TNFR CD27 30 40 95 cysteine rich region

Overview
NameTNFR CD27 30 40 95 cysteine rich region
Smed IDSMED30022087
Length (bp)6980
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNFR CD27 30 40 95 cysteine rich region (SMED30022087) t-SNE clustered cells

Violin plots show distribution of expression levels for TNFR CD27 30 40 95 cysteine rich region (SMED30022087) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNFR CD27 30 40 95 cysteine rich region (SMED30022087) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNFR CD27 30 40 95 cysteine rich region (SMED30022087) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022087

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30022087SMESG000065173.1 SmedASXL_017687SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30022087SMESG000065173.1 dd_Smed_v4_3783_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022087SMESG000065173.1 dd_Smed_v4_3783_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30022087SMESG000065173.1 dd_Smed_v4_3783_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30022087SMESG000065173.1 dd_Smed_v4_3783_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30022087SMESG000065173.1 dd_Smed_v4_3783_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30022087SMESG000065173.1 dd_Smed_v4_3783_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30022087SMESG000065173.1 dd_Smed_v4_3783_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022087SMESG000065173.1 SMESG000046897.1 Contig33164uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022087SMESG000065173.1 SMESG000046897.1 Contig33164newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022087SMESG000065173.1 Contig5757uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022087SMESG000065173.1 Contig5757newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022087SMESG000048274.1 Contig5757uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022087SMESG000048274.1 Contig5757newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30022087SMESG000065173.1 dd_Smed_v6_3783_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30022087SMESG000065173.1 dd_Smed_v4_3783_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Human
Match: HMCN1 (hemicentin 1 [Source:HGNC Symbol;Acc:HGNC:19194])

HSP 1 Score: 67.781 bits (164), Expect = 3.157e-10
Identity = 46/147 (31.29%), Postives = 66/147 (44.90%), Query Frame = 2
Query: 2387 NQEVCRQRYSCSHSCDPGNG-HRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECIC----------DGEICKDCNEKCLTNYFKKNSCAQSK--HLQCSKCTSE----CSPGYYI-SRKCTETSNIQCTACRP 2773
            +++ C     CSHSC    G + C+C +G  + +DG+TC DI+EC    + C   G  C N +GSY C+           DG  C+D NE           C +S   H +C          C PGY +  RKC + +  +   CRP
Sbjct: 5107 DEDECAAGNPCSHSCHNAMGTYYCSCPKGLTIAADGRTCQDIDECALGRHTC-HAGQDCDNTIGSYRCVVRCGSGFRRTSDGLSCQDINE-----------CQESSPCHQRCFNAIGSFHCGCEPGYQLKGRKCMDVNECRQNVCRP 5241          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Human
Match: HMCN2 (hemicentin 2 [Source:HGNC Symbol;Acc:HGNC:21293])

HSP 1 Score: 65.855 bits (159), Expect = 1.327e-9
Identity = 34/82 (41.46%), Postives = 46/82 (56.10%), Query Frame = 2
Query: 2417 CSHSCDPGNGH-RCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYEC---------ICDGEICKDCNEKCL 2632
            CSH+C    G   CTC  GFAL  D + C D++EC  + ++C + G  CVN+LGSY C         + DG  C+D +E CL
Sbjct: 4639 CSHACLNAPGRFSCTCPTGFALAWDDRNCRDVDECAWDAHLC-REGQRCVNLLGSYRCLPDCGPGFRVADGAGCEDVDE-CL 4718          

HSP 2 Score: 60.077 bits (144), Expect = 7.746e-8
Identity = 28/65 (43.08%), Postives = 34/65 (52.31%), Query Frame = 2
Query: 2399 CRQRYSCSHSCDPGNG-HRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECI 2590
            CR R  C H+C    G ++C C  G+ L   GK C DINEC      CG  G  C N  GSY+C+
Sbjct: 4867 CRVRNLCQHACRNTEGSYQCLCPAGYRLLPSGKNCQDINECEEESIECGP-GQMCFNTRGSYQCV 4930          

HSP 3 Score: 53.5286 bits (127), Expect = 8.127e-6
Identity = 27/78 (34.62%), Postives = 38/78 (48.72%), Query Frame = 2
Query: 2399 CRQRYSCSHSCDPGNGHRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECIC--------DGEIC 2608
            C     C ++  PG GHRC+C RG+ ++     C+D+NEC      C      C N+ GSY C+C        DG+ C
Sbjct: 4724 CHYNQLCENT--PG-GHRCSCPRGYRMQGPSLPCLDVNECLQLPKACAY---QCHNLQGSYRCLCPPGQTLLRDGKAC 4795          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Human
Match: SCUBE2 (signal peptide, CUB domain and EGF like domain containing 2 [Source:HGNC Symbol;Acc:HGNC:30425])

