heterogeneous nuclear ribonucleoprotein K

Overview
Nameheterogeneous nuclear ribonucleoprotein K (AHY82402.1)
Smed IDSMED30022089
Length (bp)1273
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of heterogeneous nuclear ribonucleoprotein K (SMED30022089) t-SNE clustered cells

Violin plots show distribution of expression levels for heterogeneous nuclear ribonucleoprotein K (SMED30022089) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of heterogeneous nuclear ribonucleoprotein K (SMED30022089) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for heterogeneous nuclear ribonucleoprotein K (SMED30022089) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022089

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30022089SMESG000033971.1 SmedASXL_008714SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30022089SMESG000033971.1 SmedASXL_008714SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30022089SMESG000033971.1 dd_Smed_v4_1569_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30022089SMESG000033971.1 dd_Smed_v4_1569_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022089SMESG000033971.1 dd_Smed_v4_1569_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30022089SMESG000033971.1 dd_Smed_v4_1569_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30022089SMESG000033971.1 dd_Smed_v4_1569_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30022089SMESG000033971.1 dd_Smed_v4_1569_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022089SMESG000033971.1 Contig15533uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022089SMESG000033971.1 Contig15533newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neuronSMED30022089SMESG000033971.1 Contig15533uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30022089SMESG000033971.1 Contig15533uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30022089SMESG000033971.1 Contig15533newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30022089SMESG000033971.1 Contig15533newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Human
Match: HNRNPK (heterogeneous nuclear ribonucleoprotein K [Source:HGNC Symbol;Acc:HGNC:5044])

HSP 1 Score: 125.176 bits (313), Expect = 1.672e-31
Identity = 73/213 (34.27%), Postives = 122/213 (57.28%), Query Frame = 3
Query:   90 EDNSFKSFRN----LQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYGGW-MSLEARR 713
            E+ +FK  RN    ++ R L+    AGA+I K G+ IK LR  Y+  +SVP S+GPER++ I+ DI+ +  +L +I   +++  H K +D                D +LR L+ +++ G IIG  G  I++L E  + + IK++Q+ CP STDRV+ + G P+ ++ C++ I D+I+        + YDPN ++E +  +YGG+ M  + RR
Sbjct:   29 EEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEYQHYKGSD---------------FDCELRLLIHQSLAGGIIGVKGAKIKELRENTQ-TTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDETY--DYGGFTMMFDDRR 223          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Human
Match: PCBP3 (poly(rC) binding protein 3 [Source:HGNC Symbol;Acc:HGNC:8651])

HSP 1 Score: 124.405 bits (311), Expect = 2.454e-31
Identity = 105/360 (29.17%), Postives = 168/360 (46.67%), Query Frame = 3
Query:  117 NLQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEI-FEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYGGWM---SLEARRHIARMGGPAPPTKGQTESGRNQSIIADLYGSAMSPASMVFTPGMTLGEMSDRLLAENILMDMGQEQMYGAPVATPLMPQLSMGSQGGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQA 1184
             L  R L+     G+II KKGET+K++R      I++   N PER++ I    D +    + I ++  +D ++S  N P              P + LR +V  + CG++IGKGG  I+++ E+    V +V   M P+ST+R + + G P+ I+ C++ I  V+       +   Y P   +    +  GG +    L A      +    PP    T  G+      DL  + +   +M  TP   LG+ +     E + +   +E       A  LM Q S      P     +++PN LIG I+G+ G++INEIR+ +GA+I +        SSER ITI G+   I  AQ+L+ A
Sbjct:   13 TLTIRLLMHGKEVGSIIGKKGETVKKMREESGARINISEGNCPERIVTITGPTDAIFKAFAMIAYKFEEDIINSMSNSP----------ATSKPPVTLRLVVPASQCGSLIGKGGSKIKEIRESTGAQV-QVAGDMLPNSTERAVTISGTPDAIIQCVKQICVVMLESPPKGATIPYRPKPAS-TPVIFAGGQVRADPLAASTANLSLLLQHPPLPAYTIQGQYAIPHPDL--TKLHQLAMQQTPFPPLGQTNPAFPGEKLPLHSSEE-------AQNLMGQSSGLDASPPASTHELTIPNDLIGCIIGRQGTKINEIRQMSGAQIKIANA--TEGSSERQITITGTPANISLAQYLINA 349          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Human
Match: PCBP3 (poly(rC) binding protein 3 [Source:HGNC Symbol;Acc:HGNC:8651])

HSP 1 Score: 124.405 bits (311), Expect = 2.454e-31
Identity = 105/360 (29.17%), Postives = 168/360 (46.67%), Query Frame = 3
Query:  117 NLQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEI-FEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYGGWM---SLEARRHIARMGGPAPPTKGQTESGRNQSIIADLYGSAMSPASMVFTPGMTLGEMSDRLLAENILMDMGQEQMYGAPVATPLMPQLSMGSQGGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQA 1184
             L  R L+     G+II KKGET+K++R      I++   N PER++ I    D +    + I ++  +D ++S  N P              P + LR +V  + CG++IGKGG  I+++ E+    V +V   M P+ST+R + + G P+ I+ C++ I  V+       +   Y P   +    +  GG +    L A      +    PP    T  G+      DL  + +   +M  TP   LG+ +     E + +   +E       A  LM Q S      P     +++PN LIG I+G+ G++INEIR+ +GA+I +        SSER ITI G+   I  AQ+L+ A
Sbjct:   13 TLTIRLLMHGKEVGSIIGKKGETVKKMREESGARINISEGNCPERIVTITGPTDAIFKAFAMIAYKFEEDIINSMSNSP----------ATSKPPVTLRLVVPASQCGSLIGKGGSKIKEIRESTGAQV-QVAGDMLPNSTERAVTISGTPDAIIQCVKQICVVMLESPPKGATIPYRPKPAS-TPVIFAGGQVRADPLAASTANLSLLLQHPPLPAYTIQGQYAIPHPDL--TKLHQLAMQQTPFPPLGQTNPAFPGEKLPLHSSEE-------AQNLMGQSSGLDASPPASTHELTIPNDLIGCIIGRQGTKINEIRQMSGAQIKIANA--TEGSSERQITITGTPANISLAQYLINA 349          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Human
Match: PCBP3 (poly(rC) binding protein 3 [Source:HGNC Symbol;Acc:HGNC:8651])

HSP 1 Score: 122.865 bits (307), Expect = 1.079e-30
Identity = 101/357 (28.29%), Postives = 163/357 (45.66%), Query Frame = 3
Query:  117 NLQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEI-FEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYGGWMSLEARRHIARMGGPAPPTKGQTESGRNQSIIADLYGSAMSPASMVFTPGMTLGEMSDRLLAENILMDMGQEQMYGAPVATPLMPQLSMGSQGGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQA 1184
             L  R L+     G+II KKGET+K++R      I++   N PER++ I    D +    + I ++  +D ++S  N P              P + LR +V  + CG++IGKGG  I+++ E+    V +V   M P+ST+R + + G P+ I+ C++ I  V+       +   Y P   +    V + G                     GQ  + + Q  I     + +   +M  TP   LG+ +     E + +   +E       A  LM Q S      P     +++PN LIG I+G+ G++INEIR+ +GA+I +        SSER ITI G+   I  AQ+L+ A
Sbjct:   45 TLTIRLLMHGKEVGSIIGKKGETVKKMREESGARINISEGNCPERIVTITGPTDAIFKAFAMIAYKFEEDIINSMSNSP----------ATSKPPVTLRLVVPASQCGSLIGKGGSKIKEIRESTGAQV-QVAGDMLPNSTERAVTISGTPDAIIQCVKQICVVMLESPPKGATIPYRPKPAST--PVIFAG---------------------GQAYTIQGQYAIPHPDLTKLHQLAMQQTPFPPLGQTNPAFPGEKLPLHSSEE-------AQNLMGQSSGLDASPPASTHELTIPNDLIGCIIGRQGTKINEIRQMSGAQIKIANA--TEGSSERQITITGTPANISLAQYLINA 358          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Human
Match: PCBP3 (poly(rC) binding protein 3 [Source:HGNC Symbol;Acc:HGNC:8651])

HSP 1 Score: 121.709 bits (304), Expect = 2.326e-30
Identity = 101/357 (28.29%), Postives = 162/357 (45.38%), Query Frame = 3
Query:  117 NLQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEI-FEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYGGWMSLEARRHIARMGGPAPPTKGQTESGRNQSIIADLYGSAMSPASMVFTPGMTLGEMSDRLLAENILMDMGQEQMYGAPVATPLMPQLSMGSQGGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQA 1184
             L  R L+     G+II KKGET+K++R      I++   N PER++ I    D +    + I ++  +D ++S  N P              P + LR +V  + CG++IGKGG  I+++ E+    V +V   M P+ST+R + + G P+ I+ C++ I  V+       +   Y P                  A   +   GG A   +GQ        +      + +   +M  TP   LG+ +     E + +   +E       A  LM Q S      P     +++PN LIG I+G+ G++INEIR+ +GA+I +        SSER ITI G+   I  AQ+L+ A
Sbjct:   45 TLTIRLLMHGKEVGSIIGKKGETVKKMREESGARINISEGNCPERIVTITGPTDAIFKAFAMIAYKFEEDIINSMSNSP----------ATSKPPVTLRLVVPASQCGSLIGKGGSKIKEIRESTGAQV-QVAGDMLPNSTERAVTISGTPDAIIQCVKQICVVMLESPPKGATIPYRPK----------------PASTPVIFAGGQAYTIQGQYAIPHPDQL------TKLHQLAMQQTPFPPLGQTNPAFPGEKLPLHSSEE-------AQNLMGQSSGLDASPPASTHELTIPNDLIGCIIGRQGTKINEIRQMSGAQIKIANA--TEGSSERQITITGTPANISLAQYLINA 359          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Celegans
Match: hrpk-1 (Heterogeneous nuclear RibonucleoProtein (HnRNP) K homolog [Source:UniProtKB/TrEMBL;Acc:Q8I7G9])

HSP 1 Score: 130.954 bits (328), Expect = 5.529e-34
Identity = 106/381 (27.82%), Postives = 168/381 (44.09%), Query Frame = 3
Query:  120 LQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPN-NFNEMHAVNYGGWMSLEARRHIARMGGPAPPTKGQTESGRNQSIIADLYGSAMSPASMVFTPGMTLGEMSDRLLAENILMDMGQEQMYGAPVATP--------LMPQLSMGSQGGP--------------IEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQACVR 1193
             + R L+   +AGAII K GE IKRLRA ++  + VP SN PER+  +  D   +  +L ++   ++D    +  DP                 ++R LV ++  GA+IG+ G  I++L E      +K++    P STDRV+   G  +++L  +  +   +  +    S   Y P  N++  +  +YGG+           M    PP         N+       G         +   +T G       A +       +Q  G P   P          PQ   G  G P              +  + V++P+ L G I+G+GG RI  IR+E+GA+I ++++   N   ERIITI+G+  QI +AQ+LLQ CVR
Sbjct:   33 FEVRLLVSSKSAGAIIGKGGENIKRLRAEFNAHVQVPDSNTPERVCTVTADEKTVLNILKDVLPRLEDNFSER--DP----------------CEVRMLVHQSHAGALIGRNGSKIKELREKCSAR-LKIFTGCAPGSTDRVLITSGEQKNVLGIIEEVMKELKEIPIKGSATPYLPAFNYDPSNISDYGGFP--------GNMPAGGPPN--------NRGPAPQRGGQGPPGGPRSYGGAITQGGGQRSFEAGDF------QQFRGGPGPVPGYAMSAPGYPPQ--QGQFGAPNNAGYGYGPGGGGPVTTAQVTIPSDLGGTIIGRGGERIARIRQESGAQITLEQS---NGQPERIITIKGTEQQIHSAQYLLQQCVR 367          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Celegans
Match: hrpk-1 (Heterogeneous nuclear RibonucleoProtein (HnRNP) K homolog [Source:UniProtKB/TrEMBL;Acc:Q8I7G9])

HSP 1 Score: 130.954 bits (328), Expect = 5.529e-34
Identity = 106/381 (27.82%), Postives = 168/381 (44.09%), Query Frame = 3
Query:  120 LQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPN-NFNEMHAVNYGGWMSLEARRHIARMGGPAPPTKGQTESGRNQSIIADLYGSAMSPASMVFTPGMTLGEMSDRLLAENILMDMGQEQMYGAPVATP--------LMPQLSMGSQGGP--------------IEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQACVR 1193
             + R L+   +AGAII K GE IKRLRA ++  + VP SN PER+  +  D   +  +L ++   ++D    +  DP                 ++R LV ++  GA+IG+ G  I++L E      +K++    P STDRV+   G  +++L  +  +   +  +    S   Y P  N++  +  +YGG+           M    PP         N+       G         +   +T G       A +       +Q  G P   P          PQ   G  G P              +  + V++P+ L G I+G+GG RI  IR+E+GA+I ++++   N   ERIITI+G+  QI +AQ+LLQ CVR
Sbjct:   33 FEVRLLVSSKSAGAIIGKGGENIKRLRAEFNAHVQVPDSNTPERVCTVTADEKTVLNILKDVLPRLEDNFSER--DP----------------CEVRMLVHQSHAGALIGRNGSKIKELREKCSAR-LKIFTGCAPGSTDRVLITSGEQKNVLGIIEEVMKELKEIPIKGSATPYLPAFNYDPSNISDYGGFP--------GNMPAGGPPN--------NRGPAPQRGGQGPPGGPRSYGGAITQGGGQRSFEAGDF------QQFRGGPGPVPGYAMSAPGYPPQ--QGQFGAPNNAGYGYGPGGGGPVTTAQVTIPSDLGGTIIGRGGERIARIRQESGAQITLEQS---NGQPERIITIKGTEQQIHSAQYLLQQCVR 367          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Celegans
Match: hrpk-1 (Heterogeneous nuclear RibonucleoProtein (HnRNP) K homolog [Source:UniProtKB/TrEMBL;Acc:Q8I7G9])

HSP 1 Score: 130.568 bits (327), Expect = 8.441e-34
Identity = 106/381 (27.82%), Postives = 168/381 (44.09%), Query Frame = 3
Query:  120 LQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPN-NFNEMHAVNYGGWMSLEARRHIARMGGPAPPTKGQTESGRNQSIIADLYGSAMSPASMVFTPGMTLGEMSDRLLAENILMDMGQEQMYGAPVATP--------LMPQLSMGSQGGP--------------IEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQACVR 1193
             + R L+   +AGAII K GE IKRLRA ++  + VP SN PER+  +  D   +  +L ++   ++D    +  DP                 ++R LV ++  GA+IG+ G  I++L E      +K++    P STDRV+   G  +++L  +  +   +  +    S   Y P  N++  +  +YGG+           M    PP         N+       G         +   +T G       A +       +Q  G P   P          PQ   G  G P              +  + V++P+ L G I+G+GG RI  IR+E+GA+I ++++   N   ERIITI+G+  QI +AQ+LLQ CVR
Sbjct:   50 FEVRLLVSSKSAGAIIGKGGENIKRLRAEFNAHVQVPDSNTPERVCTVTADEKTVLNILKDVLPRLEDNFSER--DP----------------CEVRMLVHQSHAGALIGRNGSKIKELREKCSAR-LKIFTGCAPGSTDRVLITSGEQKNVLGIIEEVMKELKEIPIKGSATPYLPAFNYDPSNISDYGGFP--------GNMPAGGPPN--------NRGPAPQRGGQGPPGGPRSYGGAITQGGGQRSFEAGDF------QQFRGGPGPVPGYAMSAPGYPPQ--QGQFGAPNNAGYGYGPGGGGPVTTAQVTIPSDLGGTIIGRGGERIARIRQESGAQITLEQS---NGQPERIITIKGTEQQIHSAQYLLQQCVR 384          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Celegans
Match: pes-4 (Patterned Expression Site [Source:UniProtKB/TrEMBL;Acc:Q95Y67])

