N-acetyltransferase

Overview
NameN-acetyltransferase
Smed IDSMED30022090
Length (bp)1840
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of N-acetyltransferase (SMED30022090) t-SNE clustered cells

Violin plots show distribution of expression levels for N-acetyltransferase (SMED30022090) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of N-acetyltransferase (SMED30022090) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for N-acetyltransferase (SMED30022090) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022090

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30022090SMESG000026353.1 SMESG000026342.1 SmedASXL_010748SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
muscle cellSMED30022090SMESG000026353.1 dd_Smed_v4_2527_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022090SMESG000026342.1 dd_Smed_v4_1047_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30022090SMESG000026342.1 dd_Smed_v4_1047_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30022090SMESG000026342.1 dd_Smed_v4_1047_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
testisSMED30022090SMESG000026342.1 KU852670smed_ncbi_20200123PMID:27330085
Iyer et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of N-acetyltransferase vs. Ensembl Human
Match: NAA20 (N(alpha)-acetyltransferase 20, NatB catalytic subunit [Source:HGNC Symbol;Acc:HGNC:15908])

HSP 1 Score: 216.853 bits (551), Expect = 1.090e-66
Identity = 104/165 (63.03%), Postives = 126/165 (76.36%), Query Frame = 2
Query: 1277 MTSVRRFKCSDLFKYNNVNLDPLTETFGLNFYLRYLIQWPEFFLAAENYWGRMSGYIMGKAEGHDL--NWHSHVTALSVAPEFRRIGLAGVLMSELENLSIKKDCYFVDLFVRVSNAVAIKMYNCLGYTVYRRVLKYYSGD--EEDEDAFDMRKALPRDVDKKSV 1759
            MT++R F C DLF++NN+NLDPLTET+G+ FYL+YL  WPE+F+ AE   G + GYIMGKAEG      WH HVTALSVAPEFRR+GLA  LM  LE +S +K  +FVDLFVRVSN VA+ MY  LGY+VYR V++YYS    E DEDA+DMRKAL RD +KKS+
Sbjct:    1 MTTLRAFTCDDLFRFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGKAEGSVAREEWHGHVTALSVAPEFRRLGLAAKLMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSI 165          
BLAST of N-acetyltransferase vs. Ensembl Human
Match: NAA20 (N(alpha)-acetyltransferase 20, NatB catalytic subunit [Source:HGNC Symbol;Acc:HGNC:15908])

HSP 1 Score: 191.045 bits (484), Expect = 4.521e-57
Identity = 94/150 (62.67%), Postives = 112/150 (74.67%), Query Frame = 2
Query: 1322 NNVNLDPLTETFGLNFYLRYLIQWPEFFLAAENYWGRMSGYIMGKAEGHDL--NWHSHVTALSVAPEFRRIGLAGVLMSELENLSIKKDCYFVDLFVRVSNAVAIKMYNCLGYTVYRRVLKYYSGD--EEDEDAFDMRKALPRDVDKKSV 1759
             + NLDPLTET+G+ FYL+YL  WPE+F+ AE   G + GYIMGKAEG      WH HVTALSVAPEFRR+GLA  LM  LE +S +K  +FVDLFVRVSN VA+ MY  LGY+VYR V++YYS    E DEDA+DMRKAL RD +KKS+
Sbjct:    4 QSCNLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGKAEGSVAREEWHGHVTALSVAPEFRRLGLAAKLMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSI 153          
BLAST of N-acetyltransferase vs. Ensembl Human
Match: DAZAP1 (DAZ associated protein 1 [Source:HGNC Symbol;Acc:HGNC:2683])

HSP 1 Score: 156.762 bits (395), Expect = 7.812e-42
Identity = 82/185 (44.32%), Postives = 115/185 (62.16%), Query Frame = 2
Query:   77 NEIGKLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVMSTK-HHLEGKEIDPKPCNVN--MKGRSR--------------RQLKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQ 580
            +EIGKLFVGGL  STT ETL+SYFS++GEVV+  +M D  T +SRGFG+V++ + + V  V++++ H L+G+ IDPKPC        R+R              +  KIFVGGI     E  LR++FK+FG +TE+ ++ D    R RGF F+ F+DE  V Q +N H   I  K+VE+K  EP+
Sbjct:    7 DEIGKLFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLASRPHTLDGRNIDPKPCTPRGMQPERTRPKEGWQKGPRSDNSKSNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQAVNMHFHDIMGKKVEVKRAEPR 191          
BLAST of N-acetyltransferase vs. Ensembl Human
Match: DAZAP1 (DAZ associated protein 1 [Source:HGNC Symbol;Acc:HGNC:2683])

HSP 1 Score: 157.147 bits (396), Expect = 1.077e-41
Identity = 82/184 (44.57%), Postives = 115/184 (62.50%), Query Frame = 2
Query:   77 NEIGKLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVMSTK-HHLEGKEIDPKPCNVN--MKGRSR-------------RQLKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQ 580
            +EIGKLFVGGL  STT ETL+SYFS++GEVV+  +M D  T +SRGFG+V++ + + V  V++++ H L+G+ IDPKPC        R+R             +  KIFVGGI     E  LR++FK+FG +TE+ ++ D    R RGF F+ F+DE  V Q +N H   I  K+VE+K  EP+
Sbjct:    7 DEIGKLFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLASRPHTLDGRNIDPKPCTPRGMQPERTRPKEGWKGPRSDNSKSNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQAVNMHFHDIMGKKVEVKRAEPR 190          
BLAST of N-acetyltransferase vs. Ensembl Human
Match: DAZAP1 (DAZ associated protein 1 [Source:HGNC Symbol;Acc:HGNC:2683])

HSP 1 Score: 156.762 bits (395), Expect = 1.638e-41
Identity = 82/185 (44.32%), Postives = 115/185 (62.16%), Query Frame = 2
Query:   77 NEIGKLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVMSTK-HHLEGKEIDPKPCNVN--MKGRSR--------------RQLKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQ 580
            +EIGKLFVGGL  STT ETL+SYFS++GEVV+  +M D  T +SRGFG+V++ + + V  V++++ H L+G+ IDPKPC        R+R              +  KIFVGGI     E  LR++FK+FG +TE+ ++ D    R RGF F+ F+DE  V Q +N H   I  K+VE+K  EP+
Sbjct:    7 DEIGKLFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLASRPHTLDGRNIDPKPCTPRGMQPERTRPKEGWQKGPRSDNSKSNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQAVNMHFHDIMGKKVEVKRAEPR 191          
BLAST of N-acetyltransferase vs. Ensembl Celegans
Match: natb-1 (N-terminal AceTyltransferase B (NatB) complex, catalytic subunit, homolog [Source:UniProtKB/TrEMBL;Acc:Q965S3])

HSP 1 Score: 198.364 bits (503), Expect = 4.340e-60
Identity = 93/161 (57.76%), Postives = 120/161 (74.53%), Query Frame = 2
Query: 1277 MTSVRRFKCSDLFKYNNVNLDPLTETFGLNFYLRYLIQWPEFFLAAENYWGRMSGYIMGKAEGHDLNWHSHVTALSVAPEFRRIGLAGVLMSELENLSIKKDCYFVDLFVRVSNAVAIKMYNCLGYTVYRRVLKYYSGDEEDEDAFDMRKALPRDVDKKSV 1759
            MT++R F   D+FK+NNVNLD  TET+G  FYL Y++ +PE++  AE+  G +  Y+MGK EG D NWH HVTALSVAP FRR+GLA  +M  LE  S  +  YFVDLFVRVSN +AI++Y  LGY VYR+++ YY+GD  DEDAFDMRK+L RD +KK++
Sbjct:    1 MTTLRPFDVMDMFKFNNVNLDINTETYGFQFYLHYMMNYPEYYQVAEHPNGEIMAYVMGKIEGRDTNWHGHVTALSVAPNFRRLGLAAYMMEFLERTSEARRAYFVDLFVRVSNKIAIELYKKLGYVVYRQIIGYYTGD-RDEDAFDMRKSLSRDPEKKAM 160          
BLAST of N-acetyltransferase vs. Ensembl Celegans
Match: msi-1 (MuSashI (Fly neural) family; Neural RNA-binding protein MSI-1 [Source:UniProtKB/TrEMBL;Acc:G5EFS2])

HSP 1 Score: 133.65 bits (335), Expect = 1.641e-34
Identity = 67/171 (39.18%), Postives = 103/171 (60.23%), Query Frame = 2
Query:   86 GKLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVMSTK-HHLEGKEIDPKPCNVNMKGRSRRQL-----KIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQ 580
            GK+F+GGL   TT E L+ YF +FGEV E  VM D  T R+RGFG++ +++   V KV++ + H L+GK+IDPK   V    R++ +L     K+F+GG++     E ++ +F+ +G + +  LM D++  RHRGF FV FD + V  ++   H   I  K VE K  +P+
Sbjct:   45 GKMFIGGLSWQTTAENLRDYFGRFGEVNECMVMRDPATKRARGFGFITFVDPSSVDKVLNNREHELDGKKIDPK---VAFPKRTQAKLVTKTKKVFIGGLSATSTLEDMKQYFETYGKVEDAMLMFDKATQRHRGFGFVTFDSDEVADKVCEIHFHEINGKMVECKKAQPK 212          
BLAST of N-acetyltransferase vs. Ensembl Celegans
Match: sqd-1 (Homologous to Drosophila SQD (Squid) protein [Source:UniProtKB/TrEMBL;Acc:Q8MXR6])

HSP 1 Score: 118.627 bits (296), Expect = 2.252e-29
Identity = 58/171 (33.92%), Postives = 97/171 (56.73%), Query Frame = 2
Query:   71 QGNEIGKLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGV-LKVMSTKHHLEGKEIDPKPCNVNMKGRSRRQLKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQ 580
            +GNE  K+FVGG+     NE L S+F+++GEV +A V  D   GRSRGF +V +   +G  L + + +  ++GK ++ KP       +SR   K+FVGG+  +++E+ LR  F+QFG + ++    D+     R FAF+ F++E    +  +    T G ++ ++K   PQ
Sbjct:   24 KGNEDKKIFVGGISPEVNNEDLSSHFTQYGEVAQAQVKYDRTNGRSRGFAFVEFTTGEGCKLALAAREQTIKGKSVEVKPA------KSRENKKVFVGGLPSDYSEQDLRSHFEQFGKVDDIEWPFDKQTKARRNFAFIVFEEEESADKASSQTKQTFGTRECDVKKAVPQ 188          
BLAST of N-acetyltransferase vs. Ensembl Celegans
Match: sqd-1 (Homologous to Drosophila SQD (Squid) protein [Source:UniProtKB/TrEMBL;Acc:Q8MXR6])

HSP 1 Score: 118.627 bits (296), Expect = 2.252e-29
Identity = 58/171 (33.92%), Postives = 97/171 (56.73%), Query Frame = 2
Query:   71 QGNEIGKLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGV-LKVMSTKHHLEGKEIDPKPCNVNMKGRSRRQLKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQ 580
            +GNE  K+FVGG+     NE L S+F+++GEV +A V  D   GRSRGF +V +   +G  L + + +  ++GK ++ KP       +SR   K+FVGG+  +++E+ LR  F+QFG + ++    D+     R FAF+ F++E    +  +    T G ++ ++K   PQ
Sbjct:   24 KGNEDKKIFVGGISPEVNNEDLSSHFTQYGEVAQAQVKYDRTNGRSRGFAFVEFTTGEGCKLALAAREQTIKGKSVEVKPA------KSRENKKVFVGGLPSDYSEQDLRSHFEQFGKVDDIEWPFDKQTKARRNFAFIVFEEEESADKASSQTKQTFGTRECDVKKAVPQ 188          
BLAST of N-acetyltransferase vs. Ensembl Celegans
Match: sqd-1 (Homologous to Drosophila SQD (Squid) protein [Source:UniProtKB/TrEMBL;Acc:Q8MXR6])

HSP 1 Score: 118.627 bits (296), Expect = 2.252e-29
Identity = 58/171 (33.92%), Postives = 97/171 (56.73%), Query Frame = 2
Query:   71 QGNEIGKLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGV-LKVMSTKHHLEGKEIDPKPCNVNMKGRSRRQLKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQ 580
            +GNE  K+FVGG+     NE L S+F+++GEV +A V  D   GRSRGF +V +   +G  L + + +  ++GK ++ KP       +SR   K+FVGG+  +++E+ LR  F+QFG + ++    D+     R FAF+ F++E    +  +    T G ++ ++K   PQ
Sbjct:   24 KGNEDKKIFVGGISPEVNNEDLSSHFTQYGEVAQAQVKYDRTNGRSRGFAFVEFTTGEGCKLALAAREQTIKGKSVEVKPA------KSRENKKVFVGGLPSDYSEQDLRSHFEQFGKVDDIEWPFDKQTKARRNFAFIVFEEEESADKASSQTKQTFGTRECDVKKAVPQ 188          
BLAST of N-acetyltransferase vs. Ensembl Fly
Match: Naa20A (gene:FBgn0031043 transcript:FBtr0332482)

HSP 1 Score: 227.639 bits (579), Expect = 4.368e-71
Identity = 107/161 (66.46%), Postives = 132/161 (81.99%), Query Frame = 2
Query: 1277 MTSVRRFKCSDLFKYNNVNLDPLTETFGLNFYLRYLIQWPEFFLAAENYWGRMSGYIMGKAEGHDLNWHSHVTALSVAPEFRRIGLAGVLMSELENLSIKKDCYFVDLFVRVSNAVAIKMYNCLGYTVYRRVLKYYSGDEEDEDAFDMRKALPRDVDKKSV 1759
            MT++R F C DLFK+NNVN DPLTET+GL+FY +YL +WPE+F  AE+  G++ GYIMGK EGH  NWH HVTAL+V+P++RR+GLA +LMS LE++S KK  YFVDLFVR SN VAI MY  LGY +YR +L+YYSGD +DEDA+DMRKAL RDV+KKSV
Sbjct:    1 MTTLRPFTCDDLFKFNNVNFDPLTETYGLSFYTQYLAKWPEYFQLAESPSGQIMGYIMGKVEGHLDNWHGHVTALTVSPDYRRLGLAALLMSFLEDISEKKRAYFVDLFVRKSNQVAINMYTNLGYIIYRTILEYYSGD-QDEDAYDMRKALSRDVNKKSV 160          
BLAST of N-acetyltransferase vs. Ensembl Fly
Match: Naa20A (gene:FBgn0031043 transcript:FBtr0332484)