HSP 1 Score: 60.4622 bits (145), Expect = 4.687e-8
Identity = 54/161 (33.54%), Postives = 68/161 (42.24%), Query Frame = 2
Query: 2339 RNSIDIYDMKNSLNILNQEVCRQRYSCSHSC--DPGNGHRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECIC-DGEICKDCNEKCLTNYFKKNSCAQSKHLQCSKC--------TSECSPGYYIS---RKCTETSNIQCTACRPLC 2779
            R   DI +  N LN            C H C   PGN +RCTC  GF L  DG  C+D++EC  N   C     TCVN++GSYEC C +G    D    C+    +  SC    H     C          EC PG+ ++   R C  T N     C+  C
Sbjct:   82 RQCEDIDECGNELN----------GGCVHDCLNIPGN-YRCTCFDGFMLAHDGHNCLDVDECLENNGGCQH---TCVNVMGSYECCCKEGFFLSDNQHTCIHRSEEGLSCMNKDHGCSHICKEAPRGSVACECRPGFELAKNQRDCILTCNHGNGGCQHSC 228          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Human
Match: SCUBE2 (signal peptide, CUB domain and EGF like domain containing 2 [Source:HGNC Symbol;Acc:HGNC:30425])

HSP 1 Score: 60.077 bits (144), Expect = 5.898e-8
Identity = 54/161 (33.54%), Postives = 68/161 (42.24%), Query Frame = 2
Query: 2339 RNSIDIYDMKNSLNILNQEVCRQRYSCSHSC--DPGNGHRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECIC-DGEICKDCNEKCLTNYFKKNSCAQSKHLQCSKC--------TSECSPGYYIS---RKCTETSNIQCTACRPLC 2779
            R   DI +  N LN            C H C   PGN +RCTC  GF L  DG  C+D++EC  N   C     TCVN++GSYEC C +G    D    C+    +  SC    H     C          EC PG+ ++   R C  T N     C+  C
Sbjct:   82 RQCEDIDECGNELN----------GGCVHDCLNIPGN-YRCTCFDGFMLAHDGHNCLDVDECLENNGGCQH---TCVNVMGSYECCCKEGFFLSDNQHTCIHRSEEGLSCMNKDHGCSHICKEAPRGSVACECRPGFELAKNQRDCILTCNHGNGGCQHSC 228          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Human
Match: SCUBE2 (signal peptide, CUB domain and EGF like domain containing 2 [Source:HGNC Symbol;Acc:HGNC:30425])

HSP 1 Score: 60.077 bits (144), Expect = 6.097e-8
Identity = 54/161 (33.54%), Postives = 68/161 (42.24%), Query Frame = 2
Query: 2339 RNSIDIYDMKNSLNILNQEVCRQRYSCSHSC--DPGNGHRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECIC-DGEICKDCNEKCLTNYFKKNSCAQSKHLQCSKC--------TSECSPGYYIS---RKCTETSNIQCTACRPLC 2779
            R   DI +  N LN            C H C   PGN +RCTC  GF L  DG  C+D++EC  N   C     TCVN++GSYEC C +G    D    C+    +  SC    H     C          EC PG+ ++   R C  T N     C+  C
Sbjct:   82 RQCEDIDECGNELN----------GGCVHDCLNIPGN-YRCTCFDGFMLAHDGHNCLDVDECLENNGGCQH---TCVNVMGSYECCCKEGFFLSDNQHTCIHRSEEGLSCMNKDHGCSHICKEAPRGSVACECRPGFELAKNQRDCILTCNHGNGGCQHSC 228          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Celegans
Match: fbl-1 (Fibulin-1 [Source:UniProtKB/Swiss-Prot;Acc:O77469])