HSP 1 Score: 77.0258 bits (188), Expect = 4.329e-15
Identity = 52/184 (28.26%), Postives = 91/184 (49.46%), Query Frame = 3
Query:  120 LQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPN-NFNEM 668
            L  R L+     G+II KKG+ IK++R      I++   + PER++ I   +    GV+ + F +V +         +D++  ++P+ +  P + +R +V    CG++IGKGG  I+ + E    S I+V  +M P ST+R + L G  + I  C+  +  ++       S   Y P   FN +
Sbjct:   72 LTIRLLMQGKEVGSIIGKKGDQIKKIREESGAKINISDGSCPERIVTITGTL----GVIGKAFNMVCNKFE------EDML--LLPNSVPKPPITMRVIVPATQCGSLIGKGGSKIKDIREATGAS-IQVASEMLPHSTERAVTLSGTADAINLCMTQVCQILLEAPPKGSTITYRPKPTFNPL 242          

HSP 2 Score: 51.9878 bits (123), Expect = 4.485e-7
Identity = 30/69 (43.48%), Postives = 43/69 (62.32%), Query Frame = 3
Query:  993 VSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQI-----QNAQFLLQA 1184
            V +P    G+++GKGGS+I +IRE TGA I V   M+ + S+ER +T+ G+ D I     Q  Q LL+A
Sbjct:  157 VIVPATQCGSLIGKGGSKIKDIREATGASIQVASEMLPH-STERAVTLSGTADAINLCMTQVCQILLEA 224          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Celegans
Match: fubl-3 (FUBp (FUBP) Like [Source:UniProtKB/TrEMBL;Acc:Q9BLA0])

HSP 1 Score: 65.0846 bits (157), Expect = 4.441e-11
Identity = 76/362 (20.99%), Postives = 161/362 (44.48%), Query Frame = 3
Query:  138 IPQPAAGAIISKKGETIKRLRATYSC--DISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPKDIINGIMPDGMLSPDMD--------LRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYG-GWMSLEARRHIARMGGPAPPTKGQTESGRNQSIIADLYGSAMSPASMVFTPGMTLGEMSDRLLAENILMDMGQEQMYGAPVATPLMPQLSMGSQGGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQACV 1190
            +P+   G +I + G  ++ +     C   ++V PS+   RL+ I    + +    + I E+V           + +++ +   G+ SP +D        +   +  N CGAIIGKGGE +RKL  ++    +++ Q    + T + +++ G P+ +  C   + D++A   DT +         + M A N     MSL+ +     +G            G+N   ++D  G+ +      F P     +   +L+  ++ +   + ++Y        + + +  +   P+ + ++ +P    G ++G+GG  I +I +E+GA  ++ +    N   E+   I+GS  Q+++A+ L++  V
Sbjct:   61 VPEQCVGLVIGRNGAEVQAISQKSGCRVQVTVQPSSTGFRLVEIYGIPENIERAKAYISEVVTRGTRQPGPLCQPVVH-VQTHGIKSPVVDQGDPSKITIEIPIPANKCGAIIGKGGEQMRKL-RSWTNCNVQLLQDNNIADTVKPLKITGDPKQVEQCRLLVADILACNDDTPA---------SAMMAGNGPVATMSLQVKVPRCTVGA------IMGLQGKNIKKLSDETGTKIQ-----FLP-----DDDPKLMERSLAIIGNKNKVYVCAQLIKAIVEANSEAANAPVVLFYMVIPASKCGLVIGRGGETIKQINQESGAHCELSRDPNTN-PIEKTFVIRGSEAQVEHAKHLIRVKV 394          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Fly
Match: HnRNP-K (gene:FBgn0267791 transcript:FBtr0086220)

HSP 1 Score: 102.449 bits (254), Expect = 2.557e-23
Identity = 56/185 (30.27%), Postives = 97/185 (52.43%), Query Frame = 3
Query:  129 RFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDT---RSPREYDPNNFNEMHA 674
            R LIP   AGA+I K G+ I+++R  Y   +SV  S GPER + I+ DI+    +++E+ +  ++                        D D+R L+ +++ G +IGKGG+ I+++ +      +KV+  + P STDRV++ VG    ++  +R   +VI   +DT    +   YDP NF+ ++A
Sbjct:   26 RILIPSSIAGAVIGKGGQHIQKMRTQYKATVSVDDSQGPERTIQISADIESTLEIITEMLKYFEE---------------------RDEDFDVRLLIHQSLAGCVIGKGGQKIKEIRDRIGCRFLKVFSNVAPQSTDRVVQTVGKQSQVIEAVR---EVITLTRDTPIKGAIHNYDPMNFDRVYA 186          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Fly
Match: HnRNP-K (gene:FBgn0267791 transcript:FBtr0336730)

HSP 1 Score: 102.449 bits (254), Expect = 2.557e-23
Identity = 56/185 (30.27%), Postives = 97/185 (52.43%), Query Frame = 3
Query:  129 RFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDT---RSPREYDPNNFNEMHA 674
            R LIP   AGA+I K G+ I+++R  Y   +SV  S GPER + I+ DI+    +++E+ +  ++                        D D+R L+ +++ G +IGKGG+ I+++ +      +KV+  + P STDRV++ VG    ++  +R   +VI   +DT    +   YDP NF+ ++A
Sbjct:   26 RILIPSSIAGAVIGKGGQHIQKMRTQYKATVSVDDSQGPERTIQISADIESTLEIITEMLKYFEE---------------------RDEDFDVRLLIHQSLAGCVIGKGGQKIKEIRDRIGCRFLKVFSNVAPQSTDRVVQTVGKQSQVIEAVR---EVITLTRDTPIKGAIHNYDPMNFDRVYA 186          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Fly
Match: HnRNP-K (gene:FBgn0267791 transcript:FBtr0086221)

HSP 1 Score: 102.449 bits (254), Expect = 2.617e-23
Identity = 56/185 (30.27%), Postives = 97/185 (52.43%), Query Frame = 3
Query:  129 RFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDT---RSPREYDPNNFNEMHA 674
            R LIP   AGA+I K G+ I+++R  Y   +SV  S GPER + I+ DI+    +++E+ +  ++                        D D+R L+ +++ G +IGKGG+ I+++ +      +KV+  + P STDRV++ VG    ++  +R   +VI   +DT    +   YDP NF+ ++A
Sbjct:   32 RILIPSSIAGAVIGKGGQHIQKMRTQYKATVSVDDSQGPERTIQISADIESTLEIITEMLKYFEE---------------------RDEDFDVRLLIHQSLAGCVIGKGGQKIKEIRDRIGCRFLKVFSNVAPQSTDRVVQTVGKQSQVIEAVR---EVITLTRDTPIKGAIHNYDPMNFDRVYA 192          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Fly
Match: HnRNP-K (gene:FBgn0267791 transcript:FBtr0301760)

HSP 1 Score: 102.449 bits (254), Expect = 2.635e-23
Identity = 56/185 (30.27%), Postives = 97/185 (52.43%), Query Frame = 3
Query:  129 RFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDT---RSPREYDPNNFNEMHA 674
            R LIP   AGA+I K G+ I+++R  Y   +SV  S GPER + I+ DI+    +++E+ +  ++                        D D+R L+ +++ G +IGKGG+ I+++ +      +KV+  + P STDRV++ VG    ++  +R   +VI   +DT    +   YDP NF+ ++A
Sbjct:   26 RILIPSSIAGAVIGKGGQHIQKMRTQYKATVSVDDSQGPERTIQISADIESTLEIITEMLKYFEE---------------------RDEDFDVRLLIHQSLAGCVIGKGGQKIKEIRDRIGCRFLKVFSNVAPQSTDRVVQTVGKQSQVIEAVR---EVITLTRDTPIKGAIHNYDPMNFDRVYA 186          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Fly
Match: mub (gene:FBgn0262737 transcript:FBtr0304981)

HSP 1 Score: 88.1965 bits (217), Expect = 6.641e-19
Identity = 89/355 (25.07%), Postives = 155/355 (43.66%), Query Frame = 3
Query:  120 LQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYGGWMSLEARRHIARMGGPAPPTKGQTESGRN-QSIIADLYGSAMSPASMVFTPGMTLGEMSDRLLAENILMDMGQEQMYGAPVATPLMPQLSMGSQGGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKT-MMDNKSSERIITIQGSRDQIQNAQFLL 1178
            L  R ++     G+II KKGE + R R      I++   + PER++ ++   + +    + I +  ++      ND   +    +P         +R +V  + CG++IGK G  I+++ +T   S I+V  +M P+ST+R + L G  E I  C+  I  V+       +   Y P            G + L   +     G  A PT+   E  +N  + +A L  + M+PAS        L  ++   L      +  Q+Q +                         +++ N LIG I+GKGG++I EIR+ +GA I +      +  +++R ITI G+ D +  AQ+L+
Sbjct:   24 LTIRLIMQGKEVGSIIGKKGEIVNRFREESGAKINISDGSCPERIVTVSGTTNAIFSAFTLITKKFEE-----FNDVGKVGKTQIP---------IRLIVPASQCGSLIGKSGSKIKEIRQTTGCS-IQVASEMLPNSTERAVTLSGSAEQITQCIYQICLVMLESPPRGATIPYRPKP-------QVTGPVILANGQAFTIQGNYAVPTQ---EVAKNPLASLAALGLAGMNPASTGGINHTALAALAGSQLRTANPANRAQQQQH------------------------EMTVSNDLIGCIIGKGGTKIAEIRQISGAMIRISNCEEREGGNTDRTITISGNPDSVALAQYLI 329          

HSP 2 Score: 50.8322 bits (120), Expect = 1.397e-6
Identity = 27/64 (42.19%), Postives = 40/64 (62.50%), Query Frame = 3
Query:  999 LPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQACV 1190
            +P    G+++GK GS+I EIR+ TG  I V   M+ N S+ER +T+ GS +QI   Q + Q C+
Sbjct:  109 VPASQCGSLIGKSGSKIKEIRQTTGCSIQVASEMLPN-STERAVTLSGSAEQI--TQCIYQICL 169          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Zebrafish
Match: hnrpkl (heterogeneous nuclear ribonucleoprotein K, like [Source:ZFIN;Acc:ZDB-GENE-040426-1923])

HSP 1 Score: 127.487 bits (319), Expect = 3.025e-32
Identity = 74/219 (33.79%), Postives = 121/219 (55.25%), Query Frame = 3
Query:   90 EDNSFKSFRN----LQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYGGWMSLEARRHIARMGG 734
            E+ +FK  RN    ++ R L+    AGA+I K G+ IK LR  Y+  +SVP S+GPER++ ++ DID +  +L +I   +++  H    D                D +LR L+ +++ G IIG  G  I++L E  + + IK++Q+ CP STDRV+ + G PE ++ C++ I ++IA        + YDPN ++E +  +YGG+  +   R    MGG
Sbjct:   30 EEQAFKRSRNTDEMVELRVLLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSVSADIDTIGEILLKIIPTLEEYQHYSGTD---------------FDCELRLLIHQSLAGGIIGVKGAKIKELRENTQ-TTIKLFQECCPHSTDRVVLVGGKPERVVECIKVILELIAEAPIKGRAQPYDPNFYDETY--DYGGFTMMYEERGRRPMGG 230          

HSP 2 Score: 89.3521 bits (220), Expect = 5.660e-19
Identity = 42/82 (51.22%), Postives = 60/82 (73.17%), Query Frame = 3
Query:  969 GGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQACVRKYGGKHF 1214
            GGP+  + V++P  L G+I+GKGG RI +IR E+GA I +D+ +    S +RIITI G++DQIQNAQ+LLQ  V++Y G+ F
Sbjct:  341 GGPVITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPL--EGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGRFF 420          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Zebrafish
Match: hnrpkl (heterogeneous nuclear ribonucleoprotein K, like [Source:ZFIN;Acc:ZDB-GENE-040426-1923])

HSP 1 Score: 127.487 bits (319), Expect = 3.114e-32
Identity = 74/219 (33.79%), Postives = 121/219 (55.25%), Query Frame = 3
Query:   90 EDNSFKSFRN----LQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYGGWMSLEARRHIARMGG 734
            E+ +FK  RN    ++ R L+    AGA+I K G+ IK LR  Y+  +SVP S+GPER++ ++ DID +  +L +I   +++  H    D                D +LR L+ +++ G IIG  G  I++L E  + + IK++Q+ CP STDRV+ + G PE ++ C++ I ++IA        + YDPN ++E +  +YGG+  +   R    MGG
Sbjct:   30 EEQAFKRSRNTDEMVELRVLLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSVSADIDTIGEILLKIIPTLEEYQHYSGTD---------------FDCELRLLIHQSLAGGIIGVKGAKIKELRENTQ-TTIKLFQECCPHSTDRVVLVGGKPERVVECIKVILELIAEAPIKGRAQPYDPNFYDETY--DYGGFTMMYEERGRRPMGG 230          

HSP 2 Score: 89.3521 bits (220), Expect = 6.239e-19
Identity = 42/82 (51.22%), Postives = 60/82 (73.17%), Query Frame = 3
Query:  969 GGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQACVRKYGGKHF 1214
            GGP+  + V++P  L G+I+GKGG RI +IR E+GA I +D+ +    S +RIITI G++DQIQNAQ+LLQ  V++Y G+ F
Sbjct:  352 GGPVITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPL--EGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGRFF 431          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Zebrafish
Match: hnrpkl (heterogeneous nuclear ribonucleoprotein K, like [Source:ZFIN;Acc:ZDB-GENE-040426-1923])

HSP 1 Score: 127.487 bits (319), Expect = 3.114e-32
Identity = 74/219 (33.79%), Postives = 121/219 (55.25%), Query Frame = 3
Query:   90 EDNSFKSFRN----LQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYGGWMSLEARRHIARMGG 734
            E+ +FK  RN    ++ R L+    AGA+I K G+ IK LR  Y+  +SVP S+GPER++ ++ DID +  +L +I   +++  H    D                D +LR L+ +++ G IIG  G  I++L E  + + IK++Q+ CP STDRV+ + G PE ++ C++ I ++IA        + YDPN ++E +  +YGG+  +   R    MGG
Sbjct:   30 EEQAFKRSRNTDEMVELRVLLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSVSADIDTIGEILLKIIPTLEEYQHYSGTD---------------FDCELRLLIHQSLAGGIIGVKGAKIKELRENTQ-TTIKLFQECCPHSTDRVVLVGGKPERVVECIKVILELIAEAPIKGRAQPYDPNFYDETY--DYGGFTMMYEERGRRPMGG 230          

HSP 2 Score: 89.3521 bits (220), Expect = 6.239e-19
Identity = 42/82 (51.22%), Postives = 60/82 (73.17%), Query Frame = 3
Query:  969 GGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQACVRKYGGKHF 1214
            GGP+  + V++P  L G+I+GKGG RI +IR E+GA I +D+ +    S +RIITI G++DQIQNAQ+LLQ  V++Y G+ F
Sbjct:  352 GGPVITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPL--EGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGRFF 431          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Zebrafish
Match: pcbp3 (poly(rC) binding protein 3 [Source:ZFIN;Acc:ZDB-GENE-050522-157])

HSP 1 Score: 118.627 bits (296), Expect = 1.726e-29
Identity = 102/362 (28.18%), Postives = 161/362 (44.48%), Query Frame = 3
Query:  117 NLQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEI-FEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYGGWMSLEARRHIARMGGPAPPTKGQTESGRNQSIIADLYGSAMSPASMVFTPGMTLGEMSDRLLAENILMDMGQEQMYGAPV--ATPLMPQLSMGSQGGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQACVR 1193
             L  R L+     G+II KKGET+K++R      I++   N PER++ I    D +    + I ++  +D ++S  N P              P + LR +V  + CG++IGKGG  I+++ E+    V +V   M P+ST+R + + G PE I+ C++ I  V+       +   Y P   +    +  GG +  +                    S  N S++         P       G       D+L     L  +  +Q    P+   TP  P L       P     +++PN LIG I+G+ G++INEIR+ +GA+I +   M    SSER ITI G+   I  AQ+L+ A  R
Sbjct:   15 TLTIRLLMHGKEVGSIIGKKGETVKKMREESGARINISEGNCPERIVTITGPTDAIFKAFAMIAYKFEEDIINSMSNSP----------ATSKPPVTLRLVVPASQCGSLIGKGGSKIKEMRESTGAQV-QVAGDMLPNSTERAVTISGTPEAIIQCVKQICVVMLESPPKGATIPYRPKPAS-TPVIFSGGQVRADPL----------------AASAANLSLLLQ-----HQPLPAYTIQGQYAIPHPDQLTK---LHQLAMQQTPFTPLGQTTPAFPGLDASP---PASTHELTIPNDLIGCIIGRQGTKINEIRQMSGAQIKIANAM--EGSSERQITITGTPANISLAQYLINARFR 335          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Zebrafish
Match: pcbp3 (poly(rC) binding protein 3 [Source:ZFIN;Acc:ZDB-GENE-050522-157])