HSP 1 Score: 227.254 bits (578), Expect = 4.575e-71
Identity = 107/161 (66.46%), Postives = 132/161 (81.99%), Query Frame = 2
Query: 1277 MTSVRRFKCSDLFKYNNVNLDPLTETFGLNFYLRYLIQWPEFFLAAENYWGRMSGYIMGKAEGHDLNWHSHVTALSVAPEFRRIGLAGVLMSELENLSIKKDCYFVDLFVRVSNAVAIKMYNCLGYTVYRRVLKYYSGDEEDEDAFDMRKALPRDVDKKSV 1759
            MT++R F C DLFK+NNVN DPLTET+GL+FY +YL +WPE+F  AE+  G++ GYIMGK EGH  NWH HVTAL+V+P++RR+GLA +LMS LE++S KK  YFVDLFVR SN VAI MY  LGY +YR +L+YYSGD +DEDA+DMRKAL RDV+KKSV
Sbjct:    1 MTTLRPFTCDDLFKFNNVNFDPLTETYGLSFYTQYLAKWPEYFQLAESPSGQIMGYIMGKVEGHLDNWHGHVTALTVSPDYRRLGLAALLMSFLEDISEKKRAYFVDLFVRKSNQVAINMYTNLGYIIYRTILEYYSGD-QDEDAYDMRKALSRDVNKKSV 160          
BLAST of N-acetyltransferase vs. Ensembl Fly
Match: Naa20A (gene:FBgn0031043 transcript:FBtr0332483)

HSP 1 Score: 227.254 bits (578), Expect = 4.575e-71
Identity = 107/161 (66.46%), Postives = 132/161 (81.99%), Query Frame = 2
Query: 1277 MTSVRRFKCSDLFKYNNVNLDPLTETFGLNFYLRYLIQWPEFFLAAENYWGRMSGYIMGKAEGHDLNWHSHVTALSVAPEFRRIGLAGVLMSELENLSIKKDCYFVDLFVRVSNAVAIKMYNCLGYTVYRRVLKYYSGDEEDEDAFDMRKALPRDVDKKSV 1759
            MT++R F C DLFK+NNVN DPLTET+GL+FY +YL +WPE+F  AE+  G++ GYIMGK EGH  NWH HVTAL+V+P++RR+GLA +LMS LE++S KK  YFVDLFVR SN VAI MY  LGY +YR +L+YYSGD +DEDA+DMRKAL RDV+KKSV
Sbjct:    1 MTTLRPFTCDDLFKFNNVNFDPLTETYGLSFYTQYLAKWPEYFQLAESPSGQIMGYIMGKVEGHLDNWHGHVTALTVSPDYRRLGLAALLMSFLEDISEKKRAYFVDLFVRKSNQVAINMYTNLGYIIYRTILEYYSGD-QDEDAYDMRKALSRDVNKKSV 160          
BLAST of N-acetyltransferase vs. Ensembl Fly
Match: Naa20A (gene:FBgn0031043 transcript:FBtr0074763)

HSP 1 Score: 227.254 bits (578), Expect = 4.575e-71
Identity = 107/161 (66.46%), Postives = 132/161 (81.99%), Query Frame = 2
Query: 1277 MTSVRRFKCSDLFKYNNVNLDPLTETFGLNFYLRYLIQWPEFFLAAENYWGRMSGYIMGKAEGHDLNWHSHVTALSVAPEFRRIGLAGVLMSELENLSIKKDCYFVDLFVRVSNAVAIKMYNCLGYTVYRRVLKYYSGDEEDEDAFDMRKALPRDVDKKSV 1759
            MT++R F C DLFK+NNVN DPLTET+GL+FY +YL +WPE+F  AE+  G++ GYIMGK EGH  NWH HVTAL+V+P++RR+GLA +LMS LE++S KK  YFVDLFVR SN VAI MY  LGY +YR +L+YYSGD +DEDA+DMRKAL RDV+KKSV
Sbjct:    1 MTTLRPFTCDDLFKFNNVNFDPLTETYGLSFYTQYLAKWPEYFQLAESPSGQIMGYIMGKVEGHLDNWHGHVTALTVSPDYRRLGLAALLMSFLEDISEKKRAYFVDLFVRKSNQVAINMYTNLGYIIYRTILEYYSGD-QDEDAYDMRKALSRDVNKKSV 160          
BLAST of N-acetyltransferase vs. Ensembl Fly
Match: Hrb27C (gene:FBgn0004838 transcript:FBtr0079348)

HSP 1 Score: 151.369 bits (381), Expect = 9.567e-40
Identity = 70/171 (40.94%), Postives = 108/171 (63.16%), Query Frame = 2
Query:   77 NEIGKLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVMST-KHHLEGKEIDPKPCNVNMKGRSRRQ--LKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQ 580
            +E GKLFVGGL   TT E L  YF +FG++++  VM ++ +GRSRGFG+V + +   V  V+    H L+G+ IDPKPCN     + ++    K+F+GG+     E  LR FF ++G +TE+ +M DQ   + RGF F++F++E+ V+ + N+  + +  KQVEIK  EP+
Sbjct:    4 DERGKLFVGGLSWETTQENLSRYFCRFGDIIDCVVMKNNESGRSRGFGFVTFADPTNVNHVLQNGPHTLDGRTIDPKPCNPRTLQKPKKGGGYKVFLGGLPSNVTETDLRTFFNRYGKVTEVVIMYDQEKKKSRGFGFLSFEEESSVEHVTNERYINLNGKQVEIKKAEPR 174          
BLAST of N-acetyltransferase vs. Ensembl Zebrafish
Match: naa20 (N(alpha)-acetyltransferase 20, NatB catalytic subunit [Source:NCBI gene;Acc:541516])

HSP 1 Score: 218.394 bits (555), Expect = 1.850e-67
Identity = 105/165 (63.64%), Postives = 126/165 (76.36%), Query Frame = 2
Query: 1277 MTSVRRFKCSDLFKYNNVNLDPLTETFGLNFYLRYLIQWPEFFLAAENYWGRMSGYIMGKAEGHDL--NWHSHVTALSVAPEFRRIGLAGVLMSELENLSIKKDCYFVDLFVRVSNAVAIKMYNCLGYTVYRRVLKYYSGD--EEDEDAFDMRKALPRDVDKKSV 1759
            MT++R F C DLFK+NN+NLDPLTET+G+ FYL+YL  WPE+F+ AE   G + GYIMGKAEG      WH HVTALSVAPEFRR+GLA  LM  LE +S +K  +FVDLFVRVSN VA+ MY  LGY+VYR V++YYS    E DEDA+DMRKAL RD +KKS+
Sbjct:    1 MTTLRAFTCDDLFKFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGKAEGSVAREEWHGHVTALSVAPEFRRLGLAAKLMEMLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSI 165          
BLAST of N-acetyltransferase vs. Ensembl Zebrafish
Match: dazap1 (DAZ associated protein 1 [Source:ZFIN;Acc:ZDB-GENE-070212-1])

HSP 1 Score: 157.532 bits (397), Expect = 3.467e-42
Identity = 82/191 (42.93%), Postives = 115/191 (60.21%), Query Frame = 2
Query:   56 MATDDQGNEIGKLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVMSTK-HHLEGKEIDPKPCNVNMKGRSRRQLK---------------IFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQ 580
            M ++  G+EIGKLFVGGL  STT ETL++YFS++GEVV+  +M D  T +SRGFG+V++ + + V  V+ TK H+L+G+ IDPKPC        + + K               IFVGGI     E  LRD+F +FG +TE+ ++ D    R RGF F+ F+ E  V Q +N H   I  K+VE+K  EP+
Sbjct:    1 MNSNLAGDEIGKLFVGGLDWSTTQETLRNYFSQYGEVVDCVIMKDKSTNQSRGFGFVKFKDPNCVRTVLDTKPHNLDGRNIDPKPCTPRGMQPEKTRTKDGWKGSKSDSNKSKKIFVGGIPHNCGEAELRDYFNRFGVVTEVVMIYDAEKQRPRGFGFITFEAEQSVDQAVNMHFHDIMGKKVEVKKAEPR 191          
BLAST of N-acetyltransferase vs. Ensembl Zebrafish
Match: dazap1 (DAZ associated protein 1 [Source:ZFIN;Acc:ZDB-GENE-070212-1])

HSP 1 Score: 157.532 bits (397), Expect = 3.724e-42
Identity = 82/191 (42.93%), Postives = 115/191 (60.21%), Query Frame = 2
Query:   56 MATDDQGNEIGKLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVMSTK-HHLEGKEIDPKPCNVNMKGRSRRQLK---------------IFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQ 580
            M ++  G+EIGKLFVGGL  STT ETL++YFS++GEVV+  +M D  T +SRGFG+V++ + + V  V+ TK H+L+G+ IDPKPC        + + K               IFVGGI     E  LRD+F +FG +TE+ ++ D    R RGF F+ F+ E  V Q +N H   I  K+VE+K  EP+
Sbjct:    1 MNSNLAGDEIGKLFVGGLDWSTTQETLRNYFSQYGEVVDCVIMKDKSTNQSRGFGFVKFKDPNCVRTVLDTKPHNLDGRNIDPKPCTPRGMQPEKTRTKDGWKGSKSDSNKSKKIFVGGIPHNCGEAELRDYFNRFGVVTEVVMIYDAEKQRPRGFGFITFEAEQSVDQAVNMHFHDIMGKKVEVKKAEPR 191          
BLAST of N-acetyltransferase vs. Ensembl Zebrafish
Match: dazap1 (DAZ associated protein 1 [Source:ZFIN;Acc:ZDB-GENE-070212-1])

HSP 1 Score: 157.532 bits (397), Expect = 1.092e-41
Identity = 84/201 (41.79%), Postives = 117/201 (58.21%), Query Frame = 2
Query:   26 TLTHYILYK*MATDDQGNEIGKLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVMSTK-HHLEGKEIDPKPCNVNMKGRSRRQLK---------------IFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQ 580
             L    L   M ++  G+EIGKLFVGGL  STT ETL++YFS++GEVV+  +M D  T +SRGFG+V++ + + V  V+ TK H+L+G+ IDPKPC        + + K               IFVGGI     E  LRD+F +FG +TE+ ++ D    R RGF F+ F+ E  V Q +N H   I  K+VE+K  EP+
Sbjct:    3 ALPSTTLATEMNSNLAGDEIGKLFVGGLDWSTTQETLRNYFSQYGEVVDCVIMKDKSTNQSRGFGFVKFKDPNCVRTVLDTKPHNLDGRNIDPKPCTPRGMQPEKTRTKDGWKGSKSDSNKSKKIFVGGIPHNCGEAELRDYFNRFGVVTEVVMIYDAEKQRPRGFGFITFEAEQSVDQAVNMHFHDIMGKKVEVKKAEPR 203          
BLAST of N-acetyltransferase vs. Ensembl Zebrafish
Match: msi2b (musashi RNA-binding protein 2b [Source:ZFIN;Acc:ZDB-GENE-040426-1268])

HSP 1 Score: 141.354 bits (355), Expect = 3.595e-37
Identity = 75/176 (42.61%), Postives = 111/176 (63.07%), Query Frame = 2
Query:   65 DDQGNEIGKLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVMSTKHH-LEGKEIDPK---PCNVNMKGRSRRQLKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQ 580
            +D  ++ GK+F+GGL   T+ ++L+ YFSKFGE+ E  VM D  T RSRGFG+V + +   V KV++  HH L+ K IDPK   P     K  +R + KIFVGG++     E ++ +F+QFG + +  LM D++ +RHRGF FV F++E VV+++   H   I NK VE K  +P+
Sbjct:   14 NDSQHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADAASVDKVLAQPHHELDSKTIDPKVAFPRRAQPKMVTRTK-KIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPK 188          
BLAST of N-acetyltransferase vs. Ensembl Xenopus
Match: naa20 (N(alpha)-acetyltransferase 20, NatB catalytic subunit [Source:NCBI gene;Acc:394715])

HSP 1 Score: 217.624 bits (553), Expect = 5.132e-67
Identity = 105/165 (63.64%), Postives = 126/165 (76.36%), Query Frame = 2
Query: 1277 MTSVRRFKCSDLFKYNNVNLDPLTETFGLNFYLRYLIQWPEFFLAAENYWGRMSGYIMGKAEGHDL--NWHSHVTALSVAPEFRRIGLAGVLMSELENLSIKKDCYFVDLFVRVSNAVAIKMYNCLGYTVYRRVLKYYSGD--EEDEDAFDMRKALPRDVDKKSV 1759
            MTS+R F C DLF++NN+NLDPLTET+G+ FYL+YL  WPE+F+ AE   G + GYIMGKAEG      WH HVTALSVAPEFRR+GLA  LM  LE +S +K  +FVDLFVRVSN VA+ MY  LGY+VYR V++YYS    E DEDA+DMRKAL RD +KKS+
Sbjct:    1 MTSLRPFTCDDLFRFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGKAEGSVAREEWHGHVTALSVAPEFRRLGLAAKLMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSI 165          
BLAST of N-acetyltransferase vs. Ensembl Xenopus
Match: naa20 (N(alpha)-acetyltransferase 20, NatB catalytic subunit [Source:NCBI gene;Acc:394715])

HSP 1 Score: 173.711 bits (439), Expect = 1.033e-50
Identity = 86/139 (61.87%), Postives = 103/139 (74.10%), Query Frame = 2
Query: 1355 FGLNFYLRYLIQWPEFFLAAENYWGRMSGYIMGKAEGHDL--NWHSHVTALSVAPEFRRIGLAGVLMSELENLSIKKDCYFVDLFVRVSNAVAIKMYNCLGYTVYRRVLKYYSGD--EEDEDAFDMRKALPRDVDKKSV 1759
            +G+ FYL+YL  WPE+F+ AE   G + GYIMGKAEG      WH HVTALSVAPEFRR+GLA  LM  LE +S +K  +FVDLFVRVSN VA+ MY  LGY+VYR V++YYS    E DEDA+DMRKAL RD +KKS+
Sbjct:    1 YGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGKAEGSVAREEWHGHVTALSVAPEFRRLGLAAKLMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSI 139          
BLAST of N-acetyltransferase vs. Ensembl Xenopus
Match: dazap1 (DAZ associated protein 1 [Source:NCBI gene;Acc:448406])