HSP 1 Score: 54.6842 bits (130), Expect = 8.558e-7
Identity = 65/240 (27.08%), Postives = 95/240 (39.58%), Query Frame = 2
Query: 2453 CTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECIC--------DGEICKDCNEKCL----TNYFKKNSCAQSKHLQCSKCTSECSPGYYI---SRKCTETSNIQCTACRPLCITGEFELSPCSGTSNRICKSRLSISGIELPDKKNVWYEDRRNLRDIHHIISLDEAAKLSQDKELILE--RESGYQIRLKFDSEITLQPLFEPVDHSVYNDNALFKINPSNYTLKYL 3121
            C C+ GF L SDG+ C D+NEC T +  C +    CVNI GSY+CIC        DG  C+D +E  +     N      C  +K         +C PGY I    R C +                E  +  C+G S+++C + L        D    +  D  N   I    S  +    ++D E +    RE  YQ R     +  + P+   V   V +    F +   +Y L Y+
Sbjct:  457 CKCKPGFQLASDGRRCEDVNECTTGIAACEQ---KCVNIPGSYQCICDRGFALGPDGTKCEDIDECSIWAGSGNDLCMGGCINTKGSY----LCQCPPGYKIQPDGRTCVDVD--------------ECAMGECAG-SDKVCVNTLGSFKCHSIDCPTNYIHDSLNKNQIADGYSCIKVCS-TEDTECLGNHTREVLYQFRAVPSLKTIISPI--EVSRIVTHMGVPFSV---DYNLDYV 668          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Celegans
Match: fbl-1 (Fibulin-1 [Source:UniProtKB/Swiss-Prot;Acc:O77469])

HSP 1 Score: 54.6842 bits (130), Expect = 9.438e-7
Identity = 26/48 (54.17%), Postives = 32/48 (66.67%), Query Frame = 2
Query: 2453 CTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECICD 2596
            C C+ GF L SDG+ C D+NEC T +  C +    CVNI GSY+CICD
Sbjct:  457 CKCKPGFQLASDGRRCEDVNECTTGIAACEQ---KCVNIPGSYQCICD 501          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Celegans
Match: fbl-1 (Fibulin-1 [Source:UniProtKB/Swiss-Prot;Acc:O77469])

HSP 1 Score: 54.6842 bits (130), Expect = 9.647e-7
Identity = 66/243 (27.16%), Postives = 99/243 (40.74%), Query Frame = 2
Query: 2450 RCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECIC--------DGEICKDCNEKCL----TNYFKKNSCAQSKHLQCSKCTSECSPGYYI---SRKCTETSNIQCTACRPLCITGEFELSPCSGTSNRICKSRLSISGIELPDKKNVWYEDRRNLRDIHHIISLDEAAKLSQDKELILE--RESGYQIRLKFDSEITLQPLFEPVDHS--VYNDNALFKINPSNYTLKYL 3121
             C C+ GF L SDG+ C D+NEC T +  C +    CVNI GSY+CIC        DG  C+D +E  +     N      C  +K         +C PGY I    R C +                E  +  C+G S+++C + L        D    +  D  N   I    S  +    ++D E +    RE  YQ R    +  +L+ +  P++ S  V +    F +   +Y L Y+
Sbjct:  417 ECKCKPGFQLASDGRRCEDVNECTTGIAACEQ---KCVNIPGSYQCICDRGFALGPDGTKCEDIDECSIWAGSGNDLCMGGCINTKGSY----LCQCPPGYKIQPDGRTCVDVD--------------ECAMGECAG-SDKVCVNTLGSFKCHSIDCPTNYIHDSLNKNQIADGYSCIKVCS-TEDTECLGNHTREVLYQFR----AVPSLKTIISPIEVSRIVTHMGVPFSV---DYNLDYV 629          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Celegans
Match: fbl-1 (Fibulin-1 [Source:UniProtKB/Swiss-Prot;Acc:O77469])

HSP 1 Score: 53.9138 bits (128), Expect = 1.363e-6
Identity = 26/48 (54.17%), Postives = 32/48 (66.67%), Query Frame = 2
Query: 2453 CTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECICD 2596
            C C+ GF L SDG+ C D+NEC T +  C +    CVNI GSY+CICD
Sbjct:  418 CKCKPGFQLASDGRRCEDVNECTTGIAACEQ---KCVNIPGSYQCICD 462          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Celegans
Match: mec-1 (pep chromosome:WBcel235:V:6956537:6961338:1 gene:WBGene00003165.1 transcript:T07H8.4c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mec-1)

HSP 1 Score: 53.5286 bits (127), Expect = 2.471e-6
Identity = 31/80 (38.75%), Postives = 43/80 (53.75%), Query Frame = 2
Query: 2429 CDPGNG----HRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECICDGEI-----CKDCNEKCLTNY 2641
            CDP  G     +C C +GF   S GK C+D+NEC+ N  +CG     CVN +GS++C+CD        CK   E C+  +
Sbjct:  171 CDPLYGTCLDGKCGCMKGF--RSLGKVCIDLNECD-NGAVCGP-NARCVNEIGSFQCVCDAGFSTDGDCKIGQEACMDEF 246          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Fly
Match: frac (gene:FBgn0035798 transcript:FBtr0331840)