HSP 1 Score: 118.627 bits (296), Expect = 1.726e-29
Identity = 102/362 (28.18%), Postives = 161/362 (44.48%), Query Frame = 3
Query:  117 NLQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEI-FEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYGGWMSLEARRHIARMGGPAPPTKGQTESGRNQSIIADLYGSAMSPASMVFTPGMTLGEMSDRLLAENILMDMGQEQMYGAPV--ATPLMPQLSMGSQGGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQACVR 1193
             L  R L+     G+II KKGET+K++R      I++   N PER++ I    D +    + I ++  +D ++S  N P              P + LR +V  + CG++IGKGG  I+++ E+    V +V   M P+ST+R + + G PE I+ C++ I  V+       +   Y P   +    +  GG +  +                    S  N S++         P       G       D+L     L  +  +Q    P+   TP  P L       P     +++PN LIG I+G+ G++INEIR+ +GA+I +   M    SSER ITI G+   I  AQ+L+ A  R
Sbjct:   15 TLTIRLLMHGKEVGSIIGKKGETVKKMREESGARINISEGNCPERIVTITGPTDAIFKAFAMIAYKFEEDIINSMSNSP----------ATSKPPVTLRLVVPASQCGSLIGKGGSKIKEMRESTGAQV-QVAGDMLPNSTERAVTISGTPEAIIQCVKQICVVMLESPPKGATIPYRPKPAS-TPVIFSGGQVRADPL----------------AASAANLSLLLQ-----HQPLPAYTIQGQYAIPHPDQLTK---LHQLAMQQTPFTPLGQTTPAFPGLDASP---PASTHELTIPNDLIGCIIGRQGTKINEIRQMSGAQIKIANAM--EGSSERQITITGTPANISLAQYLINARFR 335          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Xenopus
Match: hnrnpk (heterogeneous nuclear ribonucleoprotein K [Source:NCBI gene;Acc:394952])

HSP 1 Score: 129.028 bits (323), Expect = 9.279e-33
Identity = 75/220 (34.09%), Postives = 123/220 (55.91%), Query Frame = 3
Query:   90 EDNSFKSFRN----LQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYGGWMSLEARRHIARMGGP 737
            E+ +FK  RN    ++ R L+    AGA+I K G+ IK LR  Y+  +SVP S+GPER++ I+ DI+ +  +L +I   +++  H K ND                D +LR L+ +++ G IIG  G  I++L E  + + IK++Q+ CP STDRV+ + G P+ ++ C++ I D+I+        + YDPN ++E +  +YGG+  +   R    MG P
Sbjct:   26 EEQAFKRSRNTDMMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEYQHFKGND---------------FDCELRLLIHQSLAGGIIGVKGAKIKELREKTQ-TTIKLFQECCPHSTDRVVLIGGKPDRVVECIKVILDLISESPVKGRSQPYDPNFYDETY--DYGGFTMMFDDRRGRPMGFP 227          

HSP 2 Score: 86.6557 bits (213), Expect = 4.859e-18
Identity = 42/82 (51.22%), Postives = 59/82 (71.95%), Query Frame = 3
Query:  954 SMGSQGGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQACVRKY 1199
            S G  GGP+  + V++P  L G+I+GKGG RI +IR E+GA I +D+ +    S +RIITI G++DQIQNAQFLLQ  V+++
Sbjct:  312 SFGDIGGPVITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPL--EGSDDRIITITGTQDQIQNAQFLLQNSVKQF 391          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Xenopus
Match: ENSXETT00000046760.1 (poly(rC) binding protein 3 [Source:NCBI gene;Acc:100490531])

HSP 1 Score: 115.546 bits (288), Expect = 2.974e-28
Identity = 106/367 (28.88%), Postives = 168/367 (45.78%), Query Frame = 3
Query:  117 NLQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEI---FEIVKDCMHSKINDPKDIINGIMPDGMLS-PDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYGGWMSLE------ARRHIARMGGPAPPTKGQTESG-RNQSIIADLYGSAMSPASMVFTPGMTLGEMSDRLLAENILMDMGQEQMYGAPVATPLMPQLSMGSQGGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQA 1184
             L  R L+     G+II KKGET+K++R      I++   N PER++ I    D +    + I   FE             +DIIN +      S P + LR +V  + CG++IGKGG  I+++ E+    V +V   M P+ST+R + + G P+ I+ C++ I  V+       +   Y P   +    +  GG +  +      A   +     P P    Q +    +   +  L+  AM      FTP   LG+ +     E + +   +E       A  LM Q +            +++PN LIG I+G+ G++INEIR+ +GA+I +   M    S+ER ITI GS   I  AQ+L+ A
Sbjct:   13 TLTIRLLMHGKEVGSIIGKKGETVKKMREESGARINISEGNCPERIVTITGPTDAIFKAFAMIAYKFE-------------EDIINSMSNSTATSKPPVTLRLVVPASQCGSLIGKGGSKIKEIRESTGAQV-QVAGDMLPNSTERAVTISGTPDAIIQCVKQICVVMLESPPKGATIPYRPKPAS-APVIFAGGQVRADPLGASTANLSLLLQHQPLPAYSIQGQYAIPHPDQLTKLHQLAMQ--QTPFTP---LGQTTPAFPGEKLPLHSSEE-------AQNLMGQSAGMDASSQASTHELTIPNDLIGCIIGRQGTKINEIRQMSGAQIKIASAM--EGSAERQITITGSPANISLAQYLINA 350          

HSP 2 Score: 54.6842 bits (130), Expect = 1.354e-7
Identity = 30/64 (46.88%), Postives = 42/64 (65.62%), Query Frame = 3
Query:  999 LPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQACV 1190
            +P    G+++GKGGS+I EIRE TGA++ V   M+ N S+ER +TI G+ D I   Q + Q CV
Sbjct:  104 VPASQCGSLIGKGGSKIKEIRESTGAQVQVAGDMLPN-STERAVTISGTPDAI--IQCVKQICV 164          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Xenopus
Match: ENSXETT00000046774.1 (poly(rC) binding protein 3 [Source:NCBI gene;Acc:100490531])

HSP 1 Score: 114.775 bits (286), Expect = 4.041e-28
Identity = 106/371 (28.57%), Postives = 169/371 (45.55%), Query Frame = 3
Query:  117 NLQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEI---FEIVKDCMHSKINDPKDIINGIMPDGMLS-PDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYGGWMSLEARRHIARMGGPAPPTKGQTESGRNQSIIADLYGSAMSPASMVFT----PGMTL-GEMS----DRLLAENILMDMGQEQMYGAPV--ATPLMPQLSMGSQGGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQA 1184
             L  R L+     G+II KKGET+K++R      I++   N PER++ I    D +    + I   FE             +DIIN +      S P + LR +V  + CG++IGKGG  I+++ E+    V +V   M P+ST+R + + G P+ I+ C++ I  V+       +   Y P                  A   +   GG                + AD  G++ +  S++      P  ++ G+ +    D+L     L  +  +Q    P+   TP  P +   SQ    E   +++PN LIG I+G+ G++INEIR+ +GA+I +   M    S+ER ITI GS   I  AQ+L+ A
Sbjct:   13 TLTIRLLMHGKEVGSIIGKKGETVKKMREESGARINISEGNCPERIVTITGPTDAIFKAFAMIAYKFE-------------EDIINSMSNSTATSKPPVTLRLVVPASQCGSLIGKGGSKIKEIRESTGAQV-QVAGDMLPNSTERAVTISGTPDAIIQCVKQICVVMLESPPKGATIPYRPK----------------PASAPVIFAGG---------------QVRADPLGASTANLSLLLQHQPLPAYSIQGQYAIPHPDQLTK---LHQLAMQQTPFTPLGQTTPAFPGMDASSQASTHE---LTIPNDLIGCIIGRQGTKINEIRQMSGAQIKIASAM--EGSAERQITITGSPANISLAQYLINA 330          

HSP 2 Score: 54.6842 bits (130), Expect = 1.283e-7
Identity = 30/64 (46.88%), Postives = 42/64 (65.62%), Query Frame = 3
Query:  999 LPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQACV 1190
            +P    G+++GKGGS+I EIRE TGA++ V   M+ N S+ER +TI G+ D I   Q + Q CV
Sbjct:  104 VPASQCGSLIGKGGSKIKEIRESTGAQVQVAGDMLPN-STERAVTISGTPDAI--IQCVKQICV 164          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Xenopus
Match: cert1 (ceramide transporter 1 [Source:Xenbase;Acc:XB-GENE-1002414])

HSP 1 Score: 110.538 bits (275), Expect = 1.540e-26
Identity = 103/366 (28.14%), Postives = 173/366 (47.27%), Query Frame = 3
Query:  117 NLQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVI--ASLKDTRSPREYDPNNFNEMHAVNYGGWMSLEARRHIARMGGPAPPTKGQTESGRNQSIIADLYGSAMSPASMVFTPGMTLGEMSDRLLAENILMDMGQEQMYGAPVATPLMPQLSMGSQGGPIEVSH-VSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQACVRKYGG 1205
             L  R L+     G+II KKGE++K++R      I++   N PER++ +    + +    S I + +++ + S + +               P + LR +V  + CG++IGKGG  I+++ E+    V +V   M P+ST+R I + G+P+ I+ C++ I  V+  +  K    P    P++   + A   GG +S +A       GG A  T              DL+    S      T G++L  +    L +   + M Q      P++       S G        SH +++PN LIG I+G+ G++INEIR+ +GA+I +   +    S++R +TI GS   I  AQ+L+   VR  GG
Sbjct:   13 TLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFKAFSMIIDKLEEDISSSMTN---------STASSKPPVTLRLVVPASQCGSLIGKGGCKIKEIRESTGAQV-QVAGDMLPNSTERAITIAGIPQSIIECVKQICVVMLESPPKGVTIPYRPKPSSSPVIFA---GGQVSRQA-------GGHACET--------------DLWEGRRS-----HTGGVSLDAVDLHGLTKLHQLAMQQSHF---PMSHSGNTGFSGGIDASAQTTSHELTIPNDLIGCIIGRQGAKINEIRQMSGAQIKIANPV--EGSNDRQVTITGSTASISLAQYLIN--VRSGGG 332          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Xenopus
Match: ENSXETT00000046813.1 (poly(rC) binding protein 3 [Source:NCBI gene;Acc:100490531])

HSP 1 Score: 108.227 bits (269), Expect = 6.373e-26
Identity = 99/342 (28.95%), Postives = 152/342 (44.44%), Query Frame = 3
Query:  171 KKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEI---FEIVKDCMHSKINDPKDIINGIMPDGMLS-PDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYGGWMSLEARRHIARMGGPAPPTKGQTESGRNQSIIADLYGSAMSPASMVFTPGMTLGEMSDRLLAENILMDMGQEQMYGAPVATPLMPQLSMGSQGGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQA 1184
            KKGET+K++R      I++   N PER++ I    D +    + I   FE             +DIIN +      S P + LR +V  + CG++IGKGG  I+++ E+    V +V   M P+ST+R + + G P+ I+ C++ I  V+       +   Y P   +       G   S++ +  I     P P              +  L+  AM      FTP                   +GQ         TP  P +   SQ    E   +++PN LIG I+G+ G++INEIR+ +GA+I +   M    S+ER ITI GS   I  AQ+L+ A
Sbjct:   23 KKGETVKKMREESGARINISEGNCPERIVTITGPTDAIFKAFAMIAYKFE-------------EDIINSMSNSTATSKPPVTLRLVVPASQCGSLIGKGGSKIKEIRESTGAQV-QVAGDMLPNSTERAVTISGTPDAIIQCVKQICVVMLESPPKGATIPYRPKPASAPVIFAGGQAYSIQGQYAI-----PHP------------DQLTKLHQLAMQ--QTPFTP-------------------LGQ--------TTPAFPGMDASSQASTHE---LTIPNDLIGCIIGRQGTKINEIRQMSGAQIKIASAM--EGSAERQITITGSPANISLAQYLINA 299          

HSP 2 Score: 54.6842 bits (130), Expect = 1.063e-7
Identity = 30/64 (46.88%), Postives = 42/64 (65.62%), Query Frame = 3
Query:  999 LPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQACV 1190
            +P    G+++GKGGS+I EIRE TGA++ V   M+ N S+ER +TI G+ D I   Q + Q CV
Sbjct:   96 VPASQCGSLIGKGGSKIKEIRESTGAQVQVAGDMLPN-STERAVTISGTPDAI--IQCVKQICV 156          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Mouse
Match: Hnrnpk (heterogeneous nuclear ribonucleoprotein K [Source:MGI Symbol;Acc:MGI:99894])

HSP 1 Score: 125.176 bits (313), Expect = 2.743e-32
Identity = 73/213 (34.27%), Postives = 122/213 (57.28%), Query Frame = 3
Query:   90 EDNSFKSFRN----LQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYGGW-MSLEARR 713
            E+ +FK  RN    ++ R L+    AGA+I K G+ IK LR  Y+  +SVP S+GPER++ I+ DI+ +  +L +I   +++  H K +D                D +LR L+ +++ G IIG  G  I++L E  + + IK++Q+ CP STDRV+ + G P+ ++ C++ I D+I+        + YDPN ++E +  +YGG+ M  + RR
Sbjct:   29 EEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEYQHYKGSD---------------FDCELRLLIHQSLAGGIIGVKGAKIKELRENTQ-TTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDETY--DYGGFTMMFDDRR 223          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Mouse
Match: Hnrnpk (heterogeneous nuclear ribonucleoprotein K [Source:MGI Symbol;Acc:MGI:99894])

HSP 1 Score: 125.946 bits (315), Expect = 1.467e-31
Identity = 73/213 (34.27%), Postives = 122/213 (57.28%), Query Frame = 3
Query:   90 EDNSFKSFRN----LQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYGGW-MSLEARR 713
            E+ +FK  RN    ++ R L+    AGA+I K G+ IK LR  Y+  +SVP S+GPER++ I+ DI+ +  +L +I   +++  H K +D                D +LR L+ +++ G IIG  G  I++L E  + + IK++Q+ CP STDRV+ + G P+ ++ C++ I D+I+        + YDPN ++E +  +YGG+ M  + RR
Sbjct:   29 EEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEYQHYKGSD---------------FDCELRLLIHQSLAGGIIGVKGAKIKELRENTQ-TTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDETY--DYGGFTMMFDDRR 223          

HSP 2 Score: 87.0409 bits (214), Expect = 3.696e-18
Identity = 43/82 (52.44%), Postives = 59/82 (71.95%), Query Frame = 3
Query:  954 SMGSQGGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQACVRKY 1199
            S G  GGPI  + V++P  L G+I+GKGG RI +IR E+GA I +D+ +    S +RIITI G++DQIQNAQ+LLQ  V++Y
Sbjct:  355 SYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPL--EGSEDRIITITGTQDQIQNAQYLLQNSVKQY 434          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Mouse
Match: Hnrnpk (heterogeneous nuclear ribonucleoprotein K [Source:MGI Symbol;Acc:MGI:99894])

