGGCTTCAAATGCCTGGATGTACTATCAA
GATGAGTATGAACAGTTGGAAAAGGTTTTACAGTCATTGCAGACAGATAT
TTTCGTGTTCCTCACGGACGTCATCCAGAGGAATTATAAACAAAAGGAAA
TGATCCAAATTGAAAACTACTTGCCCAAGTCTTGTGTCGGCTCCTTTTAC
AAATGCATGAATCGCAATGAATCAGAAGACGGAAATGCGGGCAGTGGGAA
ATTTACGCTCCTTCAATTTAAGCTGTGGAAAAAACATTATTGCACTCTCC
TGGACGCGTTTGACATTGTGTACAAAGATTGTCAACTCCTGAACAAGTTG
CGCAATAGCAAAACTGAATATGACAAAATAACGCTGACTATTATGAATAA
GTCACTTTTCAATGAATTTCAGGTGGTCTTTGGGAAATATTTGCAGAGAT
GTGAATTGAAAAATATTATACAAAATACAAATATTGGATTCAACATGTCA
ACTGCCTTTCTCATCGACGTCATCGCTCAATGTAGGATTTTCCGAGGCGA
ATTAGAAAGACTGACGGCTACAAAGGATAGACTTTTCTACATACTTAAAA
CCGCTAAAGACCAAAGATCAAAACTTAAGAGTTACGTGTCGAATCTTAGA
AATGATCTACGATGTCTCTTAGCTAAGATGAAACTTATTCAAAAAAATGA
AGTCAACGAAGTTGTATGCACAACAATTTCAAAGACAATTGATCCGATCT
CTGGAGTTTTGACGCAAAATGAGAAACAAGACTTCCAAAAGAAAATTGAA
GATTTGGAACGGATACTGAAAGAAGAAGAGTTAAGGCGTAAAAAGTTACA
CAACAAACTTCAAGAATTAATTGGAAATATTCGGGTATATTGCCGTATAA
GGCCTCAACCTCGAACATTTCTCAAGATTACTTCCGAAGACAAACTAATA
ATAGTTGGAGATTGCTTGCCTGAAAAGATAACAAAACATTGGTATGGAAA
AGCAAGCAAATGTTTTATATTTGATAGAGTTTTTGGGCCAAAATCTGATC
AAATCGAAGTATTTGAAGCCGTTGACGAGCTCATAACTAGCTGCGTTGAT
GGGTACAACGTTTGCATAATGGCATATGGACAAACAGGAAGTGGAAAAAC
GCATACCATGATGGGCACAGTCCAAGAGCCAGGAGTCAACCGACGCGCTA
TTTACAGATTATTAAACATATGCGATACTCGAATGCAGTGGAAATATCGT
TTATTTTTAAGCATGGTTGAAATATATCAAGAAGATGTGAGAGACATTTT
AGCAGACAAGACATCAGCTAGCGTGAAAATCATGTCCAATCAAGACGATG
AAATAATGTTGCAGGGTCTGACTGAACATGAAGTAAAATGTGAAAATGAT
ATTTTTAAATATTTTGATAAAGGTGAAAAGAATCGAACTGTAGCGTCCAC
GTTGTTGAACATCACCTCATCAAGGTCCCACTTAATAGTTTTACTAAAGG
TCTATGGAGAAAACCGAATCCATTTGACTACTAGCATGGGCACATTAACT
CTTTGTGATCTAGCTGGATCCGAGAATGTTACTAAGTCTGGTGCAACAGG
AGAGCGATTTAACGAAGCAACTTGTATAAATAAATCATTAACAACTCTTG
GCCGAGTATTCGATTCCTTGAGAAATCATCAAAAGCCTTCATATCGTGAA
ACTAAATTAACATATTTATTGAAACCAACATTGGGAGGCGATTCAAAGTG
CCTCCTGTTCGTGAATGTGAGATGTGAGCCAGAGAATGCTGAGGAGACAT
TGCGAGCAATTCATTTTGGCATCAACGCCATGCAAGTTGCTCCAGAGAAG
GCTCAGCAAAGATCAAAATTTAGGAAAACCTTAGGCAAAATCACAGTTTG
AAGGAATAACATTAATCAAGGAAATTGTTGAAATTAAATAAATTTTTAAT
ATATT
back to top

protein sequence of SMED30022095-orf-1

>SMED30022095-orf-1 ID=SMED30022095-orf-1|Name=SMED30022095-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=750bp
VKIDSIDQIFHLLINVIYLSPVNLHKMASKISLQTNQNENNLHINEFLNA
ERLELEEPLSECGSSVGSLTMTMTHSTDCAVLNDSEQNINHHYCPVSDSE
KNSNESTKNLEKYIKDEYKSGILGASNAWMYYQDEYEQLEKVLQSLQTDI