HSP 1 Score: 159.844 bits (403), Expect = 2.704e-43
Identity = 84/186 (45.16%), Postives = 116/186 (62.37%), Query Frame = 2
Query:   74 GNEIGKLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVMSTK-HHLEGKEIDPKPCNVN----MKGRSR------------RQLKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQ 580
            G+EIGKLFVGGL  STT ETL+SYFS++GEVV+  +M D  T +SRGFG+V++ + + V  V++++ H L+G+ IDPKPC        + R R            R  KIFVGGI     E  LR++FK+FG +TE+ ++ D    R RGF F+ F+DE  V Q +N H   I  K+VE+K  EP+
Sbjct:    6 GDEIGKLFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLASRPHTLDGRNIDPKPCTPRGMQPERTRPREGWQKGPRTENSRSNKIFVGGIPHNCGETELREYFKRFGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQAVNMHFHDIMGKKVEVKRAEPR 191          
BLAST of N-acetyltransferase vs. Ensembl Xenopus
Match: dazap1 (DAZ associated protein 1 [Source:NCBI gene;Acc:448406])

HSP 1 Score: 159.458 bits (402), Expect = 3.624e-43
Identity = 84/187 (44.92%), Postives = 116/187 (62.03%), Query Frame = 2
Query:   74 GNEIGKLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVMSTK-HHLEGKEIDPKPCNVN----MKGRSR-------------RQLKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQ 580
            G+EIGKLFVGGL  STT ETL+SYFS++GEVV+  +M D  T +SRGFG+V++ + + V  V++++ H L+G+ IDPKPC        + R R             R  KIFVGGI     E  LR++FK+FG +TE+ ++ D    R RGF F+ F+DE  V Q +N H   I  K+VE+K  EP+
Sbjct:    6 GDEIGKLFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLASRPHTLDGRNIDPKPCTPRGMQPERTRPREGWQQKGPRTENSRSNKIFVGGIPHNCGETELREYFKRFGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQAVNMHFHDIMGKKVEVKRAEPR 192          
BLAST of N-acetyltransferase vs. Ensembl Xenopus
Match: dazap1 (DAZ associated protein 1 [Source:NCBI gene;Acc:448406])

HSP 1 Score: 159.458 bits (402), Expect = 5.137e-43
Identity = 84/187 (44.92%), Postives = 116/187 (62.03%), Query Frame = 2
Query:   74 GNEIGKLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVMSTK-HHLEGKEIDPKPCNVN----MKGRSR-------------RQLKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQ 580
            G+EIGKLFVGGL  STT ETL+SYFS++GEVV+  +M D  T +SRGFG+V++ + + V  V++++ H L+G+ IDPKPC        + R R             R  KIFVGGI     E  LR++FK+FG +TE+ ++ D    R RGF F+ F+DE  V Q +N H   I  K+VE+K  EP+
Sbjct:    6 GDEIGKLFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLASRPHTLDGRNIDPKPCTPRGMQPERTRPREGWQQKGPRTENSRSNKIFVGGIPHNCGETELREYFKRFGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQAVNMHFHDIMGKKVEVKRAEPR 192          
BLAST of N-acetyltransferase vs. Ensembl Mouse
Match: Naa20 (N(alpha)-acetyltransferase 20, NatB catalytic subunit [Source:MGI Symbol;Acc:MGI:1915127])

HSP 1 Score: 216.853 bits (551), Expect = 7.486e-67
Identity = 104/165 (63.03%), Postives = 126/165 (76.36%), Query Frame = 2
Query: 1277 MTSVRRFKCSDLFKYNNVNLDPLTETFGLNFYLRYLIQWPEFFLAAENYWGRMSGYIMGKAEGHDL--NWHSHVTALSVAPEFRRIGLAGVLMSELENLSIKKDCYFVDLFVRVSNAVAIKMYNCLGYTVYRRVLKYYSGD--EEDEDAFDMRKALPRDVDKKSV 1759
            MT++R F C DLF++NN+NLDPLTET+G+ FYL+YL  WPE+F+ AE   G + GYIMGKAEG      WH HVTALSVAPEFRR+GLA  LM  LE +S +K  +FVDLFVRVSN VA+ MY  LGY+VYR V++YYS    E DEDA+DMRKAL RD +KKS+
Sbjct:    1 MTTLRAFTCDDLFRFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGKAEGSVAREEWHGHVTALSVAPEFRRLGLAAKLMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSI 165          
BLAST of N-acetyltransferase vs. Ensembl Mouse
Match: Naa20 (N(alpha)-acetyltransferase 20, NatB catalytic subunit [Source:MGI Symbol;Acc:MGI:1915127])

HSP 1 Score: 208.764 bits (530), Expect = 1.327e-63
Identity = 103/175 (58.86%), Postives = 126/175 (72.00%), Query Frame = 2
Query: 1277 MTSVRRFKCSDLFKYNNVNLDPLTETFGLNFYLRYLIQWPEFFLAAENYWGRMSGY----------IMGKAEGHDL--NWHSHVTALSVAPEFRRIGLAGVLMSELENLSIKKDCYFVDLFVRVSNAVAIKMYNCLGYTVYRRVLKYYSGD--EEDEDAFDMRKALPRDVDKKSV 1759
            MT++R F C DLF++NN+NLDPLTET+G+ FYL+YL  WPE+F+ AE   G + GY          +MGKAEG      WH HVTALSVAPEFRR+GLA  LM  LE +S +K  +FVDLFVRVSN VA+ MY  LGY+VYR V++YYS    E DEDA+DMRKAL RD +KKS+
Sbjct:    1 MTTLRAFTCDDLFRFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYSKYSTTSTFLVMGKAEGSVAREEWHGHVTALSVAPEFRRLGLAAKLMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSI 175          
BLAST of N-acetyltransferase vs. Ensembl Mouse
Match: Dazap1 (DAZ associated protein 1 [Source:MGI Symbol;Acc:MGI:1917498])

HSP 1 Score: 158.303 bits (399), Expect = 2.702e-42
Identity = 81/184 (44.02%), Postives = 114/184 (61.96%), Query Frame = 2
Query:   77 NEIGKLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVMSTK-HHLEGKEIDPKPCNV---------------NMKGRSRRQLKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQ 580
            +EIGKLFVGGL  STT ETL+SYFS++GEVV+  +M D  T +SRGFG+V++ + + V  V++++ H L+G+ IDPKPC                   +  S +  KIFVGGI     E  LR++FK+FG +TE+ ++ D    R RGF F+ F+DE  V Q +N H   I  K+VE+K  EP+
Sbjct:    7 DEIGKLFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLASRPHTLDGRNIDPKPCTPRGMQPERTRPKEGWKGPRSDSSKSNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQAVNMHFHDIMGKKVEVKRAEPR 190          
BLAST of N-acetyltransferase vs. Ensembl Mouse
Match: Dazap1 (DAZ associated protein 1 [Source:MGI Symbol;Acc:MGI:1917498])

HSP 1 Score: 158.303 bits (399), Expect = 2.839e-42
Identity = 81/184 (44.02%), Postives = 114/184 (61.96%), Query Frame = 2
Query:   77 NEIGKLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVMSTK-HHLEGKEIDPKPCNV---------------NMKGRSRRQLKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQ 580
            +EIGKLFVGGL  STT ETL+SYFS++GEVV+  +M D  T +SRGFG+V++ + + V  V++++ H L+G+ IDPKPC                   +  S +  KIFVGGI     E  LR++FK+FG +TE+ ++ D    R RGF F+ F+DE  V Q +N H   I  K+VE+K  EP+
Sbjct:    7 DEIGKLFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLASRPHTLDGRNIDPKPCTPRGMQPERTRPKEGWKGPRSDSSKSNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQAVNMHFHDIMGKKVEVKRAEPR 190          
BLAST of N-acetyltransferase vs. Ensembl Mouse
Match: Dazap1 (DAZ associated protein 1 [Source:MGI Symbol;Acc:MGI:1917498])

HSP 1 Score: 157.918 bits (398), Expect = 3.908e-42
Identity = 81/185 (43.78%), Postives = 114/185 (61.62%), Query Frame = 2
Query:   77 NEIGKLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVMSTK-HHLEGKEIDPKPCNV----------------NMKGRSRRQLKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQ 580
            +EIGKLFVGGL  STT ETL+SYFS++GEVV+  +M D  T +SRGFG+V++ + + V  V++++ H L+G+ IDPKPC                    +  S +  KIFVGGI     E  LR++FK+FG +TE+ ++ D    R RGF F+ F+DE  V Q +N H   I  K+VE+K  EP+
Sbjct:    7 DEIGKLFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLASRPHTLDGRNIDPKPCTPRGMQPERTRPKEGWQKGPRSDSSKSNKIFVGGIPHNCGETELREYFKKFGVVTEVVMIYDAEKQRPRGFGFITFEDEQSVDQAVNMHFHDIMGKKVEVKRAEPR 191          
BLAST of N-acetyltransferase vs. UniProt/SwissProt
Match: sp|Q58ED9|NAA20_DANRE (N-alpha-acetyltransferase 20 OS=Danio rerio OX=7955 GN=naa20 PE=2 SV=1)

HSP 1 Score: 218.394 bits (555), Expect = 1.397e-66
Identity = 105/165 (63.64%), Postives = 126/165 (76.36%), Query Frame = 2
Query: 1277 MTSVRRFKCSDLFKYNNVNLDPLTETFGLNFYLRYLIQWPEFFLAAENYWGRMSGYIMGKAEGHDL--NWHSHVTALSVAPEFRRIGLAGVLMSELENLSIKKDCYFVDLFVRVSNAVAIKMYNCLGYTVYRRVLKYYSGD--EEDEDAFDMRKALPRDVDKKSV 1759
            MT++R F C DLFK+NN+NLDPLTET+G+ FYL+YL  WPE+F+ AE   G + GYIMGKAEG      WH HVTALSVAPEFRR+GLA  LM  LE +S +K  +FVDLFVRVSN VA+ MY  LGY+VYR V++YYS    E DEDA+DMRKAL RD +KKS+
Sbjct:    1 MTTLRAFTCDDLFKFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGKAEGSVAREEWHGHVTALSVAPEFRRLGLAAKLMEMLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSI 165          
BLAST of N-acetyltransferase vs. UniProt/SwissProt
Match: sp|Q6P632|NAA20_XENTR (N-alpha-acetyltransferase 20 OS=Xenopus tropicalis OX=8364 GN=naa20 PE=2 SV=1)

HSP 1 Score: 217.624 bits (553), Expect = 2.719e-66
Identity = 105/165 (63.64%), Postives = 126/165 (76.36%), Query Frame = 2
Query: 1277 MTSVRRFKCSDLFKYNNVNLDPLTETFGLNFYLRYLIQWPEFFLAAENYWGRMSGYIMGKAEGHDL--NWHSHVTALSVAPEFRRIGLAGVLMSELENLSIKKDCYFVDLFVRVSNAVAIKMYNCLGYTVYRRVLKYYSGD--EEDEDAFDMRKALPRDVDKKSV 1759
            MTS+R F C DLF++NN+NLDPLTET+G+ FYL+YL  WPE+F+ AE   G + GYIMGKAEG      WH HVTALSVAPEFRR+GLA  LM  LE +S +K  +FVDLFVRVSN VA+ MY  LGY+VYR V++YYS    E DEDA+DMRKAL RD +KKS+
Sbjct:    1 MTSLRPFTCDDLFRFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGKAEGSVAREEWHGHVTALSVAPEFRRLGLAAKLMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSI 165          
BLAST of N-acetyltransferase vs. UniProt/SwissProt
Match: sp|Q7ZXR3|NAA20_XENLA (N-alpha-acetyltransferase 20 OS=Xenopus laevis OX=8355 GN=naa20 PE=2 SV=1)

HSP 1 Score: 216.853 bits (551), Expect = 5.127e-66
Identity = 104/165 (63.03%), Postives = 126/165 (76.36%), Query Frame = 2
Query: 1277 MTSVRRFKCSDLFKYNNVNLDPLTETFGLNFYLRYLIQWPEFFLAAENYWGRMSGYIMGKAEGHDL--NWHSHVTALSVAPEFRRIGLAGVLMSELENLSIKKDCYFVDLFVRVSNAVAIKMYNCLGYTVYRRVLKYYSGD--EEDEDAFDMRKALPRDVDKKSV 1759
            MT++R F C DLF++NN+NLDPLTET+G+ FYL+YL  WPE+F+ AE   G + GYIMGKAEG      WH HVTALSVAPEFRR+GLA  LM  LE +S +K  +FVDLFVRVSN VA+ MY  LGY+VYR V++YYS    E DEDA+DMRKAL RD +KKS+
Sbjct:    1 MTTLRAFTCDDLFRFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGKAEGSVAREEWHGHVTALSVAPEFRRLGLAAKLMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSI 165          
BLAST of N-acetyltransferase vs. UniProt/SwissProt
Match: sp|P61600|NAA20_MOUSE (N-alpha-acetyltransferase 20 OS=Mus musculus OX=10090 GN=Naa20 PE=1 SV=1)