HSP 1 Score: 125.946 bits (315), Expect = 1.630e-31
Identity = 73/213 (34.27%), Postives = 122/213 (57.28%), Query Frame = 3
Query:   90 EDNSFKSFRN----LQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYGGW-MSLEARR 713
            E+ +FK  RN    ++ R L+    AGA+I K G+ IK LR  Y+  +SVP S+GPER++ I+ DI+ +  +L +I   +++  H K +D                D +LR L+ +++ G IIG  G  I++L E  + + IK++Q+ CP STDRV+ + G P+ ++ C++ I D+I+        + YDPN ++E +  +YGG+ M  + RR
Sbjct:   29 EEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEYQHYKGSD---------------FDCELRLLIHQSLAGGIIGVKGAKIKELRENTQ-TTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDETY--DYGGFTMMFDDRR 223          

HSP 2 Score: 93.2041 bits (230), Expect = 3.365e-20
Identity = 46/87 (52.87%), Postives = 62/87 (71.26%), Query Frame = 3
Query:  954 SMGSQGGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQACVRKYGGKHF 1214
            S G  GGPI  + V++P  L G+I+GKGG RI +IR E+GA I +D+ +    S +RIITI G++DQIQNAQ+LLQ  V++Y GK F
Sbjct:  355 SYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPL--EGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGKFF 439          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Mouse
Match: Pcbp3 (poly(rC) binding protein 3 [Source:MGI Symbol;Acc:MGI:1890470])

HSP 1 Score: 122.865 bits (307), Expect = 6.769e-31
Identity = 101/357 (28.29%), Postives = 163/357 (45.66%), Query Frame = 3
Query:  117 NLQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEI-FEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYGGWMSLEARRHIARMGGPAPPTKGQTESGRNQSIIADLYGSAMSPASMVFTPGMTLGEMSDRLLAENILMDMGQEQMYGAPVATPLMPQLSMGSQGGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQA 1184
             L  R L+     G+II KKGET+K++R      I++   N PER++ I    D +    + I ++  +D ++S  N P              P + LR +V  + CG++IGKGG  I+++ E+    V +V   M P+ST+R + + G P+ I+ C++ I  V+       +   Y P   +    V + G                     GQ  + + Q  I     + +   +M  TP   LG+ +     E + +   +E       A  LM Q S      P     +++PN LIG I+G+ G++INEIR+ +GA+I +        SSER ITI G+   I  AQ+L+ A
Sbjct:   45 TLTIRLLMHGKEVGSIIGKKGETVKKMREESGARINISEGNCPERIVTITGPTDAIFKAFAMIAYKFEEDIINSMSNSP----------ATSKPPVTLRLVVPASQCGSLIGKGGSKIKEIRESTGAQV-QVAGDMLPNSTERAVTISGTPDAIIQCVKQICVVMLESPPKGATIPYRPKPAST--PVIFAG---------------------GQAYTIQGQYAIPHPDLTKLHQLAMQQTPFPPLGQTNPAFPGEKLPLHSSEE-------AQNLMGQSSGLDASPPASTHELTIPNDLIGCIIGRQGTKINEIRQMSGAQIKIANA--TEGSSERQITITGTPANISLAQYLINA 358          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Mouse
Match: Hnrnpk (heterogeneous nuclear ribonucleoprotein K [Source:MGI Symbol;Acc:MGI:99894])

HSP 1 Score: 119.783 bits (299), Expect = 8.570e-31
Identity = 73/222 (32.88%), Postives = 125/222 (56.31%), Query Frame = 3
Query:   90 EDNSFKSFRN----LQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMH-------SKINDPKDIINGIMPDGMLSPDMD--LRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYGGW-MSLEARR 713
            E+ +FK  RN    ++ R L+    AGA+I K G+ IK LR  Y+  +SVP S+GPER++ I+ DI+ +  +L +I   +++ +        S++    D +  +        D D  LR L+ +++ G IIG  G  I++L E  + + IK++Q+ CP STDRV+ + G P+ ++ C++ I D+I+        + YDPN ++E +  +YGG+ M  + RR
Sbjct:   29 EEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEGLQLPSPTATSQLPLESDAVECLNYQHYKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQ-TTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDETY--DYGGFTMMFDDRR 247          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. UniProt/SwissProt
Match: sp|P91277|HRPK1_CAEEL (Heterogeneous nuclear ribonucleoprotein K homolog OS=Caenorhabditis elegans OX=6239 GN=hrpk-1 PE=1 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 1.074e-32
Identity = 106/381 (27.82%), Postives = 168/381 (44.09%), Query Frame = 3
Query:  120 LQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPN-NFNEMHAVNYGGWMSLEARRHIARMGGPAPPTKGQTESGRNQSIIADLYGSAMSPASMVFTPGMTLGEMSDRLLAENILMDMGQEQMYGAPVATP--------LMPQLSMGSQGGP--------------IEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQACVR 1193
             + R L+   +AGAII K GE IKRLRA ++  + VP SN PER+  +  D   +  +L ++   ++D    +  DP                 ++R LV ++  GA+IG+ G  I++L E      +K++    P STDRV+   G  +++L  +  +   +  +    S   Y P  N++  +  +YGG+           M    PP         N+       G         +   +T G       A +       +Q  G P   P          PQ   G  G P              +  + V++P+ L G I+G+GG RI  IR+E+GA+I ++++   N   ERIITI+G+  QI +AQ+LLQ CVR
Sbjct:   50 FEVRLLVSSKSAGAIIGKGGENIKRLRAEFNAHVQVPDSNTPERVCTVTADEKTVLNILKDVLPRLEDNFSER--DP----------------CEVRMLVHQSHAGALIGRNGSKIKELREKCSAR-LKIFTGCAPGSTDRVLITSGEQKNVLGIIEEVMKELKEIPIKGSATPYLPAFNYDPSNISDYGGFP--------GNMPAGGPPN--------NRGPAPQRGGQGPPGGPRSYGGAITQGGGQRSFEAGDF------QQFRGGPGPVPGYAMSAPGYPPQ--QGQFGAPNNAGYGYGPGGGGPVTTAQVTIPSDLGGTIIGRGGERIARIRQESGAQITLEQS---NGQPERIITIKGTEQQIHSAQYLLQQCVR 384          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. UniProt/SwissProt
Match: sp|Q5ZIQ3|HNRPK_CHICK (Heterogeneous nuclear ribonucleoprotein K OS=Gallus gallus OX=9031 GN=HNRNPK PE=2 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 3.770e-30
Identity = 72/213 (33.80%), Postives = 121/213 (56.81%), Query Frame = 3
Query:   90 EDNSFKSFRN----LQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYGGW-MSLEARR 713
            E+ +FK  RN    ++ R L+    AGA+I K G+ IK LR  Y+  +SVP S+GPER++ I+ D + +  +L +I   +++  H K +D                D +LR L+ +++ G IIG  G  I++L E  + + IK++Q+ CP STDRV+ + G P+ ++ C++ I D+I+        + YDPN ++E +  +YGG+ M  + RR
Sbjct:   26 EEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSISADTETIGEILKKIIPTLEEYQHYKGSD---------------FDCELRLLIHQSLAGGIIGVKGAKIKELRENTQ-TTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDETY--DYGGFTMMFDDRR 220          

HSP 2 Score: 93.2041 bits (230), Expect = 2.593e-19
Identity = 46/87 (52.87%), Postives = 62/87 (71.26%), Query Frame = 3
Query:  954 SMGSQGGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQACVRKYGGKHF 1214
            S G  GGPI  + V++P  L G+I+GKGG RI +IR E+GA I +D+ +    S +RIITI G++DQIQNAQ+LLQ  V++Y GK F
Sbjct:  343 SYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPL--EGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGKFF 427          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. UniProt/SwissProt
Match: sp|P57722|PCBP3_MOUSE (Poly(rC)-binding protein 3 OS=Mus musculus OX=10090 GN=Pcbp3 PE=1 SV=3)

HSP 1 Score: 122.094 bits (305), Expect = 9.611e-30
Identity = 101/357 (28.29%), Postives = 162/357 (45.38%), Query Frame = 3
Query:  117 NLQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEI-FEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYGGWMSLEARRHIARMGGPAPPTKGQTESGRNQSIIADLYGSAMSPASMVFTPGMTLGEMSDRLLAENILMDMGQEQMYGAPVATPLMPQLSMGSQGGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQA 1184
             L  R L+     G+II KKGET+K++R      I++   N PER++ I    D +    + I ++  +D ++S  N P              P + LR +V  + CG++IGKGG  I+++ E+    V +V   M P+ST+R + + G P+ I+ C++ I  V+       +   Y P                  A   +   GG A   +GQ        +      + +   +M  TP   LG+ +     E + +   +E       A  LM Q S      P     +++PN LIG I+G+ G++INEIR+ +GA+I +        SSER ITI G+   I  AQ+L+ A
Sbjct:   45 TLTIRLLMHGKEVGSIIGKKGETVKKMREESGARINISEGNCPERIVTITGPTDAIFKAFAMIAYKFEEDIINSMSNSP----------ATSKPPVTLRLVVPASQCGSLIGKGGSKIKEIRESTGAQV-QVAGDMLPNSTERAVTISGTPDAIIQCVKQICVVMLESPPKGATIPYRPK----------------PASTPVIFAGGQAYTIQGQYAIPHPDQL------TKLHQLAMQQTPFPPLGQTNPAFPGEKLPLHSSEE-------AQNLMGQSSGLDASPPASTHELTIPNDLIGCIIGRQGTKINEIRQMSGAQIKIANA--TEGSSERQITITGTPANISLAQYLINA 359          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. UniProt/SwissProt
Match: sp|P57721|PCBP3_HUMAN (Poly(rC)-binding protein 3 OS=Homo sapiens OX=9606 GN=PCBP3 PE=1 SV=2)

HSP 1 Score: 121.709 bits (304), Expect = 1.117e-29
Identity = 101/357 (28.29%), Postives = 162/357 (45.38%), Query Frame = 3
Query:  117 NLQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEI-FEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYGGWMSLEARRHIARMGGPAPPTKGQTESGRNQSIIADLYGSAMSPASMVFTPGMTLGEMSDRLLAENILMDMGQEQMYGAPVATPLMPQLSMGSQGGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQA 1184
             L  R L+     G+II KKGET+K++R      I++   N PER++ I    D +    + I ++  +D ++S  N P              P + LR +V  + CG++IGKGG  I+++ E+    V +V   M P+ST+R + + G P+ I+ C++ I  V+       +   Y P                  A   +   GG A   +GQ        +      + +   +M  TP   LG+ +     E + +   +E       A  LM Q S      P     +++PN LIG I+G+ G++INEIR+ +GA+I +        SSER ITI G+   I  AQ+L+ A
Sbjct:   45 TLTIRLLMHGKEVGSIIGKKGETVKKMREESGARINISEGNCPERIVTITGPTDAIFKAFAMIAYKFEEDIINSMSNSP----------ATSKPPVTLRLVVPASQCGSLIGKGGSKIKEIRESTGAQV-QVAGDMLPNSTERAVTISGTPDAIIQCVKQICVVMLESPPKGATIPYRPK----------------PASTPVIFAGGQAYTIQGQYAIPHPDQL------TKLHQLAMQQTPFPPLGQTNPAFPGEKLPLHSSEE-------AQNLMGQSSGLDASPPASTHELTIPNDLIGCIIGRQGTKINEIRQMSGAQIKIANA--TEGSSERQITITGTPANISLAQYLINA 359          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. UniProt/SwissProt
Match: sp|O19049|HNRPK_RABIT (Heterogeneous nuclear ribonucleoprotein K OS=Oryctolagus cuniculus OX=9986 GN=HNRNPK PE=2 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 8.958e-29
Identity = 73/222 (32.88%), Postives = 125/222 (56.31%), Query Frame = 3
Query:   90 EDNSFKSFRN----LQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMH-------SKINDPKDIINGIMPDGMLSPDMD--LRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYGGW-MSLEARR 713
            E+ +FK  RN    ++ R L+    AGA+I K G+ IK LR  Y+  +SVP S+GPER++ I+ DI+ +  +L +I   +++ +        S++    D +  +        D D  LR L+ +++ G IIG  G  I++L E  + + IK++Q+ CP STDRV+ + G P+ ++ C++ I D+I+        + YDPN ++E +  +YGG+ M  + RR
Sbjct:   29 EEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSISADIETIGEILKKIIPTLEEGLQLPSPTATSQLPLESDAVECLNYQHFKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQ-TTIKLFQECCPHSTDRVVLIGGKPDRVVECIKIILDLISESPIKGRAQPYDPNFYDETY--DYGGFTMMFDDRR 247          