HSP 1 Score: 52.373 bits (124), Expect = 7.384e-6
Identity = 31/84 (36.90%), Postives = 46/84 (54.76%), Query Frame = 2
Query: 2345 SIDIYDMKNSLNILNQEVCRQRYSCSHSCD--PGNGHRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECI 2590
            ++D  D  + L+I   E       CS  C+  PG  ++C+CQ G+ L+  GK+C+DINEC  N  +     G C N+ GSY C+
Sbjct:  281 TLDPNDYASCLDI--DECLESNGGCSEICENLPGE-YKCSCQEGYYLDESGKSCVDINEC-ANPELSSNCQGACENLPGSYRCV 360          

HSP 2 Score: 51.9878 bits (123), Expect = 8.886e-6
Identity = 26/63 (41.27%), Postives = 37/63 (58.73%), Query Frame = 2
Query: 2402 RQRYSCSHSCDPGNG-HRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYEC 2587
            +Q   CSH C    G  +C+C  G+ L+SD KTC DI+EC+ +   C    GTC+N +G + C
Sbjct:  756 KQNGGCSHRCSNTEGSFKCSCPPGYELDSDQKTCQDIDECDQDKTSC--ITGTCINEIGGFRC 816          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Fly
Match: frac (gene:FBgn0035798 transcript:FBtr0331839)

HSP 1 Score: 52.373 bits (124), Expect = 7.384e-6
Identity = 31/84 (36.90%), Postives = 46/84 (54.76%), Query Frame = 2
Query: 2345 SIDIYDMKNSLNILNQEVCRQRYSCSHSCD--PGNGHRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECI 2590
            ++D  D  + L+I   E       CS  C+  PG  ++C+CQ G+ L+  GK+C+DINEC  N  +     G C N+ GSY C+
Sbjct:  281 TLDPNDYASCLDI--DECLESNGGCSEICENLPGE-YKCSCQEGYYLDESGKSCVDINEC-ANPELSSNCQGACENLPGSYRCV 360          

HSP 2 Score: 51.9878 bits (123), Expect = 8.886e-6
Identity = 26/63 (41.27%), Postives = 37/63 (58.73%), Query Frame = 2
Query: 2402 RQRYSCSHSCDPGNG-HRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYEC 2587
            +Q   CSH C    G  +C+C  G+ L+SD KTC DI+EC+ +   C    GTC+N +G + C
Sbjct:  756 KQNGGCSHRCSNTEGSFKCSCPPGYELDSDQKTCQDIDECDQDKTSC--ITGTCINEIGGFRC 816          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Zebrafish
Match: hmcn1 (hemicentin 1 [Source:ZFIN;Acc:ZDB-GENE-041014-322])

HSP 1 Score: 66.2402 bits (160), Expect = 6.439e-10
Identity = 42/136 (30.88%), Postives = 66/136 (48.53%), Query Frame = 2
Query: 2399 CRQRYSCSHSCDPGNG-HRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECI----------CDGEICKDCNEKCLTNYFKKNSCAQSKHLQCSKCTSECSPGYYI-SRKCTETSNIQCTACR 2770
            C +   CSH+C    G + C+C RG  + +DG+TC DI+EC+   ++C   G  C N +GSY C+           DG  C D NE   +N   ++        +C+     C PGY + +R+C + +  +   CR
Sbjct: 5086 CVEGNPCSHACHNAIGTYYCSCPRGLTISADGRTCQDIDECSLGGHMCHD-GQDCENTIGSYRCVMRCGRGFRRTADGLSCSDVNECQESNPCHQHCLNTIGSFRCA-----CEPGYQLRNRRCIDINECKQRVCR 5215          

HSP 2 Score: 58.9214 bits (141), Expect = 1.194e-7
Identity = 31/66 (46.97%), Postives = 39/66 (59.09%), Query Frame = 2
Query: 2399 CRQRYSCSHSC--DPGNGHRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECI 2590
            C QR +C H C   PG+ HRC C  G+ L ++GKTC DI+EC      CG     C N+ GSY+CI
Sbjct: 5415 CEQRDTCQHECMNTPGS-HRCLCPSGYRLMTNGKTCQDIDECLEQNIQCGA-NRMCFNMRGSYQCI 5478          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Zebrafish
Match: hmcn1 (hemicentin 1 [Source:ZFIN;Acc:ZDB-GENE-041014-322])