HSP 1 Score: 216.853 bits (551), Expect = 5.236e-66
Identity = 104/165 (63.03%), Postives = 126/165 (76.36%), Query Frame = 2
Query: 1277 MTSVRRFKCSDLFKYNNVNLDPLTETFGLNFYLRYLIQWPEFFLAAENYWGRMSGYIMGKAEGHDL--NWHSHVTALSVAPEFRRIGLAGVLMSELENLSIKKDCYFVDLFVRVSNAVAIKMYNCLGYTVYRRVLKYYSGD--EEDEDAFDMRKALPRDVDKKSV 1759
            MT++R F C DLF++NN+NLDPLTET+G+ FYL+YL  WPE+F+ AE   G + GYIMGKAEG      WH HVTALSVAPEFRR+GLA  LM  LE +S +K  +FVDLFVRVSN VA+ MY  LGY+VYR V++YYS    E DEDA+DMRKAL RD +KKS+
Sbjct:    1 MTTLRAFTCDDLFRFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGKAEGSVAREEWHGHVTALSVAPEFRRLGLAAKLMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSI 165          
BLAST of N-acetyltransferase vs. UniProt/SwissProt
Match: sp|Q2PFM2|NAA20_MACFA (N-alpha-acetyltransferase 20 OS=Macaca fascicularis OX=9541 GN=NAA20 PE=2 SV=1)

HSP 1 Score: 216.853 bits (551), Expect = 5.236e-66
Identity = 104/165 (63.03%), Postives = 126/165 (76.36%), Query Frame = 2
Query: 1277 MTSVRRFKCSDLFKYNNVNLDPLTETFGLNFYLRYLIQWPEFFLAAENYWGRMSGYIMGKAEGHDL--NWHSHVTALSVAPEFRRIGLAGVLMSELENLSIKKDCYFVDLFVRVSNAVAIKMYNCLGYTVYRRVLKYYSGD--EEDEDAFDMRKALPRDVDKKSV 1759
            MT++R F C DLF++NN+NLDPLTET+G+ FYL+YL  WPE+F+ AE   G + GYIMGKAEG      WH HVTALSVAPEFRR+GLA  LM  LE +S +K  +FVDLFVRVSN VA+ MY  LGY+VYR V++YYS    E DEDA+DMRKAL RD +KKS+
Sbjct:    1 MTTLRAFTCDDLFRFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGKAEGSVAREEWHGHVTALSVAPEFRRLGLAAKLMELLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSI 165          
BLAST of N-acetyltransferase vs. TrEMBL
Match: A0A172RVM7 (DAZ-associated protein 2 OS=Schmidtea mediterranea OX=79327 GN=DAZAP2 PE=2 SV=2)

HSP 1 Score: 598.586 bits (1542), Expect = 0.000e+0
Identity = 354/354 (100.00%), Postives = 354/354 (100.00%), Query Frame = 2
Query:   56 MATDDQGNEIGKLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVMSTKHHLEGKEIDPKPCNVNMKGRSRRQLKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQAXXXXXXXXXXKRXXXXXXXXXXXWPQWANPNTAGWPASXXXXXXXXXXXXXXXXXNLWDXXXXXXXXXXXXXXXXXXSSINQHMARGPEMMTSPWDPQMWNPNHLTTSAMQPNQGSNNGWGPMTNGGWDQGHPSNQWNALGGFSMQANSGNDWRSNMSNGMNPSAASLHGQSFAAFKR 1117
            MATDDQGNEIGKLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVMSTKHHLEGKEIDPKPCNVNMKGRSRRQLKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQANRNNNDMANNKRGMGMGSMQGGQWPQWANPNTAGWPASTGWGAWPQAPGGAATATNLWDQGAAGWTGGWGNNMGQNGSSINQHMARGPEMMTSPWDPQMWNPNHLTTSAMQPNQGSNNGWGPMTNGGWDQGHPSNQWNALGGFSMQANSGNDWRSNMSNGMNPSAASLHGQSFAAFKR
Sbjct:    1 MATDDQGNEIGKLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVMSTKHHLEGKEIDPKPCNVNMKGRSRRQLKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQANRNNNDMANNKRGMGMGSMQGGQWPQWANPNTAGWPASTGWGAWPQAPGGAATATNLWDQGAAGWTGGWGNNMGQNGSSINQHMARGPEMMTSPWDPQMWNPNHLTTSAMQPNQGSNNGWGPMTNGGWDQGHPSNQWNALGGFSMQANSGNDWRSNMSNGMNPSAASLHGQSFAAFKR 354          
BLAST of N-acetyltransferase vs. TrEMBL
Match: B1Q3J0 (DAZAP OS=Dugesia japonica OX=6161 GN=Djdmlg PE=2 SV=1)

HSP 1 Score: 554.673 bits (1428), Expect = 0.000e+0
Identity = 326/354 (92.09%), Postives = 339/354 (95.76%), Query Frame = 2
Query:   56 MATDDQGNEIGKLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVMSTKHHLEGKEIDPKPCNVNMKGRSRRQLKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQAXXXXXXXXXXKRXXXXXXXXXXXWPQWANPNTAGWPASXXXXXXXXXXXXXXXXXNLWDXXXXXXXXXXXXXXXXXXSSINQHMARGPEMMTSPWDPQMWNPNHLTTSAMQPNQGSNNGWGPMTNGGWDQGHPSNQWNALGGFSMQANSGNDWRSNMSNGMNPSAASLHGQSFAAFKR 1117
            MATDD GNEIGKLFVGGLHQSTTNE+LKSYFSKFG+VVEASVMMDHRTGRSRGFGYVRY +N+ V KVMSTKHHLEGKEIDPKPCNVNMKGRSRRQLKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQANRNNN+M NNKRGMGMGSMQGGQWPQWANPNT GWP STGWGAWPQAPGGAA A NLWDQGAAGWTGGWGNNMGQNG+SINQHM R  +MM +PWDPQMWNPNHLTTSAMQP+Q SNNGWGPMTNGGWDQGHP+NQWNALGGFSMQ NSGNDWR+NMSNGMNPSAAS+HGQSFAA+KR
Sbjct:    1 MATDDLGNEIGKLFVGGLHQSTTNESLKSYFSKFGDVVEASVMMDHRTGRSRGFGYVRYSDNEAVQKVMSTKHHLEGKEIDPKPCNVNMKGRSRRQLKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQANRNNNEMVNNKRGMGMGSMQGGQWPQWANPNTTGWPTSTGWGAWPQAPGGAAAAPNLWDQGAAGWTGGWGNNMGQNGNSINQHMGRSGDMMPNPWDPQMWNPNHLTTSAMQPSQASNNGWGPMTNGGWDQGHPNNQWNALGGFSMQTNSGNDWRNNMSNGMNPSAASMHGQSFAAYKR 354          
BLAST of N-acetyltransferase vs. TrEMBL
Match: A4V6K1 (DAZ-associated protein (Fragment) OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 428.713 bits (1101), Expect = 4.576e-144
Identity = 267/288 (92.71%), Postives = 275/288 (95.49%), Query Frame = 2
Query:   56 MATDDQGNEIGKLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVMSTKHHLEGKEIDPKPCNVNMKGRSRRQLKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQAXXXXXXXXXXKRXXXXXXXXXXXWPQWANPNTAGWPASXXXXXXXXXXXXXXXXXNLWDXXXXXXXXXXXXXXXXXXSSINQHMARGPEMMTSPWDPQMWNPNHLTTSAMQP 919
            MATDD GNEIGKLFVGGLHQSTTNE+LKSYFSKFG+VVEASVMMDHRTGRSRGFGYVRY +N+ V KVMSTKHHLEGKEIDPKPCNVNMKGRSRRQLKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQANRNNN+M NNKRGMGMGSMQGGQWPQWANPNT GWP STGWGAWPQAPGGAA A NLWDQGAAGWTGGWGNNMGQNG+SINQHM R  +MM +PWDPQMWNPNHLTTSAMQP
Sbjct:    5 MATDDLGNEIGKLFVGGLHQSTTNESLKSYFSKFGDVVEASVMMDHRTGRSRGFGYVRYSDNEAVQKVMSTKHHLEGKEIDPKPCNVNMKGRSRRQLKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQANRNNNEMVNNKRGMGMGSMQGGQWPQWANPNTTGWPTSTGWGAWPQAPGGAAAAPNLWDQGAAGWTGGWGNNMGQNGNSINQHMGRSGDMMPNPWDPQMWNPNHLTTSAMQP 292          
BLAST of N-acetyltransferase vs. TrEMBL
Match: A0A4Y2AE57 (N-alpha-acetyltransferase 20 OS=Araneus ventricosus OX=182803 GN=naa20 PE=4 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 3.745e-73
Identity = 115/161 (71.43%), Postives = 133/161 (82.61%), Query Frame = 2
Query: 1277 MTSVRRFKCSDLFKYNNVNLDPLTETFGLNFYLRYLIQWPEFFLAAENYWGRMSGYIMGKAEGHDLNWHSHVTALSVAPEFRRIGLAGVLMSELENLSIKKDCYFVDLFVRVSNAVAIKMYNCLGYTVYRRVLKYYSGDEEDEDAFDMRKALPRDVDKKSV 1759
            MT++R F C DLF+YNNVNLDPLTET+GL+FYL+YL  WPE+F  AE   G + GYIMGKAEGH  NWH HVTAL+VAPE+RR+GLA  LM+ LE++S KK  YFVDLFVRVSN VA+ MY  LGY+VYRRVL+YYSGD  DEDAFDMRKAL RDV+KKSV
Sbjct:    1 MTTIRPFTCEDLFRYNNVNLDPLTETYGLSFYLQYLAHWPEYFQVAEAPNGDIMGYIMGKAEGHSENWHGHVTALTVAPEYRRLGLAATLMAGLEDISEKKKAYFVDLFVRVSNKVAVDMYKQLGYSVYRRVLEYYSGD-PDEDAFDMRKALSRDVNKKSV 160          
BLAST of N-acetyltransferase vs. TrEMBL
Match: V4B7F4 (N-acetyltransferase domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_199122 PE=4 SV=1)

HSP 1 Score: 241.121 bits (614), Expect = 8.149e-73
Identity = 114/161 (70.81%), Postives = 133/161 (82.61%), Query Frame = 2
Query: 1277 MTSVRRFKCSDLFKYNNVNLDPLTETFGLNFYLRYLIQWPEFFLAAENYWGRMSGYIMGKAEGHDLNWHSHVTALSVAPEFRRIGLAGVLMSELENLSIKKDCYFVDLFVRVSNAVAIKMYNCLGYTVYRRVLKYYSGDEEDEDAFDMRKALPRDVDKKSV 1759
            MT++R F C DLF++NNVNLDPLTET+GL FY++YL  WPE+F  AE+  G++ GYIMGKAEG    WH HVTAL+VAPEFRR+GLA  LM  LEN+S KK CYFVDLFVRVSN VA++MY  L Y+VYRRVL+YYSGD  DEDAFDMRKALPRDVDKKS+
Sbjct:    1 MTTIRPFTCDDLFRFNNVNLDPLTETYGLPFYMQYLAHWPEYFQIAESPDGQIMGYIMGKAEGSGEMWHGHVTALTVAPEFRRLGLAAKLMQNLENISEKKQCYFVDLFVRVSNQVAVEMYKKLEYSVYRRVLEYYSGD-VDEDAFDMRKALPRDVDKKSI 160          
BLAST of N-acetyltransferase vs. Ensembl Cavefish
Match: naa20 (N(alpha)-acetyltransferase 20, NatB catalytic subunit [Source:NCBI gene;Acc:103034291])

HSP 1 Score: 218.009 bits (554), Expect = 2.223e-67
Identity = 105/165 (63.64%), Postives = 126/165 (76.36%), Query Frame = 2
Query: 1277 MTSVRRFKCSDLFKYNNVNLDPLTETFGLNFYLRYLIQWPEFFLAAENYWGRMSGYIMGKAEGHDL--NWHSHVTALSVAPEFRRIGLAGVLMSELENLSIKKDCYFVDLFVRVSNAVAIKMYNCLGYTVYRRVLKYYSGD--EEDEDAFDMRKALPRDVDKKSV 1759
            MT++R F C DLFK+NN+NLDPLTET+G+ FYL+YL  WPE+F+ AE   G + GYIMGKAEG      WH HVTALSVAPEFRR+GLA  LM  LE +S +K  +FVDLFVRVSN VA+ MY  LGY+VYR V++YYS    E DEDA+DMRKAL RD +KKS+
Sbjct:    1 MTTLRAFNCDDLFKFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGKAEGSVAREEWHGHVTALSVAPEFRRLGLAAKLMEMLEEISERKGGFFVDLFVRVSNQVAVNMYKQLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSI 165          
BLAST of N-acetyltransferase vs. Ensembl Cavefish
Match: dazap1 (DAZ associated protein 1 [Source:NCBI gene;Acc:103029889])

HSP 1 Score: 161.384 bits (407), Expect = 2.599e-43
Identity = 83/185 (44.86%), Postives = 113/185 (61.08%), Query Frame = 2
Query:   74 GNEIGKLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVMSTK-HHLEGKEIDPKPCNV---------------NMKGRSRRQLKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQ 580
            G+EIGKLFVGGL  STT ETL++YFS++GEVV+  +M D  T +SRGFG+V++ + + V  V+ TK H+L+G+ IDPKPC                   K  S +  KIFVGGI     E  LRD+F +FG +TE+ ++ D    R RGF F+ F+ E  V Q +N H   I  K+VE+K  EP+
Sbjct:   19 GDEIGKLFVGGLDWSTTQETLRNYFSQYGEVVDCVIMKDKSTNQSRGFGFVKFKDPNCVRTVLDTKPHNLDGRNIDPKPCTPRGMQPEKTRAKDGWKGGKSDSNKSKKIFVGGIPHNCGEPELRDYFNRFGVVTEVVMIYDAEKQRPRGFGFITFEAEQSVDQAVNMHFHDIMGKKVEVKKAEPR 203          
BLAST of N-acetyltransferase vs. Ensembl Cavefish
Match: dazap1 (DAZ associated protein 1 [Source:NCBI gene;Acc:103029889])