HSP 2 Score: 93.5893 bits (231), Expect = 2.210e-19
Identity = 46/87 (52.87%), Postives = 62/87 (71.26%), Query Frame = 3
Query:  954 SMGSQGGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQACVRKYGGKHF 1214
            S G  GGPI  + V++P  L G+I+GKGG RI +IR E+GA I +D+ +    S +RIITI G++DQIQNAQ+LLQ  V++Y GK F
Sbjct:  379 SYGDLGGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPL--EGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGKFF 463          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. TrEMBL
Match: A0A023ZS14 (Heterogeneous nuclear ribonucleoprotein K OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 798.505 bits (2061), Expect = 0.000e+0
Identity = 387/387 (100.00%), Postives = 387/387 (100.00%), Query Frame = 3
Query:   54 MNNSIISNNPYAEDNSFKSFRNLQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYGGWMSLEARRHIARMGGPAPPTKGQTESGRNQSIIADLYGSAMSPASMVFTPGMTLGEMSDRLLAENILMDMGQEQMYGAPVATPLMPQLSMGSQGGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQACVRKYGGKHF 1214
            MNNSIISNNPYAEDNSFKSFRNLQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYGGWMSLEARRHIARMGGPAPPTKGQTESGRNQSIIADLYGSAMSPASMVFTPGMTLGEMSDRLLAENILMDMGQEQMYGAPVATPLMPQLSMGSQGGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQACVRKYGGKHF
Sbjct:    1 MNNSIISNNPYAEDNSFKSFRNLQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYGGWMSLEARRHIARMGGPAPPTKGQTESGRNQSIIADLYGSAMSPASMVFTPGMTLGEMSDRLLAENILMDMGQEQMYGAPVATPLMPQLSMGSQGGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQACVRKYGGKHF 387          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. TrEMBL
Match: A0A0R3X4X2 (Uncharacterized protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS8468 PE=4 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 2.186e-57
Identity = 131/399 (32.83%), Postives = 203/399 (50.88%), Query Frame = 3
Query:  117 NLQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFE-----IVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPRE-YDPNNFNEMHAVNYGGWMSLEARRHIARMGGPAPPTKGQTESGRNQSIIADLYGSAMSPASMVFTPG------MTLGEMSDRLLAENI--------LMDMGQEQMYGAPVA-----------------TPLMPQLSMGSQGGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQACVRKYG 1202
            N++ RFLI    AG II K+GE IK+LR  YS  I++P SNGPER++I++ D++ +  ++    +     + +DC+                        DLR LV ++  G IIGK G+ I++L E   +  +KVYQ +CP STDR+++LVG    ++SCL+AI +++      + PR+ YD  +FNE  A+ YGGW             G   P+ G +   R  +   + Y  +   A+ +F+ G      +T   +  + LA  I        L   G +   G P +                    +P     +   P   + VS+ NK+IGAIMG+GG+RIN++R+E+GA  D+  +  D    +RIITI G+ DQIQ+AQF LQ CV+++G
Sbjct:    6 NVELRFLISTKTAGLIIGKRGENIKKLRDEYSVTINIPDSNGPERILILDGDVNSVIEIMHNTLKRQAMSLQEDCV------------------------DLRLLVHQSQAGCIIGKSGQKIKELREQSILKTLKVYQMLCPDSTDRIVQLVGTVAHVISCLQAICELLEG-APAKGPRQNYDARSFNEAMAMQYGGWC------------GMGIPSSGSSYGTRRNNFANNSYPQSSMLAASLFSGGGATPRSVTQAAVVSQALASGIPPASAAAMLAATGGQSHPGGPTSGPAGDAATAAAMMAAGMMRGLPGTVSMNIIAPTTTTQVSVSNKMIGAIMGRGGTRINQVRKESGA--DIKISSQDPGVEDRIITITGTPDQIQSAQFYLQLCVKRFG 365          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. TrEMBL
Match: A0A0R3VZ02 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS2647 PE=4 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 3.798e-57
Identity = 131/399 (32.83%), Postives = 203/399 (50.88%), Query Frame = 3
Query:  117 NLQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFE-----IVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPRE-YDPNNFNEMHAVNYGGWMSLEARRHIARMGGPAPPTKGQTESGRNQSIIADLYGSAMSPASMVFTPG------MTLGEMSDRLLAENI--------LMDMGQEQMYGAPVA-----------------TPLMPQLSMGSQGGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQACVRKYG 1202
            N++ RFLI    AG II K+GE IK+LR  YS  I++P SNGPER++I++ D++ +  ++    +     + +DC+                        DLR LV ++  G IIGK G+ I++L E   +  +KVYQ +CP STDR+++LVG    ++SCL+AI +++      + PR+ YD  +FNE  A+ YGGW             G   P+ G +   R  +   + Y  +   A+ +F+ G      +T   +  + LA  I        L   G +   G P +                    +P     +   P   + VS+ NK+IGAIMG+GG+RIN++R+E+GA  D+  +  D    +RIITI G+ DQIQ+AQF LQ CV+++G
Sbjct:    6 NVELRFLISTKTAGLIIGKRGENIKKLRDEYSVTINIPDSNGPERILILDGDVNSVIEIMHNTLKRQAMSLQEDCV------------------------DLRLLVHQSQAGCIIGKSGQKIKELREQSILKTLKVYQMLCPDSTDRIVQLVGSVAHVISCLQAICELLEG-APAKGPRQNYDARSFNEAMAMQYGGWC------------GMGIPSSGSSYGTRRSNFANNSYPQSSMLAASLFSGGGATPRSVTQAAVVSQALASGIPPASAAAMLAATGGQNHPGGPTSGPAGDAATAAAMMAAGMMRGLPGTVSMNIIAPTTTTQVSVSNKMIGAIMGRGGTRINQVRKESGA--DIKISSQDPGVEDRIITITGTPDQIQSAQFYLQLCVKRFG 365          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. TrEMBL
Match: A0A068Y5G6 (Heterolocus tagous nuclear ribonucleoprotein OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000733900 PE=4 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 7.108e-57
Identity = 135/394 (34.26%), Postives = 205/394 (52.03%), Query Frame = 3
Query:  117 NLQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPRE-YDPNNFNEMHAVNYGGWMSLEARRHIARMGGPAPPTKGQTESGRNQSIIADLYGSAMSPASMVFTPG------MTLGEMSDRLLAENI--------LMDMGQEQMYGAPVA-----------------TPLMPQLSMGSQGGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQACVRKYG 1202
            N++ RFLI    AG II K+GE IK+LR  YS  I++P SNGPER++I++ D++        + EI    MHS +   K     +  D +     DLR LV ++  G IIGK G+ I++L E   +  +KVYQ +CP STDR+++LVG    ++SCL+AI +++      + PR+ YD  +FNE  A+ YGGW             G   P+ G +   R  +   + Y  +   A+ +F+ G      +T   +  + LA  I        L   G +   G P +                    +P     +   P   + VS+ NK+IGAIMG+GG+RIN++R+E+GA  D+  +  D    +RIITI G+ +QIQ+AQF LQ CV+++G
Sbjct:    6 NVELRFLISTKTAGLIIGKRGENIKKLRDEYSVTINIPDSNGPERILILDGDVN-------SVIEI----MHSTL---KRQAMSLQEDCV-----DLRLLVHQSQAGCIIGKSGQKIKELREQSILKTLKVYQMLCPDSTDRIVQLVGTVAHVISCLQAICELLEG-APAKGPRQNYDARSFNEAMAMQYGGWC------------GMGIPSSGSSYGARRSNFANNSYPQSSMLAASLFSGGGATPRSVTQAAVVSQALASGIPPASAAAMLAATGGQNHPGGPTSGPAGDAATAAAMMAAGMMRGIPGTVSMNIIAPTTTTQVSVSNKMIGAIMGRGGTRINQVRKESGA--DIKISSQDPGVEDRIITITGTPEQIQSAQFYLQLCVKRFG 365          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. TrEMBL
Match: U6JJH4 (Heterogeneous nuclear ribonucleoprotein OS=Echinococcus granulosus OX=6210 GN=EGR_06368 PE=4 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 7.108e-57
Identity = 135/394 (34.26%), Postives = 205/394 (52.03%), Query Frame = 3
Query:  117 NLQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPRE-YDPNNFNEMHAVNYGGWMSLEARRHIARMGGPAPPTKGQTESGRNQSIIADLYGSAMSPASMVFTPG------MTLGEMSDRLLAENI--------LMDMGQEQMYGAPVA-----------------TPLMPQLSMGSQGGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQACVRKYG 1202
            N++ RFLI    AG II K+GE IK+LR  YS  I++P SNGPER++I++ D++        + EI    MHS +   K     +  D +     DLR LV ++  G IIGK G+ I++L E   +  +KVYQ +CP STDR+++LVG    ++SCL+AI +++      + PR+ YD  +FNE  A+ YGGW             G   P+ G +   R  +   + Y  +   A+ +F+ G      +T   +  + LA  I        L   G +   G P +                    +P     +   P   + VS+ NK+IGAIMG+GG+RIN++R+E+GA  D+  +  D    +RIITI G+ +QIQ+AQF LQ CV+++G
Sbjct:    6 NVELRFLISTKTAGLIIGKRGENIKKLRDEYSVTINIPDSNGPERILILDGDVN-------SVIEI----MHSTL---KRQAMSLQEDCV-----DLRLLVHQSQAGCIIGKSGQKIKELREQSILKTLKVYQMLCPDSTDRIVQLVGTVAHVISCLQAICELLEG-APAKGPRQNYDARSFNEAMAMQYGGWC------------GMGIPSSGSSYGARRSNFANNSYPQSSMLAASLFSGGGATPRSVTQAAVVSQALASGIPPASAAAMLAATGGQNHPGGPTSGPAGDAATAAAMMAAGMMRGIPGTVSMNIIAPTTTTQVSVSNKMIGAIMGRGGTRINQVRKESGA--DIKISSQDPGVEDRIITITGTPEQIQSAQFYLQLCVKRFG 365          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Cavefish
Match: hnrpkl (heterogeneous nuclear ribonucleoprotein K-like [Source:NCBI gene;Acc:103043638])

HSP 1 Score: 123.25 bits (308), Expect = 8.757e-31
Identity = 72/219 (32.88%), Postives = 122/219 (55.71%), Query Frame = 3
Query:   90 EDNSFKSFRN----LQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYGGWMSLEARRHIARMGG 734
            E+ +FK  RN    ++ R L+    AGA+I K G+ IK LR  Y+  +SVP S+GPER++ ++ DI+ +  +L +I   +++  H          NGI        D +LR L+ +++ G IIG  G  I++L E  + + IK++Q+ CP STDRV+ + G P+ ++ C++ I ++ +        + YDPN ++E +  +YGG+  +   R    MGG
Sbjct:   30 EEQAFKRSRNTDEMVELRVLLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSVSADIETIGEILLKIIPTLEEYQH---------YNGI------DFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQ-TTIKLFQECCPHSTDRVVLVGGKPQRVVECIKVILELTSEAPIKGRAQPYDPNFYDETY--DYGGFTMMFEERGRRPMGG 230          

HSP 2 Score: 89.3521 bits (220), Expect = 4.091e-19
Identity = 42/82 (51.22%), Postives = 60/82 (73.17%), Query Frame = 3
Query:  969 GGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQACVRKYGGKHF 1214
            GGP+  + V++P  L G+I+GKGG RI +IR E+GA I +D+ +    S +RIITI G++DQIQNAQ+LLQ  V++Y G+ F
Sbjct:  334 GGPVITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPL--EGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGRFF 413          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Cavefish
Match: hnrpkl (heterogeneous nuclear ribonucleoprotein K-like [Source:NCBI gene;Acc:103043638])

HSP 1 Score: 122.479 bits (306), Expect = 1.772e-30
Identity = 72/219 (32.88%), Postives = 122/219 (55.71%), Query Frame = 3
Query:   90 EDNSFKSFRN----LQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYGGWMSLEARRHIARMGG 734
            E+ +FK  RN    ++ R L+    AGA+I K G+ IK LR  Y+  +SVP S+GPER++ ++ DI+ +  +L +I   +++  H          NGI        D +LR L+ +++ G IIG  G  I++L E  + + IK++Q+ CP STDRV+ + G P+ ++ C++ I ++ +        + YDPN ++E +  +YGG+  +   R    MGG
Sbjct:   30 EEQAFKRSRNTDEMVELRVLLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSVSADIETIGEILLKIIPTLEEYQH---------YNGI------DFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQ-TTIKLFQECCPHSTDRVVLVGGKPQRVVECIKVILELTSEAPIKGRAQPYDPNFYDETY--DYGGFTMMFEERGRRPMGG 230          

HSP 2 Score: 88.9669 bits (219), Expect = 7.087e-19
Identity = 42/82 (51.22%), Postives = 60/82 (73.17%), Query Frame = 3
Query:  969 GGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQACVRKYGGKHF 1214
            GGP+  + V++P  L G+I+GKGG RI +IR E+GA I +D+ +    S +RIITI G++DQIQNAQ+LLQ  V++Y G+ F
Sbjct:  353 GGPVITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPL--EGSEDRIITITGTQDQIQNAQYLLQNSVKQYSGRFF 432          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Cavefish
Match: hnrpkl (heterogeneous nuclear ribonucleoprotein K-like [Source:NCBI gene;Acc:103043638])

HSP 1 Score: 122.094 bits (305), Expect = 2.526e-30
Identity = 72/219 (32.88%), Postives = 122/219 (55.71%), Query Frame = 3
Query:   90 EDNSFKSFRN----LQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYGGWMSLEARRHIARMGG 734
            E+ +FK  RN    ++ R L+    AGA+I K G+ IK LR  Y+  +SVP S+GPER++ ++ DI+ +  +L +I   +++  H          NGI        D +LR L+ +++ G IIG  G  I++L E  + + IK++Q+ CP STDRV+ + G P+ ++ C++ I ++ +        + YDPN ++E +  +YGG+  +   R    MGG
Sbjct:   30 EEQAFKRSRNTDEMVELRVLLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSVSADIETIGEILLKIIPTLEEYQH---------YNGI------DFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQ-TTIKLFQECCPHSTDRVVLVGGKPQRVVECIKVILELTSEAPIKGRAQPYDPNFYDETY--DYGGFTMMFEERGRRPMGG 230          

HSP 2 Score: 78.5666 bits (192), Expect = 1.909e-15
Identity = 38/71 (53.52%), Postives = 53/71 (74.65%), Query Frame = 3
Query:  969 GGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQ 1181
            GGP+  + V++P  L G+I+GKGG RI +IR E+GA I +D+ +    S +RIITI G++DQIQNAQ+LLQ
Sbjct:  353 GGPVITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPL--EGSEDRIITITGTQDQIQNAQYLLQ 421          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Cavefish
Match: pcbp3 (poly(rC)-binding protein 3 [Source:NCBI gene;Acc:103036377])

HSP 1 Score: 119.398 bits (298), Expect = 7.183e-30
Identity = 102/362 (28.18%), Postives = 162/362 (44.75%), Query Frame = 3
Query:  117 NLQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEI-FEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYGGWMSLEARRHIARMGGPAPPTKGQTESGRNQSIIADLYGSAMSPASMVFTPGMTLGEMSDRLLAENILMDMGQEQMYGAPV--ATPLMPQLSMGSQGGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQACVR 1193
             L  R L+     G+II KKGET+K++R   +  I++   N PER++ I    D +    + I ++  +D ++S  N P              P + LR +V  + CG++IGKGG  I+++ E+    V +V   M P+ST+R + + G PE I+ C++ I  V+       +   Y P   +    +  GG +  +                    S  N S++         P       G       D+L     L  +  +Q    P+   TP  P L       P     +++PN LIG I+G+ G++INEIR+ +GA+I +   M    SSER ITI G+   I  AQ+L+ A  R
Sbjct:   15 TLTIRLLMHGKEVGSIIGKKGETVKKMREESAARINISEGNCPERIVTITGPTDAIFKAFAMIAYKFEEDIINSMSNSP----------ATSKPPVTLRLVVPASQCGSLIGKGGSKIKEMRESTGAQV-QVAGDMLPNSTERAVTISGTPEAIIQCVKQICVVMLESPPKGATIPYRPKPAS-TPVIFSGGQVRADPL----------------AASAANLSLLLQ-----HQPLPAYTIQGQYAIPHPDQLTK---LHQLAMQQTPFTPLGQTTPAFPGLDASP---PASTHELTIPNDLIGCIIGRQGTKINEIRQMSGAQIKIANAM--EGSSERQITITGTPANISLAQYLINARFR 335          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Cavefish
Match: hnrnpk (heterogeneous nuclear ribonucleoprotein K [Source:NCBI gene;Acc:103037234])

HSP 1 Score: 116.316 bits (290), Expect = 3.161e-28
Identity = 69/212 (32.55%), Postives = 117/212 (55.19%), Query Frame = 3
Query:   99 SFKSFRNLQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYGGWMSLEARRHIARMGG 734
            S KS   ++ R L+    AGA+I K G+ IK LR  Y+  +SVP S+GPER++ I  +I  +  +L +I   +++  H K  D                D +LR L+ +++ G+IIG  G  I++L E  + + IK++Q+ CP STDRV+ + G  E ++ C++ + ++I         ++YDPN ++E +  +YGG+ ++   R    MGG
Sbjct:   36 SRKSDEMVELRVLLQSKNAGAVIGKAGKNIKALRTDYNATVSVPDSSGPERILSITAEIPIVAEILLKIIPTLEEYQHHKGVD---------------FDCELRILIHQSLAGSIIGVKGAKIKELRENTQ-TTIKLFQECCPQSTDRVVLVGGKAEKVVECIKTMLELINEAPIKGRAQQYDPNFYDETY--DYGGYTTVYEDRGRRPMGG 229          

HSP 2 Score: 81.2629 bits (199), Expect = 2.153e-16
Identity = 41/87 (47.13%), Postives = 56/87 (64.37%), Query Frame = 3
Query:  954 SMGSQGGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQACVRKYGGKHF 1214
            S G  G P+  + V++P  L G+I+GKGG RI +IR E+GA I +D+ +    S +RIITI G++DQIQNAQ+LLQ       G H 
Sbjct:  346 SYGDMGAPVVTTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLQ--GSEDRIITITGTQDQIQNAQYLLQNSALHLLGHHH 430          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005114.1 (pep scaffold:Pmarinus_7.0:GL476545:177182:183416:1 gene:ENSPMAG00000004551.1 transcript:ENSPMAT00000005114.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 108.612 bits (270), Expect = 9.556e-27
Identity = 91/356 (25.56%), Postives = 161/356 (45.22%), Query Frame = 3
Query:  117 NLQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYGGWMSLEARRHIARMGGPAPPTKGQTESGRNQSIIADLYGSAMSPASMVFTPGMTLGEMSDRLLAENILMDMGQEQMYGAPVATPLMPQLSMGSQGGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQA 1184
             L  R L+     G+II KKGE +KR+R      I++  +N PER++ +   ++ +    + I   +++ M S ++       G+M   M  P + LR +V  + CG++IGK G  I++L E+    V +V   + P+ST+R + + G P+ I+ C+R I  ++       +   Y P   +    V + G                     GQ  + + Q  I +   + +   +M  TP   + + S    A                      P +   +Q   +    +S+PN LIG I+GK G++INEIR+ +GA+I +   +  + +++R + I GS   I  AQ+L+ A
Sbjct:   15 TLSIRLLMHSKEVGSIIGKKGEFVKRVREESGARINISDANCPERIVTVTGPMESIFLAFALITHKLEEDMGSTLS------GGVM---MSRPPVTLRLVVPASQCGSLIGKSGNKIQELRESTGAQV-QVAGDLLPNSTERAVTISGTPDAIVQCVRQICVLMMESPPKGATIPYRPKPVSSSAPVIFAG---------------------GQAYTIQGQYAIPNPDLTKLHQLAMQHTPFTPINQASSGYQA---------------------TPGVDASAQ---MSTHEISIPNNLIGCIIGKQGTKINEIRQMSGAQIKIASAI--DGATDRQVIITGSPANISLAQYLINA 313          