FVFLTDVIQRNYKQKEMIQIENYLPKSCVGSFYKCMNRNESEDGNAGSGK
FTLLQFKLWKKHYCTLLDAFDIVYKDCQLLNKLRNSKTEYDKITLTIMNK
SLFNEFQVVFGKYLQRCELKNIIQNTNIGFNMSTAFLIDVIAQCRIFRGE
LERLTATKDRLFYILKTAKDQRSKLKSYVSNLRNDLRCLLAKMKLIQKNE
VNEVVCTTISKTIDPISGVLTQNEKQDFQKKIEDLERILKEEELRRKKLH
NKLQELIGNIRVYCRIRPQPRTFLKITSEDKLIIVGDCLPEKITKHWYGK
ASKCFIFDRVFGPKSDQIEVFEAVDELITSCVDGYNVCIMAYGQTGSGKT
HTMMGTVQEPGVNRRAIYRLLNICDTRMQWKYRLFLSMVEIYQEDVRDIL
ADKTSASVKIMSNQDDEIMLQGLTEHEVKCENDIFKYFDKGEKNRTVAST
LLNITSSRSHLIVLLKVYGENRIHLTTSMGTLTLCDLAGSENVTKSGATG
ERFNEATCINKSLTTLGRVFDSLRNHQKPSYRETKLTYLLKPTLGGDSKC
LLFVNVRCEPENAEETLRAIHFGINAMQVAPEKAQQRSKFRKTLGKITV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0008569ATP-dependent microtubule motor activity, minus-end-directed
GO:0008017microtubule binding
GO:0003777microtubule motor activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0003774motor activity
GO:0016887ATPase activity
Vocabulary: INTERPRO
TermDefinition
IPR036961Kinesin_motor_dom_sf
IPR027640Kinesin-like_fam
IPR027325KIFC3-like
IPR001752Kinesin_motor_dom
IPR019821Kinesin_motor_CS
IPR027417P-loop_NTPase
Vocabulary: biological process
TermDefinition
GO:0007018microtubule-based movement
Vocabulary: cellular component
TermDefinition
GO:0005871kinesin complex
GO:0005874microtubule
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 375..409
NoneNo IPR availableCOILSCoilCoilcoord: 315..349
IPR001752Kinesin motor domainPRINTSPR00380KINESINHEAVYcoord: 631..649
score: 52.81
coord: 484..505
score: 72.58
coord: 600..617
score: 46.76
coord: 679..700
score: 46.14
IPR001752Kinesin motor domainSMARTSM00129kinesin_4coord: 407..735
e-value: 1.1E-103
score: 360.5
IPR001752Kinesin motor domainPFAMPF00225Kinesincoord: 443..728
e-value: 7.7E-86
score: 288.0
IPR001752Kinesin motor domainPROSITEPS50067KINESIN_MOTOR_2coord: 409..729
score: 87.61
IPR036961Kinesin motor domain superfamilyGENE3DG3DSA:3.40.850.10coord: 349..730
e-value: 1.5E-108
score: 364.9
IPR027640Kinesin-like proteinPANTHERPTHR24115FAMILY NOT NAMEDcoord: 324..723
IPR027325Kinesin-like protein KIFC3-likePANTHERPTHR24115:SF387KINESIN-LIKE PROTEIN KIFC3coord: 324..723
IPR019821Kinesin motor domain, conserved sitePROSITEPS00411KINESIN_MOTOR_1coord: 630..641
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 375..728