HSP 1 Score: 161.77 bits (408), Expect = 3.205e-43
Identity = 83/185 (44.86%), Postives = 113/185 (61.08%), Query Frame = 2
Query:   74 GNEIGKLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVMSTK-HHLEGKEIDPKPCNV---------------NMKGRSRRQLKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQ 580
            G+EIGKLFVGGL  STT ETL++YFS++GEVV+  +M D  T +SRGFG+V++ + + V  V+ TK H+L+G+ IDPKPC                   K  S +  KIFVGGI     E  LRD+F +FG +TE+ ++ D    R RGF F+ F+ E  V Q +N H   I  K+VE+K  EP+
Sbjct:   19 GDEIGKLFVGGLDWSTTQETLRNYFSQYGEVVDCVIMKDKSTNQSRGFGFVKFKDPNCVRTVLDTKPHNLDGRNIDPKPCTPRGMQPEKTRAKDGWKGGKSDSNKSKKIFVGGIPHNCGEPELRDYFNRFGVVTEVVMIYDAEKQRPRGFGFITFEAEQSVDQAVNMHFHDIMGKKVEVKKAEPR 203          
BLAST of N-acetyltransferase vs. Ensembl Cavefish
Match: hnrnpabb (heterogeneous nuclear ribonucleoprotein A/B [Source:NCBI gene;Acc:103033389])

HSP 1 Score: 142.895 bits (359), Expect = 1.067e-37
Identity = 71/168 (42.26%), Postives = 103/168 (61.31%), Query Frame = 2
Query:   80 EIGKLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVMSTKHH-LEGKEIDPKPCNVNMKGRSRRQLKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQ 580
            + GK+FVGGL   T+ + LK YFSKFGEV + ++ MD  TGRSRGFG++ + E   V KV+  K H L+G++IDPK     M  +     KIFVGG+ PE  EE +R++F  FG I  + L  D   ++ RGF F+ F +E+ VK+++     T+   + EIK  +P+
Sbjct:   51 DAGKMFVGGLSWDTSKKDLKDYFSKFGEVTDCTIKMDSNTGRSRGFGFILFKEAASVEKVLQQKEHRLDGRQIDPKKA---MAMKKDPVKKIFVGGLNPETTEEKIREYFGAFGEIESIELPTDPKTNKRRGFVFITFKEESAVKKIMEKKYHTVNGSKCEIKIAQPK 215          
BLAST of N-acetyltransferase vs. Ensembl Cavefish
Match: hnrnpabb (heterogeneous nuclear ribonucleoprotein A/B [Source:NCBI gene;Acc:103033389])

HSP 1 Score: 143.28 bits (360), Expect = 1.370e-37
Identity = 71/168 (42.26%), Postives = 103/168 (61.31%), Query Frame = 2
Query:   80 EIGKLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVMSTKHH-LEGKEIDPKPCNVNMKGRSRRQLKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQ 580
            + GK+FVGGL   T+ + LK YFSKFGEV + ++ MD  TGRSRGFG++ + E   V KV+  K H L+G++IDPK      K   +   KIFVGG+ PE  EE +R++F  FG I  + L  D   ++ RGF F+ F +E+ VK+++     T+   + EIK  +P+
Sbjct:   51 DAGKMFVGGLSWDTSKKDLKDYFSKFGEVTDCTIKMDSNTGRSRGFGFILFKEAASVEKVLQQKEHRLDGRQIDPKKAMAMKKDPVK---KIFVGGLNPETTEEKIREYFGAFGEIESIELPTDPKTNKRRGFVFITFKEESAVKKIMEKKYHTVNGSKCEIKIAQPK 215          
BLAST of N-acetyltransferase vs. Ensembl Sea Lamprey
Match: naa20 (N(alpha)-acetyltransferase 20, NatB catalytic subunit [Source:NCBI gene;Acc:541516])

HSP 1 Score: 197.978 bits (502), Expect = 2.374e-60
Identity = 103/162 (63.58%), Postives = 120/162 (74.07%), Query Frame = 2
Query: 1295 FKCSDLFK---YNNVNLDPLTETFGLNFYLRYLIQWPEFFLAAENYWGRMSGYIMGKAEGH--DLNWHSHVTALSVAPEFRRIGLAGVLMSELENLSIKKDCYFVDLFVRVSNAVAIKMYNCLGYTVYRRVLKYYSGD--EEDEDAFDMRKALPRDVDKKSV 1759
            F  S  F+    N +NLDPLTET+G+ FYL+YL  WPE+FL AE+  G + GYIMGKAEG      WH HVTALSVAP+FRR+GLA  LM  LE +S KK C+FVDLFVRVSN VA+ MY  LGY+VYR VL+YYS    E DEDA+DMRKAL RDV+KKSV
Sbjct:    7 FNLSGFFRNCMSNIINLDPLTETYGIPFYLQYLAHWPEYFLLAESASGDIMGYIMGKAEGSVSREEWHGHVTALSVAPDFRRLGLAAKLMELLEEISEKKGCFFVDLFVRVSNQVAVSMYRRLGYSVYRTVLEYYSASNGEADEDAYDMRKALSRDVNKKSV 168          
BLAST of N-acetyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004893.1 (pep scaffold:Pmarinus_7.0:GL479484:4:2056:-1 gene:ENSPMAG00000004449.1 transcript:ENSPMAT00000004893.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.538 bits (275), Expect = 9.233e-28
Identity = 65/180 (36.11%), Postives = 101/180 (56.11%), Query Frame = 2
Query:   56 MATDDQGNEIGKLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVMSTK-HHLEGKEIDPKPC---NVNMK-GRSRRQLKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQ 580
            M  D +  +  KLFVGGL   TT E L+ YF ++G + +  VM D ++ RSRGFG+V +     V   MS + H ++G+ ++PK       +M+ G      KIFVGGI  + +EE LRD+F+++G I  + +M ++   + RGFAFV F+D   V +++     TI     EI+   P+
Sbjct:    1 MHKDREPEQFRKLFVGGLSFETTEEGLRQYFEQWGSLTDCVVMKDTQSKRSRGFGFVTFSSMSEVDAAMSARPHKIDGRMVEPKRAVSREDSMRPGAHLSVKKIFVGGIKDDTDEEHLRDYFEKYGRIEIVEVMTERESGKKRGFAFVTFNDHDPVDKIVVQKYHTINGHNCEIRKALPK 180          
BLAST of N-acetyltransferase vs. Ensembl Sea Lamprey
Match: HNRNPA2B1 (heterogeneous nuclear ribonucleoprotein A2/B1 [Source:HGNC Symbol;Acc:HGNC:5033])

HSP 1 Score: 107.842 bits (268), Expect = 1.315e-26
Identity = 58/167 (34.73%), Postives = 96/167 (57.49%), Query Frame = 2
Query:   77 NEIGKLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVMSTK-HHLEGKEIDPK---PCNVNMKGRSRRQLKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIK 565
             ++ KLF+GGL   TT E+L+ Y+ ++G +V+  VM D  + RSRGFG++ Y   + V   M  + H ++G+ ++ K   P + +  G      K+FVGGI    +E  LRD+F +FG +  + ++ D+   + RGFAFV FDD   V Q++     TI   ++E++
Sbjct:   11 EQMRKLFIGGLSFETTEESLREYYEQWGTIVDCVVMKDPSSKRSRGFGFITYSVMEEVNSAMQARPHTVDGRVVEAKRAVPRDDSRPGIQVTVKKLFVGGIKDNTDESHLRDYFSKFGRVESVDMVTDKQTGKKRGFAFVTFDDYDPVDQIVFQKFHTINCHKLEVR 177          

HSP 2 Score: 56.6102 bits (135), Expect = 3.405e-9
Identity = 27/78 (34.62%), Postives = 45/78 (57.69%), Query Frame = 2
Query:  347 KIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQ 580
            K+F+GG++ E  EE+LR++++Q+G I +  +MKD S  R RGF F+ +     V   +     T+  + VE K   P+
Sbjct:   15 KLFIGGLSFETTEESLREYYEQWGTIVDCVVMKDPSSKRSRGFGFITYSVMEEVNSAMQARPHTVDGRVVEAKRAVPR 92          
BLAST of N-acetyltransferase vs. Ensembl Sea Lamprey
Match: HNRNPA0 (heterogeneous nuclear ribonucleoprotein A0 [Source:HGNC Symbol;Acc:HGNC:5030])

HSP 1 Score: 109.768 bits (273), Expect = 2.228e-26
Identity = 57/164 (34.76%), Postives = 93/164 (56.71%), Query Frame = 2
Query:   89 KLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVMSTK-HHLEGKEIDPKPC----NVNMKGRSRRQLKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIK 565
            KLF+GGL   TT E+++ +F ++G + +  VM D  T RSRGFG+V Y+  + V   M  + HHL+G+ ++ K      +    G   +  KIFVGGI    +E+ LRD+F ++G +  + +M+D+   + RGF FV F D   V +++     TI   + E++
Sbjct:   34 KLFIGGLSFETTEESMQKHFEQWGTLTDCVVMRDPHTKRSRGFGFVTYMSAEEVDAAMEVRPHHLDGRVVEAKRAISREDSLKPGAHLKVKKIFVGGIKDNTDEDHLRDYFSEYGMVESVDVMEDRQSGKKRGFGFVTFSDHDAVDKVVVQKYHTINGHKAEVR 197          

HSP 2 Score: 63.5438 bits (153), Expect = 4.771e-11
Identity = 27/66 (40.91%), Postives = 45/66 (68.18%), Query Frame = 2
Query:   80 EIGKLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVMSTKHH 277
            ++ K+FVGG+  +T  + L+ YFS++G V    VM D ++G+ RGFG+V + ++D V KV+  K+H
Sbjct:  122 KVKKIFVGGIKDNTDEDHLRDYFSEYGMVESVDVMEDRQSGKKRGFGFVTFSDHDAVDKVVVQKYH 187          

HSP 3 Score: 49.6766 bits (117), Expect = 1.289e-6
Identity = 20/51 (39.22%), Postives = 35/51 (68.63%), Query Frame = 2
Query:  338 RQLKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAF 490
            +Q K+F+GG++ E  EE+++  F+Q+G +T+  +M+D    R RGF FV +
Sbjct:   31 QQRKLFIGGLSFETTEESMQKHFEQWGTLTDCVVMRDPHTKRSRGFGFVTY 81          
BLAST of N-acetyltransferase vs. Ensembl Sea Lamprey
Match: HNRNPA0 (heterogeneous nuclear ribonucleoprotein A0 [Source:HGNC Symbol;Acc:HGNC:5030])

HSP 1 Score: 101.293 bits (251), Expect = 9.202e-25
Identity = 57/164 (34.76%), Postives = 95/164 (57.93%), Query Frame = 2
Query:   89 KLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVMSTK-HHLEGKEIDPKPC---NVNMK-GRSRRQLKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIK 565
            KLF+GGL   TT ++++ +F ++G + +  VM D  T RSRGFG+V Y   + V   M  + HHL+ + ++ K       ++K G   +  KIFVGGI  + +E+ LR++F+ +G++    +M+D+S  + RGF FV F D   V ++I     TI   + E++
Sbjct:   10 KLFIGGLSFETTEDSMRKHFEQWGTLTDCVVMRDPHTKRSRGFGFVTYTCPEEVDAAMDARPHHLDNRVVEAKRAISREDSLKPGAHLKVKKIFVGGIRDDTDEQHLREYFQVYGDVEAAEVMEDRSTGKKRGFGFVTFSDHDTVDKVIVQKYHTINGHKAEVR 173          

HSP 2 Score: 63.929 bits (154), Expect = 7.754e-12
Identity = 28/66 (42.42%), Postives = 43/66 (65.15%), Query Frame = 2
Query:   80 EIGKLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVMSTKHH 277
            ++ K+FVGG+   T  + L+ YF  +G+V  A VM D  TG+ RGFG+V + ++D V KV+  K+H
Sbjct:   98 KVKKIFVGGIRDDTDEQHLREYFQVYGDVEAAEVMEDRSTGKKRGFGFVTFSDHDTVDKVIVQKYH 163          

HSP 3 Score: 49.2914 bits (116), Expect = 6.886e-7
Identity = 25/76 (32.89%), Postives = 44/76 (57.89%), Query Frame = 2
Query:  338 RQLKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIK 565
            +Q K+F+GG++ E  E+++R  F+Q+G +T+  +M+D    R RGF FV +     V   ++     + N+ VE K
Sbjct:    7 QQRKLFIGGLSFETTEDSMRKHFEQWGTLTDCVVMRDPHTKRSRGFGFVTYTCPEEVDAAMDARPHHLDNRVVEAK 82          
BLAST of N-acetyltransferase vs. Ensembl Yeast
Match: NAT3 (Catalytic subunit of the NatB N-terminal acetyltransferase; NatB catalyzes acetylation of the amino-terminal methionine residues of all proteins beginning with Met-Asp or Met-Glu and of some proteins beginning with Met-Asn or Met-Met [Source:SGD;Acc:S000006335])

HSP 1 Score: 158.303 bits (399), Expect = 1.243e-45
Identity = 80/177 (45.20%), Postives = 113/177 (63.84%), Query Frame = 2
Query: 1277 MTSVRRFKCSDLFKYNNVNLDPLTETFGLNFYLRYLIQWPEFFLAAE------NYWGRMSGYIMGKAEGHDLNWHSHVTALSVAPEFRRIGLAGVLMSELENLS--IKKDCYFVDLFVRVSNAVAIKMYNCLGYTVYRRVLKYYSGDE-----------EDEDAFDMRKALPRDVDK 1750
            MT+++ F+  DLFK NNVNLD LTE F L FY  Y+I WP+ F  +        +   +SGY+M K EG    WH+H+TA++VAP FRRI LA  L + LE ++  +  +  F+DLFV+ +N +AIK+Y  LGY+VYRRV+ YY+  E           +++DAFDMRKA+ RD ++
Sbjct:    1 MTTIQPFEPVDLFKTNNVNLDILTENFPLEFYFEYMIIWPDLFFKSSEMTVDPTFKHNISGYMMAKTEGKTTEWHTHITAVTVAPRFRRISLASKLCNTLETMTDVMPHEVNFIDLFVKCNNQLAIKLYEKLGYSVYRRVVGYYNSAEDGYPDTLKKVDDNKDAFDMRKAMARDRNR 177          
BLAST of N-acetyltransferase vs. Ensembl Yeast
Match: HRP1 (Subunit of cleavage factor I; cleavage factor I is a five-subunit complex required for the cleavage and polyadenylation of pre-mRNA 3' ends; RRM-containing heteronuclear RNA binding protein and hnRNPA/B family member that binds to poly (A) signal sequences; required for genome stability [Source:SGD;Acc:S000005483])