HSP 2 Score: 49.2914 bits (116), Expect = 7.737e-7
Identity = 26/64 (40.62%), Postives = 41/64 (64.06%), Query Frame = 3
Query:  999 LPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQACV 1190
            +P    G+++GK G++I E+RE TGA++ V   ++ N S+ER +TI G+ D I   Q + Q CV
Sbjct:  106 VPASQCGSLIGKSGNKIQELRESTGAQVQVAGDLLPN-STERAVTISGTPDAI--VQCVRQICV 166          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005105.1 (pep scaffold:Pmarinus_7.0:GL501087:1205:15413:-1 gene:ENSPMAG00000004637.1 transcript:ENSPMAT00000005105.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.0333 bits (201), Expect = 1.741e-18
Identity = 51/162 (31.48%), Postives = 84/162 (51.85%), Query Frame = 3
Query:  117 NLQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPKDIINGIMPDGMLS--PDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAI 596
             L  R L+     G+II KKGET+K++R      I++   + PER++ I    D +    S I            N  ++ IN  M +  ++  P + LR +V  + CG++IGKGG  I+++ E+    V +V   M P+ST+R + + G PE I+ C++ I
Sbjct:   13 TLTIRLLMHGKEVGSIIGKKGETVKKMREESGARINISEGSCPERIVTITGQTDAIFKAFSMI-----------TNKFEEDINASMANSAVTSKPPVTLRLVVPASQCGSLIGKGGSKIKEIRESTGAQV-QVAGDMLPNSTERAVTVSGAPEAIIQCVKQI 162          

HSP 2 Score: 52.373 bits (124), Expect = 2.901e-8
Identity = 28/64 (43.75%), Postives = 42/64 (65.62%), Query Frame = 3
Query:  999 LPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQACV 1190
            +P    G+++GKGGS+I EIRE TGA++ V   M+ N S+ER +T+ G+ + I   Q + Q CV
Sbjct:  104 VPASQCGSLIGKGGSKIKEIRESTGAQVQVAGDMLPN-STERAVTVSGAPEAI--IQCVKQICV 164          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Sea Lamprey
Match: zgc:110045 (zgc:110045 [Source:ZFIN;Acc:ZDB-GENE-050706-149])

HSP 1 Score: 51.6026 bits (122), Expect = 1.624e-8
Identity = 34/121 (28.10%), Postives = 61/121 (50.41%), Query Frame = 3
Query:  120 LQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTE 482
            L  R L+     G+II KKG+ +KR+R      I++   N PER++ +    + +    + +   +++ M S       + N ++   M  P + LR +V  + CG++IGK G  I++L E
Sbjct:   17 LTIRLLMHSKEVGSIIGKKGDFVKRIRDESGSRINISDGNCPERIVTVTGPTEAIFRAFTMMTHKLEEDMIS------TMANSVV---MNRPPVTLRLVVPASQCGSLIGKSGNKIKELRE 128          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Sea Lamprey
Match: igf2bp2b (insulin-like growth factor 2 mRNA binding protein 2b [Source:ZFIN;Acc:ZDB-GENE-060503-536])

HSP 1 Score: 51.9878 bits (123), Expect = 5.762e-8
Identity = 49/215 (22.79%), Postives = 89/215 (41.40%), Query Frame = 3
Query:   21 YFLYVYSN*PGMNNSIISNNPYAEDNSFKSFRNLQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGP---ERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDR-VIRLVGLPEDILSCLRAIHDVIASLKDTRS-PREYDP 650
            +F Y +   P    S+    P  ++  F           IP  A GA+I KKG+ IK+L       I + P++ P   ER++II    +        I+  +K+       +PK+ +            ++    V  +  G +IGKGG+ + +L       V+ V +   P   D+ V++++G      +  R I +++   K  +S P +  P
Sbjct:   45 FFGYFHCIYPEGLPSVERRKPSEQETVF---------LFIPAQAVGALIGKKGQHIKQLSRFAGASIKIAPADTPDSKERMVIITGPPEAQFKSQGRIYGKLKE---ENFFNPKEEVK-----------LEAHIKVPSSAAGRVIGKGGKTVNELQNLTSAEVV-VPRDQTPDENDQVVVKIIGHFFASQTAQRKIREILHQFKQQQSRPEQSQP 235          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009168.1 (pep scaffold:Pmarinus_7.0:GL479182:17814:35570:1 gene:ENSPMAG00000008286.1 transcript:ENSPMAT00000009168.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.0618 bits (118), Expect = 3.841e-7
Identity = 46/203 (22.66%), Postives = 86/203 (42.36%), Query Frame = 3
Query:   57 NNSIISNNPYAEDNSFKSFRNLQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDC--MHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNF 659
             N I+S    A   +F+    +   + +P    G II + GE I R+++   C +   P +G +         D+ C  L+   E + +   M  +I +   I  G  P G+         ++  +  G IIGKGGE I++L +   V ++ +     P+  D+ +R++G P  +      + +++         RE D  +F
Sbjct:   67 QNDIVSAQLAA--IAFQHRPQMSIEYKVPDKMVGFIIGRGGENISRIQSDSGCKVQFAPDSGGQ--------ADRPC-TLTGTPEAIAEAKRMLDQIVERGRIPPG--PAGVDHTSHSQEMMIPADKVGLIIGKGGETIKQLQDRAGVRMLLIQDGSQPTGADKPLRIMGEPFKVQQAKELVLELL---------REKDREDF 247          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Yeast
Match: HEK2 (RNA binding protein involved in asymmetric localization of ASH1 mRNA; represses translation of ASH1 mRNA, an effect reversed by Yck1p-dependent phosphoryation; regulates telomere position effect and length; similarity to hnRNP-K [Source:SGD;Acc:S000000128])

HSP 1 Score: 51.6026 bits (122), Expect = 1.139e-7
Identity = 47/204 (23.04%), Postives = 85/204 (41.67%), Query Frame = 3
Query:  120 LQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPS--NGPERLMIINTDIDKLCGVLSEIFEIVKD-------------CMHSKINDPKDIINGIMPDGMLSPDMDL---------RFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTR--SPREYDPN 653
            + +R L+    A  II  KG TI R+RA  +  I +        +R++    ++  +   + +I +++                 H   +     +N I+P        DL         R +V+ +   +IIGK G  I+ L   + V ++   +   P+S +R+I + G P  I + L  I ++I S  D R  + R Y P+
Sbjct:   44 INHRLLLSLKEAAKIIGTKGSTISRIRAANAVKIGISEKVPGCSDRILSCAGNVINVANAIGDIVDVLNKRNPENEDAAEGEAEEHYYFH----FLNHILPAPSKDEIRDLQQLEDIGYVRLIVANSHISSIIGKAGATIKSLINKHGVKIV-ASKDFLPASDERIIEIQGFPGSITNVLIEISEIILSDVDVRFSTERSYFPH 242          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Nematostella
Match: EDO42485 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1C6])

HSP 1 Score: 77.7962 bits (190), Expect = 7.633e-16
Identity = 50/190 (26.32%), Postives = 89/190 (46.84%), Query Frame = 3
Query:  117 NLQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYG 686
            NL  + ++     G+II K+G TIK+ R   +  I++   + PER++ +    D +    + I + ++D + S                  +P + LR +V  + CG+IIGKGG  I+++ E    SV+ V  +  P S++R + L G PE + +C+  +  V+        P  Y P+   +     YG
Sbjct:   26 NLVLKMIMQGKDIGSIIGKEGSTIKQFRQESNAHINISDGSTPERIVSVTGTKDAVVTAFALIGQKLEDELKSNSKS------------NTTPPVTLRLIVPGSQCGSIIGKGGAKIKEIREVSGASVV-VAGEFLPGSSERAVTLSGTPEALETCIDLLCGVMIEFPPRGHPMPYTPHKLQQQFGF-YG 201          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Nematostella
Match: EDO35692 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKT2])

HSP 1 Score: 74.3294 bits (181), Expect = 1.331e-14
Identity = 94/389 (24.16%), Postives = 171/389 (43.96%), Query Frame = 3
Query:   72 SNNPYAEDNSFKSFRNLQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSN-----GPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPKDIINGIMPDGMLSPDMD----LRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPS-STDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYGGWMSLEARRHIARMGGPAPPTKGQTESGRNQSIIADLYGSAMSPASMVFTPGMTLGEMSDRLLAENILMDMGQEQMYGAPVATPLMPQLSMGSQGGPIEVS---HVSLPNKLIGAIMGKGGSRINEIREETGARIDV-DKTMMDNKSSERIITIQGSRDQIQNAQFLLQACVRK 1196
            +  PY   N F   ++   + L+P  AAG+II K G+ I +++ T    I + P+N       ER+ +I  +++ +  +L  + + ++        +P+    GI     +S D +    ++ +V  +  G IIGK G  I+ ++E      I++ Q+   S + +R++ + G  E + +       VI + K    P     NN      + Y G  +  A     ++ G A        SG   S ++ L    ++  +       T    ++ +LA+  LM        G+ +  P+ P  S  +    I+ S    +++P++LIGAI+GKGG  I E  + +GARI V  K      +S R + I G     Q A FL+   +++
Sbjct:   31 TRQPYKRSN-FGPAKSPILKILVPNYAAGSIIGKGGQNIAQVQQTTGARIKLSPNNQYYPGTQERIGLIMGEVENIVQMLDFVIDKIRQ-------EPQ----GIKASMSISFDRERAKQMKIIVPNSTAGMIIGKAGSAIKSISEQTGAR-IQISQKDAESVAGERIVCVGGSQEQVTAAC-----VIITSKVQEDPEHALNNN------IMYSGLTTSRAGHTNGQLAGSA------FSSGLPFSALSGLSALGLTNTATAQN---TTTSATNHILAQAALMS-------GSNLNNPMAPPTSTATSSS-IQSSATLEITVPDELIGAILGKGGKTITEFMQYSGARIQVSQKGEFVPGTSNRKVVITGDVPAAQLAHFLVTQRIQQ 378          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Nematostella
Match: EDO37243 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGC0])

HSP 1 Score: 72.0182 bits (175), Expect = 8.939e-14
Identity = 45/162 (27.78%), Postives = 77/162 (47.53%), Query Frame = 3
Query:  129 RFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIAS 614
            R LI    AG II K G  I+RLR  Y+  ++VP +N  ER++ I         +L+E+   + +  +                       +++ LV  +  G+IIG+ G  I+++ E    +V KV+    P+ST+RV+ + G  E I+ C+  +   IA+
Sbjct:   56 RILIQSKDAGGIIGKGGTNIRRLRTEYNAVVNVPDTNSNERVLTITAPRQSALDILAEVVPKIGEVQYGH---------------------EIQMLVQRSQVGSIIGRAGYKIKEIREGSGANV-KVFADCLPNSTERVVTMSGSAETIVKCVENVLVAIAN 195          

HSP 2 Score: 67.3958 bits (163), Expect = 2.789e-12
Identity = 36/82 (43.90%), Postives = 53/82 (64.63%), Query Frame = 3
Query:  969 GGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQACVRKYGGKHF 1214
            GG    + V++P  L G+I+GKGG RI  IR    A I +D  +    S++RIITI G+++QI +AQ+LLQ  VR++ G+ F
Sbjct:  340 GGDQTSTQVTIPKDLAGSIIGKGGERIKMIRNRCNAVIKIDDPLPG--SNDRIITITGNQEQINHAQYLLQQSVRQHSGQKF 419          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Nematostella
Match: EDO25444 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DWG5])

HSP 1 Score: 50.447 bits (119), Expect = 1.941e-8
Identity = 29/67 (43.28%), Postives = 42/67 (62.69%), Query Frame = 3
Query:  969 GGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQ 1169
            GG    + V++P  L G+I+GKGG RI  IR    A I +D  +    S++RIITI G+++QI +AQ
Sbjct:    2 GGDQTSTQVTIPKDLAGSIIGKGGERIKMIRNRCNAVIKIDDPLP--GSNDRIITITGNQEQINHAQ 66          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Nematostella
Match: EDO38203 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDL7])

HSP 1 Score: 55.0694 bits (131), Expect = 3.669e-8
Identity = 82/360 (22.78%), Postives = 152/360 (42.22%), Query Frame = 3
Query:  138 IPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPKDIINGIMPDGMLSP-DMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYGGWMSLEARRHIARMGGPAPPTKGQTESGRNQSIIADLYGSAMSPASMVFTPGMTLGEMSDRLLAENILMDMGQEQMYGA-PVATPLMPQLSMGSQGGP-----------IEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLL 1178
            IP    G +I + GE I +L++     I V P   P   M+   D     G   +  E  K  ++ KI +   I + +M   +++P +  +  ++  +  G IIGKGGE I+ L E  +  ++ V      ++ ++ +R++G   D   C R   D++  L   +   +  P       A+++ G      +     +  P P        G+    I  +   A S A + F P       SDR+      +   QEQ+     +   ++ Q+    +GGP           I    + +P    G I+GKGG  I +I   +GA +++++ + +N  + +   I+G+  QIQ A+ ++
Sbjct:  163 IPNKYVGLVIGRGGEQINKLQSETGARIQVAPD--PPAGMMSPPDRSVTIGGTVQAVEKAKQVLN-KICEEGKIPDSLMSVPVVAPGEQVIEMMIPASKVGLIIGKGGETIKNLQERAQCRMVMVQDGPYANAPEKPLRIMG---DNTRCQRG-KDLVTDLLTEKELEQSKP-------ALDFLGKRQDNRQLGATTLEIPVPRDVVGFVIGKGGETIKRI--QAESGARVQFNPAKDNPNSSDRMAT----VQGSQEQIQKVEKIINEIISQVESRQRGGPPPRGPPANMPGINTLEMPVPGNKCGLIIGKGGETIKQIIAVSGAHVELNRNVPENNPT-KFFVIRGTDQQIQQAEKMI 501          

HSP 2 Score: 51.9878 bits (123), Expect = 3.164e-7
Identity = 22/69 (31.88%), Postives = 43/69 (62.32%), Query Frame = 3
Query:  990 HVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQACVRK 1196
             + +P  ++G ++GKGG  I  I+ E+GAR+  +    +  SS+R+ T+QGS++QIQ  + ++   + +
Sbjct:  347 EIPVPRDVVGFVIGKGGETIKRIQAESGARVQFNPAKDNPNSSDRMATVQGSQEQIQKVEKIINEIISQ 415          

HSP 3 Score: 51.6026 bits (122), Expect = 4.405e-7
Identity = 48/170 (28.24%), Postives = 78/170 (45.88%), Query Frame = 3
Query:  132 FLIPQPAAGAIISKKGETIKRLRATYSCDISV----PPSNGPE---RLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLK 620
             +IP    G II K GETIK L+    C + +    P +N PE   R+M  NT   +   +++++    K+   SK   P     G   D        L   V  +V G +IGKGGE I+++       V     +  P+S+DR+  + G  E I    + I+++I+ ++
Sbjct:  252 MMIPASKVGLIIGKGGETIKNLQERAQCRMVMVQDGPYANAPEKPLRIMGDNTRCQRGKDLVTDLL-TEKELEQSK---PALDFLGKRQDNRQLGATTLEIPVPRDVVGFVIGKGGETIKRIQAESGARVQFNPAKDNPNSSDRMATVQGSQEQIQKVEKIINEIISQVE 417          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Medaka
Match: hnrnpk (heterogeneous nuclear ribonucleoprotein K [Source:NCBI gene;Acc:101169861])