HSP 1 Score: 129.413 bits (324), Expect = 2.639e-32
Identity = 64/171 (37.43%), Postives = 99/171 (57.89%), Query Frame = 2
Query:   68 DQGNEIGKLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVMSTKHHLEGKEIDPKPCNVNMKGRSRRQLKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQ 580
            D   E  K+F+GGL+  TT + L+ YF K+G V +  +M D  TGRSRGFG++ + +   V +V+ T+H L+GK IDPK      +    +  KIFVGGI P+   +   +FF Q+G I +  LM D+   + RGF FV +D    V ++  +  +   ++++EIK  EP+
Sbjct:  153 DLSKESCKMFIGGLNWDTTEDNLREYFGKYGTVTDLKIMKDPATGRSRGFGFLSFEKPSSVDEVVKTQHILDGKVIDPK--RAIPRDEQDKTGKIFVGGIGPDVRPKEFEEFFSQWGTIIDAQLMLDKDTGQSRGFGFVTYDSADAVDRVCQNKFIDFKDRKIEIKRAEPR 321          
BLAST of N-acetyltransferase vs. Ensembl Yeast
Match: PAB1 (Poly(A) binding protein; part of the 3'-end RNA-processing complex, mediates interactions between the 5' cap structure and the 3' mRNA poly(A) tail, involved in control of poly(A) tail length, interacts with translation factor eIF-4G; stimulates, but is not required for the deadenylation activity of the Pan2p-Pan3p poly(A)-ribonuclease complex [Source:SGD;Acc:S000000967])

HSP 1 Score: 63.5438 bits (153), Expect = 4.923e-11
Identity = 47/163 (28.83%), Postives = 80/163 (49.08%), Query Frame = 2
Query:   86 GKLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVMSTKH--HLEGKEIDPKPCNVNMKGRSRRQLK--------IFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAF---DDEAVVKQLINDHIL 535
            G +F+  LH    N+ L   FS FG+++ + +  D   G+S+GFG+V + E     + +   +   L G+EI   P +++ K R   QL+        ++V  I  E  +E  ++ F +FG I   +L KD  G + +GF FV +   +D     + +ND  L
Sbjct:  126 GNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDE-NGKSKGFGFVHFEEEGAAKEAIDALNGMLLNGQEIYVAP-HLSRKERD-SQLEETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSASLEKDADG-KLKGFGFVNYEKHEDAVKAVEALNDSEL 284          

HSP 2 Score: 60.4622 bits (145), Expect = 4.647e-10
Identity = 42/154 (27.27%), Postives = 69/154 (44.81%), Query Frame = 2
Query:   77 NEIGKLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVMSTKHHLEGKEIDPKPCNV-----NMKGRSRRQLKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLIN 523
            N    L+VG L  S +   L   FS  G V    V  D  T  S G+ YV + +++   K +     L    I  + C +     +   R +    IF+  + P+ + + L D F  FG+I    +  D++G + +GF FV F++E   K+ I+
Sbjct:   35 NSSASLYVGDLEPSVSEAHLYDIFSPIGSVSSIRVCRDAITKTSLGYAYVNFNDHEAGRKAI---EQLNYTPIKGRLCRIMWSQRDPSLRKKGSGNIFIKNLHPDIDNKALYDTFSVFGDILSSKIATDENG-KSKGFGFVHFEEEGAAKEAID 184          

HSP 3 Score: 58.151 bits (139), Expect = 2.227e-9
Identity = 40/157 (25.48%), Postives = 76/157 (48.41%), Query Frame = 2
Query:   92 LFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVMSTKHHLEGKEIDPKPCNVNMKGRSRRQ------------------------LKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAF 490
            L+V  ++  TT+E  +  F+KFG +V AS+  D   G+ +GFG+V Y +++  +K +     L   E++ +   V   GR++++                        + +FV  +    ++E L + F  +G IT   +M+ ++G + +GF FV F
Sbjct:  221 LYVKNINSETTDEQFQELFAKFGPIVSASLEKDA-DGKLKGFGFVNYEKHEDAVKAVEA---LNDSELNGEKLYV---GRAQKKNERMHVLKKQYEAYRLEKMAKYQGVNLFVKNLDDSVDDEKLEEEFAPYGTITSAKVMRTENG-KSKGFGFVCF 369          
BLAST of N-acetyltransferase vs. Ensembl Yeast
Match: NSR1 (Nucleolar protein that binds nuclear localization sequences; required for pre-rRNA processing and ribosome biogenesis; binds to single stranded telomeric DNA and mRNA; methylated by Hmt1p; interaction with Top1p and nucleolar localization are negatively regulated by polyphosphorylation [Source:SGD;Acc:S000003391])

HSP 1 Score: 62.003 bits (149), Expect = 1.036e-10
Identity = 43/169 (25.44%), Postives = 78/169 (46.15%), Query Frame = 2
Query:   65 DDQGNEIGKLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVMSTKHHLEGKEIDPKPCNVNMK-----GRSRRQLK-----------IFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLIN 523
            +++  E   +FVG L  S  +E LK  F   G V+ A V+ +  T RSRG+GYV +       K +     ++GKEID +P N +M      G + R  K           +F+G ++   + + + + F + G +  + +       + +GF +V F +    K+ ++
Sbjct:  161 NEETEEPATIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAI---QEMQGKEIDGRPINCDMSTSKPAGNNDRAKKFGDTPSEPSDTLFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALD 326          
BLAST of N-acetyltransferase vs. Ensembl Yeast
Match: PUB1 (Poly (A)+ RNA-binding protein; abundant mRNP-component protein that binds mRNA and is required for stability of many mRNAs; component of glucose deprivation induced stress granules, involved in P-body-dependent granule assembly; implicated in regulation of translation; carries Q/N-rich domain at C- terminus, identified as candidate prion; human homolog Tia1 is critical for normal synaptic plasticity; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004961])

HSP 1 Score: 60.077 bits (144), Expect = 4.465e-10
Identity = 38/138 (27.54%), Postives = 66/138 (47.83%), Query Frame = 2
Query:   92 LFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVMSTKHHLEGKEIDPKPCNVN-----MKGRSRRQLKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAF 490
            L+VG L ++ T + LK YF   G +    +M+D +  ++  + +V Y ++      + T   L GK+I+     +N      +  S     +FVG +    ++ETLR+ FK F +     +M D      RG+ FV+F
Sbjct:   77 LYVGNLDKAITEDILKQYFQVGGPIANIKIMID-KNNKNVNYAFVEYHQSHDANIALQT---LNGKQIENNIVKINWAFQSQQSSSDDTFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSF 210          

HSP 2 Score: 53.1434 bits (126), Expect = 7.235e-8
Identity = 28/87 (32.18%), Postives = 49/87 (56.32%), Query Frame = 2
Query:   59 ATDDQGNEIGKLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVMSTKHHLEGKEIDPKPCNVN 319
            ++DD  N    LFVG L+ +  +ETL++ F  F   +   VM D +TG SRG+G+V +   D     M +   ++G++++ +P  +N
Sbjct:  157 SSDDTFN----LFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDS---MQGQDLNGRPLRIN 236          
BLAST of N-acetyltransferase vs. Ensembl Nematostella
Match: EDO49530 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGI6])

HSP 1 Score: 226.868 bits (577), Expect = 2.966e-71
Identity = 110/163 (67.48%), Postives = 130/163 (79.75%), Query Frame = 2
Query: 1277 MTSVRRFKCSDLFKYNNVNLDPLTETFGLNFYLRYLIQWPEFFLAAENYWGRMSGYIMGKAEGHDLN--WHSHVTALSVAPEFRRIGLAGVLMSELENLSIKKDCYFVDLFVRVSNAVAIKMYNCLGYTVYRRVLKYYSGDEEDEDAFDMRKALPRDVDKKSV 1759
            MT++R FKC DL  +NNVNLDPLTET+GL+FYL+YL +WPE+F   E+  G++ GYIMGKAEG +    WH HVTA+SVAPEFRR+GLA  LMS LEN+S  K+ +FVDLFVRVSN VA+ MY  LGY VYR VL+YYSGD  DEDA+DMRKAL RD DKKSV
Sbjct:    1 MTTIRPFKCEDLLNFNNVNLDPLTETYGLSFYLQYLARWPEYFQVLESPTGQIMGYIMGKAEGSEAQEQWHGHVTAVSVAPEFRRLGLAAKLMSSLENISEIKEGFFVDLFVRVSNKVAVAMYKQLGYVVYRTVLEYYSGD-PDEDAYDMRKALSRDKDKKSV 162          
BLAST of N-acetyltransferase vs. Ensembl Nematostella
Match: EDO38417 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCX6])

HSP 1 Score: 137.887 bits (346), Expect = 2.120e-36
Identity = 76/179 (42.46%), Postives = 105/179 (58.66%), Query Frame = 2
Query:   56 MATDDQGNEIGKLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYL---ENDGVLKVMSTKHHLEGKEIDPKPCNVNMKGRSRRQLKIFVGGIAPEHNEETLRDFF-KQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQ 580
            M  DD   +IGKLFVGGL   TT E+LK YFSK+GE+V   + MD  TGR RGF +V++    E D VL  +   H L+G+ IDPKP     K    R  KIFVGG+ PE ++E +R++F K +  + E+  + + S +R RGF FV+FD E  V ++       I   +VE+K   P+
Sbjct:   22 MTKDD---DIGKLFVGGLSYETTKESLKEYFSKYGELVGVDIKMDALTGRPRGFAFVQFKHQSEADAVLNQVD-PHVLDGRTIDPKPAAPIGKPPHLRVKKIFVGGLKPETSDEKIREYFGKAYAPVKEIEYITEHSSNRRRGFCFVSFDSEDTVDKICETQFHNIEGNKVEVKRALPK 196          
BLAST of N-acetyltransferase vs. Ensembl Nematostella
Match: EDO39879 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8S5])

HSP 1 Score: 125.176 bits (313), Expect = 3.013e-33
Identity = 70/168 (41.67%), Postives = 100/168 (59.52%), Query Frame = 2
Query:   89 KLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVM-STKHHLEGKEIDPK---PCNVNMKGRSRRQLKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQ 580
            K+F+GGL   TT E L+ +F KFGE+ E  VM D  T RSRGFG++ + +   V  V+ S    L+GK+IDPK   P     K  +  + KIF+GG++   +EE ++ +F QFG ITE  LM D++  RHRGF FV F+ E    +  +     I NK+VE+K  +P+
Sbjct:    1 KMFIGGLSWQTTAEGLRQHFEKFGELKECVVMRDPVTKRSRGFGFLTFKDPKAVDVVLNSGAQELDGKKIDPKLAVPKRAPAKMVTTTK-KIFIGGLSTNTSEEDMKKYFSQFGKITETMLMFDKATQRHRGFGFVTFESENSADKACDTQYHLINNKKVEVKKAQPK 167          
BLAST of N-acetyltransferase vs. Ensembl Nematostella
Match: EDO33389 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSE1])

HSP 1 Score: 112.464 bits (280), Expect = 6.490e-29
Identity = 63/163 (38.65%), Postives = 89/163 (54.60%), Query Frame = 2
Query:   89 KLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVMSTK-HHLEGKEIDPKPCNVNMKGRSRRQ------LKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQV 556
            K+FVGGL  ST +  L+ YF K+GEV +  +M D  T RSR FG++ + +   V  VM  K H L+GK IDPKP      G+   Q       KIFVGG+A   +++ L D+F  +G +  + LM D    + RGF FV F+ +  V +  ++H   I  K V
Sbjct:    2 KIFVGGLAISTDSAGLQGYFEKYGEVTDCVLMTDPVTKRSRCFGFITFRDPSVVQNVMDDKPHQLDGKMIDPKPAVPRGPGQGPPQGNQNNEFKIFVGGLAHSTSKQDLEDYFTAYGKVVSVNLMVDPQTQKMRGFGFVTFESKDSVTKAADEHYHQINGKTV 164          

HSP 2 Score: 62.3882 bits (150), Expect = 1.806e-11
Identity = 31/77 (40.26%), Postives = 49/77 (63.64%), Query Frame = 2
Query:   68 DQGNEIGKLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVMSTKHH-LEGKEI 295
            +Q NE  K+FVGGL  ST+ + L+ YF+ +G+VV  ++M+D +T + RGFG+V +   D V K     +H + GK +
Sbjct:   89 NQNNEF-KIFVGGLAHSTSKQDLEDYFTAYGKVVSVNLMVDPQTQKMRGFGFVTFESKDSVTKAADEHYHQINGKTV 164          

HSP 3 Score: 60.4622 bits (145), Expect = 8.869e-11
Identity = 27/78 (34.62%), Postives = 46/78 (58.97%), Query Frame = 2
Query:  347 KIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQ 580
            KIFVGG+A   +   L+ +F+++G +T+  LM D    R R F F+ F D +VV+ +++D    +  K ++ KP  P+
Sbjct:    2 KIFVGGLAISTDSAGLQGYFEKYGEVTDCVLMTDPVTKRSRCFGFITFRDPSVVQNVMDDKPHQLDGKMIDPKPAVPR 79          
BLAST of N-acetyltransferase vs. Ensembl Nematostella
Match: EDO49349 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG33])

HSP 1 Score: 111.694 bits (278), Expect = 1.388e-28
Identity = 67/177 (37.85%), Postives = 104/177 (58.76%), Query Frame = 2
Query:   89 KLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVMSTKHH-LEGKEIDPKPCNVNMKGRS----RRQLKIFVGGIAPEHNEETLRDFFKQF------GNITELTLMKDQSG-HRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQA 583
            K+F+GGL+ +TT E LK YFS++G +V+  +M   R GRSRGFG+V Y  +D V +V+  K H L+ +EI+PK      +  +     +  KIFVGG+A    EE ++++F         G + ++ L +D+    R RGFAFV FD++ +V+++       I  KQ E+K  EPQ+
Sbjct:    1 KIFIGGLNWNTTEEGLKDYFSQWGTIVDCVIM--KRDGRSRGFGFVTYESSDSVNEVLKKKDHVLDDREIEPKRSVPRDESGAPEAMSKTRKIFVGGLASTTVEEDIKEYFNSLCRKNGMGEVIDVDLKRDRDNPKRIRGFAFVTFDNDEIVEKVCAMKYHEIRMKQCEVKKAEPQS 175          
BLAST of N-acetyltransferase vs. Ensembl Medaka
Match: naa20 (N(alpha)-acetyltransferase 20, NatB catalytic subunit [Source:NCBI gene;Acc:101164367])

HSP 1 Score: 217.238 bits (552), Expect = 4.392e-67
Identity = 105/165 (63.64%), Postives = 126/165 (76.36%), Query Frame = 2
Query: 1277 MTSVRRFKCSDLFKYNNVNLDPLTETFGLNFYLRYLIQWPEFFLAAENYWGRMSGYIMGKAEGHDL--NWHSHVTALSVAPEFRRIGLAGVLMSELENLSIKKDCYFVDLFVRVSNAVAIKMYNCLGYTVYRRVLKYYSGD--EEDEDAFDMRKALPRDVDKKSV 1759
            MT++R F C DLFK+NN+NLDPLTET+G+ FYL+YL  WPE+F+ AE   G + GYIMGKAEG      WH HVTALSVAPEFRR+GLA  LM  LE +S +K  +FVDLFVRVSN VA+ MY  LGY+VYR V++YYS    E DEDA+DMRKAL RD +KKS+
Sbjct:    1 MTTLRPFTCDDLFKFNNINLDPLTETYGIPFYLQYLAHWPEYFIVAEAPGGELMGYIMGKAEGSVAREEWHGHVTALSVAPEFRRLGLAAKLMEMLEEISERKGGFFVDLFVRVSNQVAVNMYRRLGYSVYRTVIEYYSASNGEPDEDAYDMRKALSRDTEKKSI 165          
BLAST of N-acetyltransferase vs. Ensembl Medaka
Match: dazap1 (DAZ associated protein 1 [Source:NCBI gene;Acc:101166783])

HSP 1 Score: 161.384 bits (407), Expect = 1.802e-43
Identity = 82/185 (44.32%), Postives = 113/185 (61.08%), Query Frame = 2
Query:   74 GNEIGKLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVMSTK-HHLEGKEIDPKPCNVN---------------MKGRSRRQLKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQ 580
            G+E+GKLFVGGL  STT ETL++YFS++GEVV+  +M D  T +SRGFG+V++ + + V  V+ TK H+L+G+ IDPKPC                   K  S +  KIFVGGI     E  LRD+F +FG +TE+ ++ D    R RGF F+ F+ E  V Q +N H   I  K+VE+K  EP+
Sbjct:    7 GDEVGKLFVGGLDWSTTQETLRNYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVRTVLETKPHNLDGRNIDPKPCTPRGMQPEKSRTKEGWKGSKADSNKSKKIFVGGIPHNCGEPELRDYFNRFGVVTEVVMIYDAEKQRPRGFGFITFEAEQSVDQAVNMHFHDIMGKKVEVKKAEPR 191          
BLAST of N-acetyltransferase vs. Ensembl Medaka
Match: dazap1 (DAZ associated protein 1 [Source:NCBI gene;Acc:101166783])

HSP 1 Score: 161.77 bits (408), Expect = 2.609e-43
Identity = 82/185 (44.32%), Postives = 113/185 (61.08%), Query Frame = 2
Query:   74 GNEIGKLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVMSTK-HHLEGKEIDPKPCNVN---------------MKGRSRRQLKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQ 580
            G+E+GKLFVGGL  STT ETL++YFS++GEVV+  +M D  T +SRGFG+V++ + + V  V+ TK H+L+G+ IDPKPC                   K  S +  KIFVGGI     E  LRD+F +FG +TE+ ++ D    R RGF F+ F+ E  V Q +N H   I  K+VE+K  EP+
Sbjct:    7 GDEVGKLFVGGLDWSTTQETLRNYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVRTVLETKPHNLDGRNIDPKPCTPRGMQPEKSRTKEGWKGSKADSNKSKKIFVGGIPHNCGEPELRDYFNRFGVVTEVVMIYDAEKQRPRGFGFITFEAEQSVDQAVNMHFHDIMGKKVEVKKAEPR 191          
BLAST of N-acetyltransferase vs. Ensembl Medaka
Match: hnrnpabb (heterogeneous nuclear ribonucleoprotein A/B [Source:NCBI gene;Acc:101170948])

HSP 1 Score: 144.05 bits (362), Expect = 4.817e-38
Identity = 74/169 (43.79%), Postives = 106/169 (62.72%), Query Frame = 2
Query:   77 NEIGKLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVMSTKHH-LEGKEIDPKPCNVNMKGRSRRQLKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQ 580
            ++ GK+FVGGL   T+ + LK YFSKFGEV + ++ MD  TGRSRGFG+V + ++  V KV+  K H L+G++IDPK   + MK  + R  KIFVGG+ PE  EE +R++F  FG I  + L  D    + RGF F+ + DEA VK+ +     TI   + E+K  +P+
Sbjct:   53 DDAGKMFVGGLSWDTSKKDLKDYFSKFGEVSDCTIKMDSNTGRSRGFGFVLFKDSSSVDKVLEQKEHRLDGRQIDPKRA-MAMKKEAVR--KIFVGGLNPEATEEAIREYFGAFGEIETIELPIDPKSKKRRGFIFITYKDEASVKKCLEKKYHTIEGGRCELKIAQPK 218          
BLAST of N-acetyltransferase vs. Ensembl Medaka
Match: msi1 (musashi RNA binding protein 1 [Source:NCBI gene;Acc:101173434])

HSP 1 Score: 142.51 bits (358), Expect = 3.326e-37
Identity = 76/181 (41.99%), Postives = 112/181 (61.88%), Query Frame = 2
Query:   56 MATDDQGNEIGKLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVMS-TKHHLEGKEIDPKPCNVNMKGRSRRQL-----KIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQ 580
            ++  D  ++  K+F+GGL   TT E LK YF K+GEV E  VM D  T RSRGFG+V +++  GV KV++ ++H L+ K IDPK   V    R++ +L     KIFVGG++     E ++ +F QFG + +  LM D++ +RHRGF FV F++E VV+++   H   I NK VE K  +P+
Sbjct:   10 LSNADSPHDPCKMFIGGLSWQTTQEGLKEYFCKYGEVKECMVMRDPVTKRSRGFGFVTFVDQAGVDKVLAQSRHELDSKTIDPK---VAFPRRAQPKLVTRTKKIFVGGLSVNTTIEDVKQYFDQFGKVDDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPK 187          
BLAST of N-acetyltransferase vs. Planmine SMEST
Match: SMESG000026342.1 (SMESG000026342.1)

HSP 1 Score: 597.816 bits (1540), Expect = 0.000e+0
Identity = 353/354 (99.72%), Postives = 354/354 (100.00%), Query Frame = 2
Query:   56 MATDDQGNEIGKLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVMSTKHHLEGKEIDPKPCNVNMKGRSRRQLKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQAXXXXXXXXXXKRXXXXXXXXXXXWPQWANPNTAGWPASXXXXXXXXXXXXXXXXXNLWDXXXXXXXXXXXXXXXXXXSSINQHMARGPEMMTSPWDPQMWNPNHLTTSAMQPNQGSNNGWGPMTNGGWDQGHPSNQWNALGGFSMQANSGNDWRSNMSNGMNPSAASLHGQSFAAFKR 1117
            MATDDQGNEIGKLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGV+KVMSTKHHLEGKEIDPKPCNVNMKGRSRRQLKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQANRNNNDMANNKRGMGMGSMQGGQWPQWANPNTAGWPASTGWGAWPQAPGGAATATNLWDQGAAGWTGGWGNNMGQNGSSINQHMARGPEMMTSPWDPQMWNPNHLTTSAMQPNQGSNNGWGPMTNGGWDQGHPSNQWNALGGFSMQANSGNDWRSNMSNGMNPSAASLHGQSFAAFKR
Sbjct:    1 MATDDQGNEIGKLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVIKVMSTKHHLEGKEIDPKPCNVNMKGRSRRQLKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQANRNNNDMANNKRGMGMGSMQGGQWPQWANPNTAGWPASTGWGAWPQAPGGAATATNLWDQGAAGWTGGWGNNMGQNGSSINQHMARGPEMMTSPWDPQMWNPNHLTTSAMQPNQGSNNGWGPMTNGGWDQGHPSNQWNALGGFSMQANSGNDWRSNMSNGMNPSAASLHGQSFAAFKR 354          
BLAST of N-acetyltransferase vs. Planmine SMEST
Match: SMESG000026353.1 (SMESG000026353.1)

HSP 1 Score: 336.65 bits (862), Expect = 1.738e-113
Identity = 161/161 (100.00%), Postives = 161/161 (100.00%), Query Frame = 2
Query: 1277 MTSVRRFKCSDLFKYNNVNLDPLTETFGLNFYLRYLIQWPEFFLAAENYWGRMSGYIMGKAEGHDLNWHSHVTALSVAPEFRRIGLAGVLMSELENLSIKKDCYFVDLFVRVSNAVAIKMYNCLGYTVYRRVLKYYSGDEEDEDAFDMRKALPRDVDKKSV 1759
            MTSVRRFKCSDLFKYNNVNLDPLTETFGLNFYLRYLIQWPEFFLAAENYWGRMSGYIMGKAEGHDLNWHSHVTALSVAPEFRRIGLAGVLMSELENLSIKKDCYFVDLFVRVSNAVAIKMYNCLGYTVYRRVLKYYSGDEEDEDAFDMRKALPRDVDKKSV
Sbjct:    1 MTSVRRFKCSDLFKYNNVNLDPLTETFGLNFYLRYLIQWPEFFLAAENYWGRMSGYIMGKAEGHDLNWHSHVTALSVAPEFRRIGLAGVLMSELENLSIKKDCYFVDLFVRVSNAVAIKMYNCLGYTVYRRVLKYYSGDEEDEDAFDMRKALPRDVDKKSV 161          
BLAST of N-acetyltransferase vs. Planmine SMEST
Match: SMESG000020492.1 (SMESG000020492.1)

HSP 1 Score: 218.009 bits (554), Expect = 2.998e-64
Identity = 100/173 (57.80%), Postives = 132/173 (76.30%), Query Frame = 2
Query:   62 TDDQGNEIGKLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVMST-KHHLEGKEIDPKPCNVNMKGRSRRQLKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEP 577
            TD  GNEIGK+F+GGL Q+T +++L++YF +FG + +  VMMD++TGRSRGFGY+++ E   V  V+    H L+GK +D K CN++MKGR+RR LKIFVGGI  + NEET+R FF QFGN+T++ LM DQ+  RHRGFAFV FDDE+VVK+LI  H +T+  K VEIK MEP
Sbjct:    2 TDADGNEIGKVFIGGLSQATNDDSLRNYFDQFGSIEDCVVMMDNKTGRSRGFGYIKFHEESTVRTVLEEGPHLLDGKIVDVKQCNIHMKGRNRRSLKIFVGGIGLDDNEETIRQFFSQFGNVTDVNLMLDQTKQRHRGFAFVGFDDESVVKELIVRHFVTMNGKHVEIKAMEP 174          
BLAST of N-acetyltransferase vs. Planmine SMEST
Match: SMESG000071202.1 (SMESG000071202.1)

HSP 1 Score: 145.591 bits (366), Expect = 2.029e-37
Identity = 77/169 (45.56%), Postives = 107/169 (63.31%), Query Frame = 2
Query:   89 KLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVMSTKHH-LEGKEIDPK---PCNVNMKGR-SRRQLKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQ 580
            KLFVGGL+ +TT+E L+SYFS+FGE+ E  VM D    RSRGFG+V + +  GV+KV+  ++H L+ K+IDPK   P ++    + S R  KIF+GGIA     E +R +F ++G +    LM D++ +RHRGF FV F DE V +Q+   H   I NK VE K   P+
Sbjct:   38 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPK 206          

HSP 2 Score: 60.077 bits (144), Expect = 2.802e-9
Identity = 28/80 (35.00%), Postives = 45/80 (56.25%), Query Frame = 2
Query:  344 LKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQA 583
             K+FVGG+ P    E L+ +F QFG I E  +M+D    R RGF FV F D + V +++      + +K+++ K   P++
Sbjct:   37 CKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKS 116          
BLAST of N-acetyltransferase vs. Planmine SMEST
Match: SMESG000071202.1 (SMESG000071202.1)

HSP 1 Score: 145.206 bits (365), Expect = 2.456e-37
Identity = 77/169 (45.56%), Postives = 107/169 (63.31%), Query Frame = 2
Query:   89 KLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGRSRGFGYVRYLENDGVLKVMSTKHH-LEGKEIDPK---PCNVNMKGR-SRRQLKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQ 580
            KLFVGGL+ +TT+E L+SYFS+FGE+ E  VM D    RSRGFG+V + +  GV+KV+  ++H L+ K+IDPK   P ++    + S R  KIF+GGIA     E +R +F ++G +    LM D++ +RHRGF FV F DE V +Q+   H   I NK VE K   P+
Sbjct:   46 KLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKSICQPEKISARTKKIFIGGIATSSTVEEIRQYFNRYGEVENCELMMDKATNRHRGFGFVTFLDEDVAEQICQIHYHNINNKMVEAKKALPK 214          