HSP 1 Score: 178.333 bits (451), Expect = 3.787e-51
Identity = 131/408 (32.11%), Postives = 204/408 (50.00%), Query Frame = 3
Query:   90 EDNSFKSFRN----LQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYGGWMSLEARRHIARMGGPAPPTKGQTESG---------------------RNQSIIADLYGSAMSPASMVFTP-----GMTLGEMSDRLLAENILMDMGQEQMYGAPVATPLMPQLSMGSQG------GPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQACVRKYGG 1205
            E  SFK  RN    ++ R L+    AGA+I K G+ IK LR+ Y+  +SVP S+GPER++ I+ DI+ +  +L +I   +++             NG      +  D +LR L+ +++ G+IIG  G  I++L E  + S IK++Q+ CP STDRV+ + G  E ++ C++ + ++I+        + YDPN ++E +   YGG+   E R    R+ G + P +G   SG                     R+   I+   G      S V  P      M +G    R        D   + M G    +        G +G      GP+  + V++P  L G+I+GKGG RI +IR E+GA I +D+ +    S +RIITI G++DQIQNAQ+LLQ  V++Y G
Sbjct:   29 EHKSFKRSRNSDEMVELRILLQSKNAGAVIGKGGKNIKALRSDYNASVSVPDSSGPERILSISADIETVGEILLKIIPTLEEYQQ---------YNG------MDFDCELRLLIHQSLAGSIIGVKGAKIKELRENTKTS-IKLFQECCPQSTDRVVLVGGKSERVVECVKTMLELISEAPIKGRTQPYDPNFYDETY--EYGGFTMFEERGGGRRLMG-SFPMRGSRSSGDRGYDRMPSSRVGRGPLPPSRRDYDDISPRRGPPPPHHSRVVRPSGRSRNMPMGH-PHRGGDRRSRPDRYGDNMSGGYDNSSSWDSYQSGGRGSYSDMGGPVITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPL--EGSEDRIITITGTQDQIQNAQYLLQNSVKQYSG 414          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Medaka
Match: hnrpkl (heterogeneous nuclear ribonucleoprotein K-like [Source:NCBI gene;Acc:101167466])

HSP 1 Score: 122.865 bits (307), Expect = 9.582e-31
Identity = 73/219 (33.33%), Postives = 122/219 (55.71%), Query Frame = 3
Query:   90 EDNSFKSFRN----LQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYGGWMSLEARRHIARMGG 734
            E+ +FK  RN    ++ R L+    AGA+I K G+ IK LR  Y+  +SVP S+GPER++ ++  ID +  +L +I   +++  H          +GI        D +LR L+ +++ G IIG  G  I++L E  + + IK++Q+ CP STDRV+ + G PE ++ C++ I ++++        + YDPN ++E +  +YGG+  L   R    MGG
Sbjct:   28 EEQAFKRSRNADEMVELRVLLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSVSAGIDTIGDILLKIIPTLEEYQH---------YSGI------DFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQ-TTIKLFQECCPHSTDRVVLVGGKPERVVECIKVILELVSETTIKGRSQPYDPNFYDETY--DYGGFTMLFEDRGRRPMGG 228          

HSP 2 Score: 90.8929 bits (224), Expect = 1.246e-19
Identity = 43/82 (52.44%), Postives = 60/82 (73.17%), Query Frame = 3
Query:  969 GGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQACVRKYGGKHF 1214
            GGP+  + V++P  L G+I+GKGG RI +IR E+GA I +D+ +    S +RIITI G++DQIQNAQ+LLQ  VR+Y G+ F
Sbjct:  338 GGPVITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPL--EGSEDRIITITGTQDQIQNAQYLLQNSVRQYSGRFF 417          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Medaka
Match: hnrpkl (heterogeneous nuclear ribonucleoprotein K-like [Source:NCBI gene;Acc:101167466])

HSP 1 Score: 122.865 bits (307), Expect = 1.159e-30
Identity = 73/219 (33.33%), Postives = 122/219 (55.71%), Query Frame = 3
Query:   90 EDNSFKSFRN----LQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYGGWMSLEARRHIARMGG 734
            E+ +FK  RN    ++ R L+    AGA+I K G+ IK LR  Y+  +SVP S+GPER++ ++  ID +  +L +I   +++  H          +GI        D +LR L+ +++ G IIG  G  I++L E  + + IK++Q+ CP STDRV+ + G PE ++ C++ I ++++        + YDPN ++E +  +YGG+  L   R    MGG
Sbjct:   32 EEQAFKRSRNADEMVELRVLLQSKNAGAVIGKGGKNIKALRTDYNASVSVPDSSGPERILSVSAGIDTIGDILLKIIPTLEEYQH---------YSGI------DFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQ-TTIKLFQECCPHSTDRVVLVGGKPERVVECIKVILELVSETTIKGRSQPYDPNFYDETY--DYGGFTMLFEDRGRRPMGG 232          

HSP 2 Score: 90.5077 bits (223), Expect = 1.714e-19
Identity = 43/82 (52.44%), Postives = 60/82 (73.17%), Query Frame = 3
Query:  969 GGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQACVRKYGGKHF 1214
            GGP+  + V++P  L G+I+GKGG RI +IR E+GA I +D+ +    S +RIITI G++DQIQNAQ+LLQ  VR+Y G+ F
Sbjct:  341 GGPVITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPL--EGSEDRIITITGTQDQIQNAQYLLQNSVRQYSGRFF 420          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Medaka
Match: pcbp3 (poly(rC)-binding protein 3 [Source:NCBI gene;Acc:101158397])

HSP 1 Score: 120.168 bits (300), Expect = 2.017e-30
Identity = 102/360 (28.33%), Postives = 160/360 (44.44%), Query Frame = 3
Query:  117 NLQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEI-FEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYGGWMSLEARRHIARMGGPAPPTKGQTESGRNQSIIADLYGSAMSPASMVFTPGMTLGEMSDRLLAENILMDMGQEQMYGAPVATPLMPQLSMGSQGGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQACVR 1193
             L  R L+     G+II KKGET+K++R      I++   N PER++ I    D +    + I ++  +D ++S  N P              P + LR +V  + CG++IGKGG  I+++ E+    V +V   M P+ST+R + + G PE I+ C++ I  V+       +   Y P   +     + G   +++ +  I     P P              +  L+  AM      FTP                   +GQ         TP  P L       P     +++PN LIG I+G+ G++INEIR+ +GA+I +   M    SSER ITI G+   I  AQ+L+ A  R
Sbjct:   15 TLTIRLLMHGKEVGSIIGKKGETVKKMREESGARINISEGNCPERIVTITGPTDTIFKAFAMIAYKFEEDIINSMSNSP----------ATSKPPVTLRLVVPASQCGSLIGKGGSKIKEMRESTGAQV-QVAGDMLPNSTERAVTISGTPEAIIQCVKQICVVMLESPPKGATIPYRPKPASTPVIFSGGQAYTIQGQYAI-----PHP------------DQLTKLHQLAMQ--QTPFTP-------------------LGQ--------TTPAFPGLDAAP---PASTHELTIPNDLIGCIIGRQGTKINEIRQMSGAQIKIANAM--EGSSERQITITGTPANISLAQYLINARFR 312          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Medaka
Match: pcbp3 (poly(rC)-binding protein 3-like [Source:NCBI gene;Acc:101167429])

HSP 1 Score: 119.783 bits (299), Expect = 2.038e-30
Identity = 101/357 (28.29%), Postives = 161/357 (45.10%), Query Frame = 3
Query:  117 NLQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEI-FEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYGGWMSLEARRHIARMGGPAPPTKGQTESGRNQSIIADLYGSAMSPASMVFTPGMTLGEMSDRLLAENILMDMGQEQMYGAPVATPLMPQLSMGSQGGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQA 1184
             L  R L+     G+II KKGET+K++R      I++   N PER++ I    D +    + I ++  +D ++S  N P              P + LR +V  + CG++IGKGG  I+++ E+    V +V   M P+ST+R + + G PE I+ C++ I  V+       +   Y P   +     + G   +++ +  I     P P              ++ L+  AM      FTP                   +GQ         TP  P L   +Q        +++PN LIG I+G+ G++INEIR+ +GA+I +   M    SSER ITI G+   I  AQ+L+ A
Sbjct:   15 TLTIRLLMHGKEVGSIIGKKGETVKKMREDSGARINISEGNCPERIVTITGPTDAIFKAFAMIAYKFEEDIINSMSNSP----------ATSKPPVTLRLVVPASQCGSLIGKGGSKIKEMRESTGAQV-QVAGDMLPNSTERAVTISGAPEAIIQCVKQICVVMLESPPKGATIPYRPKPASTPVIFSGGQAYTIQGQYAI-----PHP------------DQLSKLHQLAMQ--QTPFTP-------------------LGQ--------TTPAFPGLDASNQA---STHELTIPNDLIGCIIGRQGTKINEIRQMSGAQIKIANAM--EGSSERQITITGTPANISLAQYLINA 309          

HSP 2 Score: 51.6026 bits (122), Expect = 7.135e-7
Identity = 28/64 (43.75%), Postives = 42/64 (65.62%), Query Frame = 3
Query:  999 LPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQACV 1190
            +P    G+++GKGGS+I E+RE TGA++ V   M+ N S+ER +TI G+ + I   Q + Q CV
Sbjct:  106 VPASQCGSLIGKGGSKIKEMRESTGAQVQVAGDMLPN-STERAVTISGAPEAI--IQCVKQICV 166          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Planmine SMEST
Match: SMESG000033971.1 (SMESG000033971.1)

HSP 1 Score: 798.505 bits (2061), Expect = 0.000e+0
Identity = 387/387 (100.00%), Postives = 387/387 (100.00%), Query Frame = 3
Query:   54 MNNSIISNNPYAEDNSFKSFRNLQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYGGWMSLEARRHIARMGGPAPPTKGQTESGRNQSIIADLYGSAMSPASMVFTPGMTLGEMSDRLLAENILMDMGQEQMYGAPVATPLMPQLSMGSQGGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQACVRKYGGKHF 1214
            MNNSIISNNPYAEDNSFKSFRNLQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYGGWMSLEARRHIARMGGPAPPTKGQTESGRNQSIIADLYGSAMSPASMVFTPGMTLGEMSDRLLAENILMDMGQEQMYGAPVATPLMPQLSMGSQGGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQACVRKYGGKHF
Sbjct:    1 MNNSIISNNPYAEDNSFKSFRNLQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYGGWMSLEARRHIARMGGPAPPTKGQTESGRNQSIIADLYGSAMSPASMVFTPGMTLGEMSDRLLAENILMDMGQEQMYGAPVATPLMPQLSMGSQGGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQACVRKYGGKHF 387          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Planmine SMEST
Match: SMESG000021955.1 (SMESG000021955.1)

HSP 1 Score: 199.904 bits (507), Expect = 7.947e-60
Identity = 130/383 (33.94%), Postives = 211/383 (55.09%), Query Frame = 3
Query:   93 DNSFKSFRNLQY--------RFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYGGWMSLEARRHIARMGGPAPPTKGQTESGRNQSIIADLYGSAMSPASMVFTPGMTLGEMSDRLLAEN----ILMDMGQEQMYGAPVATPLMPQLSMGSQGGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDN-KSSERIITIQGSRDQIQNAQFLLQACVRKYG 1202
            +NS  SF N ++        RFLIP  AAGA+I K GE IKRLR  ++  I VP S GPERL+II+     +  + ++I   +K+ M++K  D K   +  +       ++DLR +V E+  GA+IGKGGE IR L + +R+++IK+YQ  CP+STDR++R+V   E++L+CL  + +++ +       R+Y+P++++E  A NYGG++S ++R    R   P     G++    N    AD Y S  S  S V +  +  G  + R +          + G   ++G  +    +  LS       +  S +++P  L+ AI+G+ G RI++I  ++GA I++D   MD   S E +  ++G+ DQI  AQ L+Q C RK+ 
Sbjct:   11 NNSGDSFGNKKFLSGSMSGHRFLIPSKAAGAMIGKGGEIIKRLRTEHNARIIVPDSQGPERLLIIDASPSTILDIWNDILPSIKEYMNAKECDYKGSSSKFIEG---ENEIDLRLIVHESQAGAVIGKGGERIRNLIDKHRMTMIKLYQTFCPNSTDRIVRMVSRMENLLACLENVFELLENQSIKGEKRDYNPDDYDEATAPNYGGFVSRDSRFPTRRTSNPP----GRSLINDNAFETAD-YMSRPSVFSRVNSNKLEDGISAVRSIFNQSNPIAEYERGVSDLFGGVIRVGAINDLS------SMNFSRMAVPKNLVSAIIGREGRRIHDIERDSGASIEID---MDRVGSRETLFVLRGNPDQIYKAQCLMQLCARKFA 376          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Planmine SMEST
Match: SMESG000021944.1 (SMESG000021944.1)

HSP 1 Score: 182.185 bits (461), Expect = 3.889e-53
Identity = 115/363 (31.68%), Postives = 197/363 (54.27%), Query Frame = 3
Query:   90 EDNSFKSFRNLQ---YRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPK----DIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYGGWMSLEARRHIARMGGPAPPTKGQTESGRNQSIIADLYGSAMSPASMVFTPGMTLGEMSDRLLAENILMDMGQEQMYGAPVATPLMPQLSMGSQGGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQI 1157
            E ++ K F  +    +RFLIP  AAGA+I K GE IKRLR  ++C I VP S GPERL+II+     + G+ ++I   +K+ M++K  D K      I G         ++DLR +V E+  GA+IGKGGE IR L + + +++IK+Y+  CP+STDRV+R+V   E++++CL  + +++ +     + ++Y+P+N++E  A +YGG++S ++R          PP +   +       +      A  P    +  GM  G     +   N +MD G   ++G  +    +  +++      +  S +++P  L+ A++GK G R+ ++  E GA I+++   M+   S  +  I+GS DQI
Sbjct:   15 ESSNKKKFETISPPGHRFLIPSKAAGAMIGKGGEIIKRLRTEHNCRIIVPDSQGPERLVIIDGSPSTVLGIWNDILPSIKEYMNAKDCDYKGSSSKYIEG-------DDEIDLRMIVHESQAGAVIGKGGERIRNLIDGHAMTIIKLYKMFCPNSTDRVVRMVSKIENVMACLANVFELLDNQAIKGARKDYNPDNYDESIAPDYGGFISKDSRN---------PPRRNMQQP---DDFMPHPNAFARPPIPHGYDDGMYGGVRPMNIPHNNPIMDRGVNDLFGGSLRINPVNDINI------MNTSRITVPQNLVSAVVGKDGRRLGDLERECGASIEMEVDRMNMGDS--VFIIRGSPDQI 350          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Planmine SMEST
Match: SMESG000029221.1 (SMESG000029221.1)

HSP 1 Score: 162.155 bits (409), Expect = 4.844e-46
Identity = 107/363 (29.48%), Postives = 181/363 (49.86%), Query Frame = 3
Query:  120 LQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPKDIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPR-EYDPNNFNEMHAVNYGGWMSLEARRHIARMGGPAPPTKGQTESGRNQSIIADLYGSAMSPASMVFT-PGMTLGEMSDRLLAENILMDMGQEQMYGAPVATPLMPQLSMGSQGGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMMDNKSSERIITIQGSRDQIQNAQFLLQACVRKYG 1202
            ++ RFLIP  AAG++I K GE I+ LR  +   I++  ++GPER++ +  D+D + G+L++  E ++ C+        D  +        + ++DLR LV++++ GA+IG+GG  I  L E   + V+KVYQ +CP STDR++++VG    ++ C+  I D+       R P+  YD  N++   A +YGGW              P  P                     ++  S+ F+ PG     M  +   +N   D      Y   + T          Q    E+  + LP+K++GAI+G GGSRI ++R ++GA I +  + +D    ER++TI G+   ++ A  ++  C+ KYG
Sbjct:   21 IELRFLIPSKAAGSVIGKSGENIRNLRRLFMARINISDNSGPERILSLEADLDTILGILAQCLEKMEGCIPLPRAGSGDCNDN-------ASNVDLRMLVNQSLVGALIGRGGGRINDLREKCDLRVLKVYQTVCPESTDRIVQMVGAIPLVIDCIGKIVDMCKETP-VREPKVNYDAQNYDHATANHYGGWAQ-----------SPIRPDN-------------------IATRSLGFSRPGF----MKHQSTYKNEHYDYSYPNNY-REMDTSFRNTTHYEDQES--EIQEIRLPHKVVGAIIGPGGSRIQQVRMDSGAHITI--SSLDRNPQERVVTISGNTQDVKRAYNMINECLGKYG 336          
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Planmine SMEST
Match: SMESG000064674.1 (SMESG000064674.1)