HSP 2 Score: 59.6918 bits (143), Expect = 3.305e-9
Identity = 28/80 (35.00%), Postives = 45/80 (56.25%), Query Frame = 2
Query:  344 LKIFVGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAVVKQLINDHILTIGNKQVEIKPMEPQA 583
             K+FVGG+ P    E L+ +F QFG I E  +M+D    R RGF FV F D + V +++      + +K+++ K   P++
Sbjct:   45 CKLFVGGLNPTTTSEALQSYFSQFGEIKEFMVMRDIVHKRSRGFGFVTFTDYSGVIKVLKQENHILDSKKIDPKLAVPKS 124          
The following BLAST results are available for this feature:
BLAST of N-acetyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NAA201.090e-6663.03N(alpha)-acetyltransferase 20, NatB catalytic subu... [more]
NAA204.521e-5762.67N(alpha)-acetyltransferase 20, NatB catalytic subu... [more]
DAZAP17.812e-4244.32DAZ associated protein 1 [Source:HGNC Symbol;Acc:H... [more]
DAZAP11.077e-4144.57DAZ associated protein 1 [Source:HGNC Symbol;Acc:H... [more]
DAZAP11.638e-4144.32DAZ associated protein 1 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of N-acetyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
natb-14.340e-6057.76N-terminal AceTyltransferase B (NatB) complex, cat... [more]
msi-11.641e-3439.18MuSashI (Fly neural) family; Neural RNA-binding pr... [more]
sqd-12.252e-2933.92Homologous to Drosophila SQD (Squid) protein [Sou... [more]
sqd-12.252e-2933.92Homologous to Drosophila SQD (Squid) protein [Sou... [more]
sqd-12.252e-2933.92Homologous to Drosophila SQD (Squid) protein [Sou... [more]
back to top
BLAST of N-acetyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Naa20A4.368e-7166.46gene:FBgn0031043 transcript:FBtr0332482[more]
Naa20A4.575e-7166.46gene:FBgn0031043 transcript:FBtr0332484[more]
Naa20A4.575e-7166.46gene:FBgn0031043 transcript:FBtr0332483[more]
Naa20A4.575e-7166.46gene:FBgn0031043 transcript:FBtr0074763[more]
Hrb27C9.567e-4040.94gene:FBgn0004838 transcript:FBtr0079348[more]
back to top
BLAST of N-acetyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
naa201.850e-6763.64N(alpha)-acetyltransferase 20, NatB catalytic subu... [more]
dazap13.467e-4242.93DAZ associated protein 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
dazap13.724e-4242.93DAZ associated protein 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
dazap11.092e-4141.79DAZ associated protein 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
msi2b3.595e-3742.61musashi RNA-binding protein 2b [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of N-acetyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
naa205.132e-6763.64N(alpha)-acetyltransferase 20, NatB catalytic subu... [more]
naa201.033e-5061.87N(alpha)-acetyltransferase 20, NatB catalytic subu... [more]
dazap12.704e-4345.16DAZ associated protein 1 [Source:NCBI gene;Acc:448... [more]
dazap13.624e-4344.92DAZ associated protein 1 [Source:NCBI gene;Acc:448... [more]
dazap15.137e-4344.92DAZ associated protein 1 [Source:NCBI gene;Acc:448... [more]
back to top
BLAST of N-acetyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Naa207.486e-6763.03N(alpha)-acetyltransferase 20, NatB catalytic subu... [more]
Naa201.327e-6358.86N(alpha)-acetyltransferase 20, NatB catalytic subu... [more]
Dazap12.702e-4244.02DAZ associated protein 1 [Source:MGI Symbol;Acc:MG... [more]
Dazap12.839e-4244.02DAZ associated protein 1 [Source:MGI Symbol;Acc:MG... [more]
Dazap13.908e-4243.78DAZ associated protein 1 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of N-acetyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q58ED9|NAA20_DANRE1.397e-6663.64N-alpha-acetyltransferase 20 OS=Danio rerio OX=795... [more]
sp|Q6P632|NAA20_XENTR2.719e-6663.64N-alpha-acetyltransferase 20 OS=Xenopus tropicalis... [more]
sp|Q7ZXR3|NAA20_XENLA5.127e-6663.03N-alpha-acetyltransferase 20 OS=Xenopus laevis OX=... [more]
sp|P61600|NAA20_MOUSE5.236e-6663.03N-alpha-acetyltransferase 20 OS=Mus musculus OX=10... [more]
sp|Q2PFM2|NAA20_MACFA5.236e-6663.03N-alpha-acetyltransferase 20 OS=Macaca fasciculari... [more]
back to top
BLAST of N-acetyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A172RVM70.000e+0100.00DAZ-associated protein 2 OS=Schmidtea mediterranea... [more]
B1Q3J00.000e+092.09DAZAP OS=Dugesia japonica OX=6161 GN=Djdmlg PE=2 S... [more]
A4V6K14.576e-14492.71DAZ-associated protein (Fragment) OS=Dugesia japon... [more]
A0A4Y2AE573.745e-7371.43N-alpha-acetyltransferase 20 OS=Araneus ventricosu... [more]
V4B7F48.149e-7370.81N-acetyltransferase domain-containing protein OS=L... [more]
back to top
BLAST of N-acetyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
naa202.223e-6763.64N(alpha)-acetyltransferase 20, NatB catalytic subu... [more]
dazap12.599e-4344.86DAZ associated protein 1 [Source:NCBI gene;Acc:103... [more]
dazap13.205e-4344.86DAZ associated protein 1 [Source:NCBI gene;Acc:103... [more]
hnrnpabb1.067e-3742.26heterogeneous nuclear ribonucleoprotein A/B [Sourc... [more]
hnrnpabb1.370e-3742.26heterogeneous nuclear ribonucleoprotein A/B [Sourc... [more]
back to top
BLAST of N-acetyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
naa202.374e-6063.58N(alpha)-acetyltransferase 20, NatB catalytic subu... [more]
ENSPMAT00000004893.19.233e-2836.11pep scaffold:Pmarinus_7.0:GL479484:4:2056:-1 gene:... [more]
HNRNPA2B11.315e-2634.73heterogeneous nuclear ribonucleoprotein A2/B1 [Sou... [more]
HNRNPA02.228e-2634.76heterogeneous nuclear ribonucleoprotein A0 [Source... [more]
HNRNPA09.202e-2534.76heterogeneous nuclear ribonucleoprotein A0 [Source... [more]
back to top
BLAST of N-acetyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
NAT31.243e-4545.20Catalytic subunit of the NatB N-terminal acetyltra... [more]
HRP12.639e-3237.43Subunit of cleavage factor I; cleavage factor I is... [more]
PAB14.923e-1128.83Poly(A) binding protein; part of the 3'-end RNA-pr... [more]
NSR11.036e-1025.44Nucleolar protein that binds nuclear localization ... [more]
PUB14.465e-1027.54Poly (A)+ RNA-binding protein; abundant mRNP-compo... [more]
back to top
BLAST of N-acetyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO495302.966e-7167.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384172.120e-3642.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO398793.013e-3341.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO333896.490e-2938.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493491.388e-2837.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of N-acetyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
naa204.392e-6763.64N(alpha)-acetyltransferase 20, NatB catalytic subu... [more]
dazap11.802e-4344.32DAZ associated protein 1 [Source:NCBI gene;Acc:101... [more]
dazap12.609e-4344.32DAZ associated protein 1 [Source:NCBI gene;Acc:101... [more]
hnrnpabb4.817e-3843.79heterogeneous nuclear ribonucleoprotein A/B [Sourc... [more]
msi13.326e-3741.99musashi RNA binding protein 1 [Source:NCBI gene;Ac... [more]
back to top
BLAST of N-acetyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026342.10.000e+099.72SMESG000026342.1[more]
SMESG000026353.11.738e-113100.00SMESG000026353.1[more]
SMESG000020492.12.998e-6457.80SMESG000020492.1[more]
SMESG000071202.12.029e-3745.56SMESG000071202.1[more]
SMESG000071202.12.456e-3745.56SMESG000071202.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022090 ID=SMED30022090|Name=N-acetyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=1840bp
CCGATCTGTTTGTTTCATTTTCTATACTTTGACGCATTACATTTTATACA
AATAAATGGCAACTGATGATCAAGGAAATGAGATTGGTAAACTTTTTGTT
GGTGGTCTTCATCAGTCAACTACTAATGAAACTTTAAAGAGCTACTTTTC
GAAATTCGGAGAAGTTGTTGAAGCTTCTGTCATGATGGATCATAGAACTG
GAAGATCTAGGGGGTTTGGATATGTTAGATATCTTGAGAATGACGGTGTC
TTAAAAGTCATGTCAACTAAGCATCATTTAGAAGGCAAAGAAATTGATCC
TAAACCATGCAATGTTAATATGAAAGGAAGAAGTAGAAGACAGTTAAAGA
TTTTTGTTGGAGGTATAGCTCCAGAACACAATGAAGAAACTTTACGTGAT
TTTTTCAAACAGTTTGGAAATATTACAGAGCTGACATTAATGAAAGATCA
AAGTGGACACAGACATAGAGGATTTGCATTTGTCGCCTTTGATGATGAAG
CTGTCGTGAAACAATTAATAAATGATCATATTTTGACAATTGGAAACAAA
CAGGTTGAAATTAAACCGATGGAACCGCAAGCAAATCGTAATAATAATGA
CATGGCGAATAACAAGCGCGGAATGGGTATGGGTTCAATGCAAGGTGGTC
AATGGCCACAATGGGCCAATCCGAACACTGCGGGATGGCCTGCATCTACC
GGCTGGGGAGCTTGGCCTCAGGCACCTGGTGGGGCAGCAACTGCTACAAA
TTTATGGGATCAAGGAGCTGCAGGCTGGACCGGAGGCTGGGGAAATAATA
TGGGACAGAATGGCAGCAGTATTAATCAGCATATGGCCAGAGGCCCTGAA
ATGATGACCAGCCCCTGGGATCCGCAAATGTGGAATCCAAATCATTTGAC
AACATCAGCTATGCAACCAAATCAAGGCAGTAACAATGGTTGGGGTCCAA
TGACCAATGGCGGGTGGGATCAAGGACATCCAAGCAATCAGTGGAATGCA
CTCGGTGGATTCAGTATGCAGGCAAATTCTGGAAATGATTGGAGGTCAAA
TATGTCAAACGGTATGAATCCTTCAGCAGCTTCGCTGCATGGACAGTCTT
TTGCTGCTTTTAAAAGATGATTCATATTTTTTGTAGTGTAGTGGTTAATA
TAAAATGTAGTTTTTGTTGTATTCATTACTTTGTTTGTTTCTTTCAAATT
GTAAGAAATATTTTTAAGTAAAAACTTAGGTTTTATTTGTTTAAGTTAAT
TTTTTGTTTAAATATTTAAAATTGCAATGACGTCTGTCCGAAGATTTAAA
TGTTCTGATTTATTCAAATATAATAATGTCAATCTTGACCCTTTAACGGA
AACTTTTGGATTAAATTTTTATTTGCGTTATTTAATACAATGGCCGGAAT
TTTTCTTGGCTGCTGAAAATTATTGGGGTAGAATGTCAGGATATATTATG
GGTAAGGCAGAGGGGCATGATCTTAATTGGCACAGTCATGTTACGGCGTT
ATCTGTTGCACCCGAGTTTAGAAGAATAGGATTAGCTGGTGTTTTAATGT
CTGAATTGGAAAATTTATCAATAAAGAAGGATTGTTATTTCGTGGATTTA
TTTGTACGAGTGTCAAATGCAGTCGCAATTAAAATGTATAATTGTCTGGG
TTACACTGTATATAGACGAGTTTTAAAATACTACTCTGGAGACGAAGAAG
ATGAAGATGCTTTTGACATGCGGAAAGCATTACCTAGGGATGTTGACAAG
AAATCTGTTATACCTTTGGAAAGACCAATACGACCTGAGGAGCTGGAACA
TCCTTAGTTGTAATTTAAATATATTTTGATTGAAAAAAAA
back to top

protein sequence of SMED30022090-orf-1

>SMED30022090-orf-1 ID=SMED30022090-orf-1|Name=SMED30022090-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=355bp
MATDDQGNEIGKLFVGGLHQSTTNETLKSYFSKFGEVVEASVMMDHRTGR
SRGFGYVRYLENDGVLKVMSTKHHLEGKEIDPKPCNVNMKGRSRRQLKIF
VGGIAPEHNEETLRDFFKQFGNITELTLMKDQSGHRHRGFAFVAFDDEAV
VKQLINDHILTIGNKQVEIKPMEPQANRNNNDMANNKRGMGMGSMQGGQW
PQWANPNTAGWPASTGWGAWPQAPGGAATATNLWDQGAAGWTGGWGNNMG
QNGSSINQHMARGPEMMTSPWDPQMWNPNHLTTSAMQPNQGSNNGWGPMT
NGGWDQGHPSNQWNALGGFSMQANSGNDWRSNMSNGMNPSAASLHGQSFA
AFKR*
back to top

protein sequence of SMED30022090-orf-2

>SMED30022090-orf-2 ID=SMED30022090-orf-2|Name=SMED30022090-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=177bp
MTSVRRFKCSDLFKYNNVNLDPLTETFGLNFYLRYLIQWPEFFLAAENYW
GRMSGYIMGKAEGHDLNWHSHVTALSVAPEFRRIGLAGVLMSELENLSIK
KDCYFVDLFVRVSNAVAIKMYNCLGYTVYRRVLKYYSGDEEDEDAFDMRK
ALPRDVDKKSVIPLERPIRPEELEHP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016740transferase activity
GO:0003729mRNA binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
GO:0008080N-acetyltransferase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000208testis
PLANA:0002032epidermal cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR037366BOULE/DAZ
IPR035979RBD_domain_sf
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
IPR000182GNAT_dom
IPR016181Acyl_CoA_acyltransferase
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 12..88
e-value: 1.3E-21
score: 87.8
coord: 98..170
e-value: 1.8E-17
score: 74.0
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 99..155
e-value: 2.0E-14
score: 53.1
coord: 13..73
e-value: 9.1E-16
score: 57.4
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 97..174
score: 16.04
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 11..92
score: 16.534
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 97..175
e-value: 2.3E-19
score: 71.5
IPR012677Nucleotide-binding alpha-beta plait domain superfamilyGENE3DG3DSA:3.30.70.330coord: 11..84
e-value: 1.4E-21
score: 78.5
IPR037366BOULE/DAZ familyPANTHERPTHR11176BOULE-RELATEDcoord: 10..81
IPR037366BOULE/DAZ familyPANTHERPTHR11176BOULE-RELATEDcoord: 57..331
NoneNo IPR availablePANTHERPTHR11176:SF13GENE 17190-RELATEDcoord: 10..81
NoneNo IPR availablePANTHERPTHR11176:SF13GENE 17190-RELATEDcoord: 57..331
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 94..195
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 8..90