HSP 1 Score: 133.65 bits (335), Expect = 2.488e-34
Identity = 68/196 (34.69%), Postives = 114/196 (58.16%), Query Frame = 3
Query:  120 LQYRFLIPQPAAGAIISKKGETIKRLRATYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPKDIINGIMPDGML---SPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVIKVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPNNFNEMHAVNYGGWMS 698
            +++RFLIP  AA  II K GE I+RLR   +  +S+P ++GPER+ I+ + ++    +  E    +K+CM + ++  +       P G     +P++D+RFLV ++  GAIIGKGG  ++ L   +++S+IKV+    P+S+DR++++VG  + +  C R I+D I S         Y+  NF+E     YGG+ S
Sbjct:   28 IEFRFLIPSKAASVIIGKGGERIQRLRYECNARLSIPDNHGPERVFILESTMENCIKIWRECVPELKECMSANVDQRR-------PAGSFRDDNPEIDIRFLVHDSQVGAIIGKGGVNVKNLRMQHQLSIIKVFPVPAPNSSDRLVQIVGKFDKVFECFRVIYDTIESQTIKGKVENYNSENFDESLTAQYGGYNS 216          

HSP 2 Score: 62.7734 bits (151), Expect = 1.813e-10
Identity = 41/105 (39.05%), Postives = 60/105 (57.14%), Query Frame = 3
Query:  888 LMDMGQEQMYGAPVATP-LMPQLSMGSQGGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDV-DKTMMDNKSSERIITIQGSRDQIQNAQFLLQACVRK 1196
              D   E M   PV T  L+P  S+     PIE   VSLP  LI AI G  G  +++I  E+GA I + ++   D ++SE I+ + G++DQI+ AQ+L+Q  V+K
Sbjct:  372 FFDNRNEGMNRNPVVTASLLPSNSLP----PIEKVEVSLPKSLIHAIKGPNGEILSKIINESGAEISIGEEDFNDEQNSESILHLTGTKDQIEGAQYLMQIRVKK 472          
The following BLAST results are available for this feature:
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HNRNPK1.672e-3134.27heterogeneous nuclear ribonucleoprotein K [Source:... [more]
PCBP32.454e-3129.17poly(rC) binding protein 3 [Source:HGNC Symbol;Acc... [more]
PCBP32.454e-3129.17poly(rC) binding protein 3 [Source:HGNC Symbol;Acc... [more]
PCBP31.079e-3028.29poly(rC) binding protein 3 [Source:HGNC Symbol;Acc... [more]
PCBP32.326e-3028.29poly(rC) binding protein 3 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hrpk-15.529e-3427.82Heterogeneous nuclear RibonucleoProtein (HnRNP) K ... [more]
hrpk-15.529e-3427.82Heterogeneous nuclear RibonucleoProtein (HnRNP) K ... [more]
hrpk-18.441e-3427.82Heterogeneous nuclear RibonucleoProtein (HnRNP) K ... [more]
pes-44.329e-1528.26Patterned Expression Site [Source:UniProtKB/TrEMB... [more]
fubl-34.441e-1120.99FUBp (FUBP) Like [Source:UniProtKB/TrEMBL;Acc:Q9B... [more]
back to top
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HnRNP-K2.557e-2330.27gene:FBgn0267791 transcript:FBtr0086220[more]
HnRNP-K2.557e-2330.27gene:FBgn0267791 transcript:FBtr0336730[more]
HnRNP-K2.617e-2330.27gene:FBgn0267791 transcript:FBtr0086221[more]
HnRNP-K2.635e-2330.27gene:FBgn0267791 transcript:FBtr0301760[more]
mub6.641e-1925.07gene:FBgn0262737 transcript:FBtr0304981[more]
back to top
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hnrpkl3.025e-3233.79heterogeneous nuclear ribonucleoprotein K, like [S... [more]
hnrpkl3.114e-3233.79heterogeneous nuclear ribonucleoprotein K, like [S... [more]
hnrpkl3.114e-3233.79heterogeneous nuclear ribonucleoprotein K, like [S... [more]
pcbp31.726e-2928.18poly(rC) binding protein 3 [Source:ZFIN;Acc:ZDB-GE... [more]
pcbp31.726e-2928.18poly(rC) binding protein 3 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hnrnpk9.279e-3334.09heterogeneous nuclear ribonucleoprotein K [Source:... [more]
ENSXETT00000046760.12.974e-2828.88poly(rC) binding protein 3 [Source:NCBI gene;Acc:1... [more]
ENSXETT00000046774.14.041e-2828.57poly(rC) binding protein 3 [Source:NCBI gene;Acc:1... [more]
cert11.540e-2628.14ceramide transporter 1 [Source:Xenbase;Acc:XB-GENE... [more]
ENSXETT00000046813.16.373e-2628.95poly(rC) binding protein 3 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hnrnpk2.743e-3234.27heterogeneous nuclear ribonucleoprotein K [Source:... [more]
Hnrnpk1.467e-3134.27heterogeneous nuclear ribonucleoprotein K [Source:... [more]
Hnrnpk1.630e-3134.27heterogeneous nuclear ribonucleoprotein K [Source:... [more]
Pcbp36.769e-3128.29poly(rC) binding protein 3 [Source:MGI Symbol;Acc:... [more]
Hnrnpk8.570e-3132.88heterogeneous nuclear ribonucleoprotein K [Source:... [more]
back to top
BLAST of heterogeneous nuclear ribonucleoprotein K vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P91277|HRPK1_CAEEL1.074e-3227.82Heterogeneous nuclear ribonucleoprotein K homolog ... [more]
sp|Q5ZIQ3|HNRPK_CHICK3.770e-3033.80Heterogeneous nuclear ribonucleoprotein K OS=Gallu... [more]
sp|P57722|PCBP3_MOUSE9.611e-3028.29Poly(rC)-binding protein 3 OS=Mus musculus OX=1009... [more]
sp|P57721|PCBP3_HUMAN1.117e-2928.29Poly(rC)-binding protein 3 OS=Homo sapiens OX=9606... [more]
sp|O19049|HNRPK_RABIT8.958e-2932.88Heterogeneous nuclear ribonucleoprotein K OS=Oryct... [more]
back to top
BLAST of heterogeneous nuclear ribonucleoprotein K vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A023ZS140.000e+0100.00Heterogeneous nuclear ribonucleoprotein K OS=Schmi... [more]
A0A0R3X4X22.186e-5732.83Uncharacterized protein OS=Hydatigena taeniaeformi... [more]
A0A0R3VZ023.798e-5732.83Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A068Y5G67.108e-5734.26Heterolocus tagous nuclear ribonucleoprotein OS=Ec... [more]
U6JJH47.108e-5734.26Heterogeneous nuclear ribonucleoprotein OS=Echinoc... [more]
back to top
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hnrpkl8.757e-3132.88heterogeneous nuclear ribonucleoprotein K-like [So... [more]
hnrpkl1.772e-3032.88heterogeneous nuclear ribonucleoprotein K-like [So... [more]
hnrpkl2.526e-3032.88heterogeneous nuclear ribonucleoprotein K-like [So... [more]
pcbp37.183e-3028.18poly(rC)-binding protein 3 [Source:NCBI gene;Acc:1... [more]
hnrnpk3.161e-2832.55heterogeneous nuclear ribonucleoprotein K [Source:... [more]
back to top
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005114.19.556e-2725.56pep scaffold:Pmarinus_7.0:GL476545:177182:183416:1... [more]
ENSPMAT00000005105.11.741e-1831.48pep scaffold:Pmarinus_7.0:GL501087:1205:15413:-1 g... [more]
zgc:1100451.624e-828.10zgc:110045 [Source:ZFIN;Acc:ZDB-GENE-050706-149][more]
igf2bp2b5.762e-822.79insulin-like growth factor 2 mRNA binding protein ... [more]
ENSPMAT00000009168.13.841e-722.66pep scaffold:Pmarinus_7.0:GL479182:17814:35570:1 g... [more]
back to top
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
HEK21.139e-723.04RNA binding protein involved in asymmetric localiz... [more]
back to top
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO424857.633e-1626.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356921.331e-1424.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO372438.939e-1427.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO254441.941e-843.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
EDO382033.669e-822.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hnrnpk3.787e-5132.11heterogeneous nuclear ribonucleoprotein K [Source:... [more]
hnrpkl9.582e-3133.33heterogeneous nuclear ribonucleoprotein K-like [So... [more]
hnrpkl1.159e-3033.33heterogeneous nuclear ribonucleoprotein K-like [So... [more]
pcbp32.017e-3028.33poly(rC)-binding protein 3 [Source:NCBI gene;Acc:1... [more]
pcbp32.038e-3028.29poly(rC)-binding protein 3-like [Source:NCBI gene;... [more]
back to top
BLAST of heterogeneous nuclear ribonucleoprotein K vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033971.10.000e+0100.00SMESG000033971.1[more]
SMESG000021955.17.947e-6033.94SMESG000021955.1[more]
SMESG000021944.13.889e-5331.68SMESG000021944.1[more]
SMESG000029221.14.844e-4629.48SMESG000029221.1[more]
SMESG000064674.12.488e-3434.69SMESG000064674.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30022089
GenBankAHY82402.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022089 ID=SMED30022089|Name=heterogeneous nuclear ribonucleoprotein K|organism=Schmidtea mediterranea sexual|type=transcript|length=1273bp
TGAATAATGTCGTTAGTTATTATTTTCTTTACGTATATTCAAATTAGCCT
GGAATGAATAATTCAATTATTTCTAATAATCCATATGCTGAGGATAACTC
ATTTAAATCTTTCAGAAATCTTCAGTATAGGTTTTTAATTCCTCAACCCG
CAGCTGGTGCGATCATTAGCAAAAAAGGCGAAACCATTAAAAGACTTCGG
GCAACATATAGCTGTGATATTTCTGTACCACCAAGTAATGGACCAGAAAG
GTTGATGATAATCAATACTGATATTGATAAATTATGTGGCGTTTTATCTG
AGATTTTTGAAATTGTGAAGGATTGTATGCACAGCAAGATAAATGATCCT
AAAGATATTATTAACGGTATTATGCCAGATGGAATGTTGAGCCCTGATAT
GGATTTAAGGTTTCTTGTTAGTGAAAATGTTTGTGGTGCAATAATTGGAA
AAGGCGGAGAAGTAATAAGAAAGTTAACTGAAACATACAGGGTTAGTGTA
ATAAAGGTTTATCAACAAATGTGTCCATCTTCAACTGATCGGGTTATTCG
ATTAGTTGGTCTTCCTGAAGATATTTTAAGTTGTCTTAGGGCAATTCATG
ATGTTATTGCTAGTTTAAAAGACACAAGATCACCCCGAGAATATGATCCC
AATAACTTCAATGAGATGCATGCTGTTAATTACGGTGGCTGGATGTCATT
GGAAGCTAGGAGACACATTGCTCGAATGGGAGGCCCTGCTCCTCCAACTA
AGGGTCAAACTGAAAGTGGCCGTAATCAGTCAATCATTGCCGATTTATAT
GGTAGCGCCATGAGTCCAGCATCAATGGTTTTTACACCCGGAATGACTTT
GGGAGAAATGAGCGATCGACTGTTAGCAGAGAACATCTTGATGGACATGG
GCCAAGAACAAATGTATGGGGCTCCAGTTGCAACACCTCTGATGCCACAA
TTGTCTATGGGATCTCAAGGCGGACCGATTGAGGTCTCACACGTTTCATT
GCCAAATAAGTTGATTGGAGCGATTATGGGAAAAGGAGGTTCAAGAATCA
ACGAAATTCGTGAAGAAACAGGGGCAAGGATTGATGTCGATAAAACAATG
ATGGACAATAAATCAAGCGAGCGAATAATTACAATTCAAGGATCCCGTGA
TCAAATACAGAACGCACAATTTCTTTTACAAGCATGCGTCAGGAAATATG
GCGGAAAGCATTTCTAGTTGTTGTTAACATGTCCGTGTTTCGTTGTGTTT
AATACTAATATATTTAATCCGTG
back to top

protein sequence of SMED30022089-orf-1

>SMED30022089-orf-1 ID=SMED30022089-orf-1|Name=SMED30022089-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=388bp
MNNSIISNNPYAEDNSFKSFRNLQYRFLIPQPAAGAIISKKGETIKRLRA
TYSCDISVPPSNGPERLMIINTDIDKLCGVLSEIFEIVKDCMHSKINDPK
DIINGIMPDGMLSPDMDLRFLVSENVCGAIIGKGGEVIRKLTETYRVSVI
KVYQQMCPSSTDRVIRLVGLPEDILSCLRAIHDVIASLKDTRSPREYDPN
NFNEMHAVNYGGWMSLEARRHIARMGGPAPPTKGQTESGRNQSIIADLYG
SAMSPASMVFTPGMTLGEMSDRLLAENILMDMGQEQMYGAPVATPLMPQL
SMGSQGGPIEVSHVSLPNKLIGAIMGKGGSRINEIREETGARIDVDKTMM
DNKSSERIITIQGSRDQIQNAQFLLQACVRKYGGKHF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000136whole organism
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036612KH_dom_type_1_sf
IPR004087KH_dom
IPR004088KH_dom_type_1
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0003723RNA binding
Vocabulary: cellular component
TermDefinition
GO:0019013viral nucleocapsid
GO:0030529intracellular ribonucleoprotein complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004087K Homology domainSMARTSM00322kh_6coord: 114..186
e-value: 4.7E-8
score: 42.7
coord: 308..380
e-value: 4.0E-16
score: 69.6
coord: 21..89
e-value: 4.7E-5
score: 32.8
IPR036612K Homology domain, type 1 superfamilyGENE3DG3DSA:3.30.1370.10coord: 307..387
e-value: 4.4E-22
score: 79.5
IPR036612K Homology domain, type 1 superfamilyGENE3DG3DSA:3.30.1370.10coord: 21..90
e-value: 1.4E-12
score: 48.9
IPR036612K Homology domain, type 1 superfamilyGENE3DG3DSA:3.30.1370.10coord: 111..187
e-value: 1.0E-16
score: 62.1
IPR036612K Homology domain, type 1 superfamilySUPERFAMILYSSF54791Eukaryotic type KH-domain (KH-domain type I)coord: 24..93
IPR036612K Homology domain, type 1 superfamilySUPERFAMILYSSF54791Eukaryotic type KH-domain (KH-domain type I)coord: 116..188
IPR036612K Homology domain, type 1 superfamilySUPERFAMILYSSF54791Eukaryotic type KH-domain (KH-domain type I)coord: 309..381
IPR004088K Homology domain, type 1PFAMPF00013KH_1coord: 119..182
e-value: 5.3E-11
score: 42.2
coord: 313..376
e-value: 1.3E-19
score: 69.8
coord: 25..70
e-value: 1.4E-8
score: 34.4
NoneNo IPR availablePANTHERPTHR10288KH DOMAIN CONTAINING RNA BINDING PROTEINcoord: 20..381
NoneNo IPR availablePANTHERPTHR10288:SF179HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN Kcoord: 20..381
NoneNo IPR availablePROSITEPS50084KH_TYPE_1coord: 115..181
score: 12.978
NoneNo IPR availablePROSITEPS50084KH_TYPE_1coord: 309..375
score: 19.162
NoneNo IPR availablePROSITEPS50084KH_TYPE_1coord: 22..84
score: 10.211
NoneNo IPR availableCDDcd02396PCBP_like_KHcoord: 118..182
e-value: 6.03958E-14
score: 64.0347
NoneNo IPR availableCDDcd02396PCBP_like_KHcoord: 317..371
e-value: 2.8751E-17
score: 73.2795