HSP 1 Score: 66.2402 bits (160), Expect = 6.439e-10
Identity = 42/136 (30.88%), Postives = 66/136 (48.53%), Query Frame = 2
Query: 2399 CRQRYSCSHSCDPGNG-HRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECI----------CDGEICKDCNEKCLTNYFKKNSCAQSKHLQCSKCTSECSPGYYI-SRKCTETSNIQCTACR 2770
            C +   CSH+C    G + C+C RG  + +DG+TC DI+EC+   ++C   G  C N +GSY C+           DG  C D NE   +N   ++        +C+     C PGY + +R+C + +  +   CR
Sbjct: 5088 CVEGNPCSHACHNAIGTYYCSCPRGLTISADGRTCQDIDECSLGGHMCHD-GQDCENTIGSYRCVMRCGRGFRRTADGLSCSDVNECQESNPCHQHCLNTIGSFRCA-----CEPGYQLRNRRCIDINECKQRVCR 5217          

HSP 2 Score: 58.9214 bits (141), Expect = 1.194e-7
Identity = 31/66 (46.97%), Postives = 39/66 (59.09%), Query Frame = 2
Query: 2399 CRQRYSCSHSC--DPGNGHRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECI 2590
            C QR +C H C   PG+ HRC C  G+ L ++GKTC DI+EC      CG     C N+ GSY+CI
Sbjct: 5417 CEQRDTCQHECMNTPGS-HRCLCPSGYRLMTNGKTCQDIDECLEQNIQCGA-NRMCFNMRGSYQCI 5480          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Zebrafish
Match: scube2 (signal peptide, CUB domain, EGF-like 2 [Source:NCBI gene;Acc:503728])

HSP 1 Score: 59.6918 bits (143), Expect = 4.848e-8
Identity = 47/136 (34.56%), Postives = 61/136 (44.85%), Query Frame = 2
Query: 2414 SCSHSCD--PGNGHRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECIC-DGEICKDCNEKCLTNYFKKNSCAQSKHLQCSKC--------TSECSPGYYIS---RKCTETSNIQCTACRPLC 2779
             C H C+  PGN +RCTC  GF L  DG  C+D++EC  N   C      CVN +GSYEC C  G    D    C+    +  SC   +H     C          EC PG+ ++   R C  T N     C+ +C
Sbjct:   80 GCVHECNNIPGN-YRCTCLDGFHLAHDGHNCLDVDECVFNNGGCQH---VCVNTMGSYECRCKQGFFLSDNQHTCIHRSVEGLSCMNKEHGCGHICKESPKGGVACECRPGFELAKNQRGCILTCNHGNGGCQHIC 211          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Zebrafish
Match: scube1 (signal peptide, CUB domain, EGF-like 1 [Source:ZFIN;Acc:ZDB-GENE-050302-78])

HSP 1 Score: 57.7658 bits (138), Expect = 1.794e-7
Identity = 47/136 (34.56%), Postives = 59/136 (43.38%), Query Frame = 2
Query: 2414 SCSHSCD--PGNGHRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECIC-DGEICKDCNEKCLTNYFKKNSCAQSKHLQCSKC--------TSECSPGYYIS---RKCTETSNIQCTACRPLC 2779
             C H C   PGN +RCTC  GF L  DG  C+D++EC  N   C +    CVN +GSYEC C DG    D    C+       +C    H     C          EC PG+ ++   R C  T N     C+  C
Sbjct:  125 GCVHDCINIPGN-YRCTCYDGFMLADDGHNCLDVDECLDNNGGCQQ---ICVNTMGSYECQCKDGFFLSDNQHTCIHRSDDGMNCMNKDHGCAHICREITKGGVACECRPGFELAENQRDCKLTCNYGNGGCQHTC 256          

HSP 2 Score: 53.5286 bits (127), Expect = 3.473e-6
Identity = 32/88 (36.36%), Postives = 43/88 (48.86%), Query Frame = 2
Query: 2333 FKRNSIDIYDMKNSLNILNQEVCRQRYSCSHSC-DPGNGHRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECIC 2593
            F   S+   D +    +L +        C  +C D   G RC+C  GF L+ DGKTC DI+EC  N   C  +   C N +GS+EC C
Sbjct:  293 FNTTSVADVDKRVKRRLLMETCAVNNGGCDRTCKDTATGVRCSCPVGFTLQPDGKTCKDIDECLENNGGCDHF---CRNTVGSFECSC 377          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Zebrafish
Match: hmcn2 (hemicentin 2 [Source:ZFIN;Acc:ZDB-GENE-030131-9765])

HSP 1 Score: 57.7658 bits (138), Expect = 2.226e-7
Identity = 39/141 (27.66%), Postives = 62/141 (43.97%), Query Frame = 2
Query: 2387 NQEVCRQRYSCSHSCDPG-NGHRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECICD----------GEICKDCNEKCLTNYFKKNSCAQS--KHLQCSKCTSECSPGY-YISRKCTETSNIQCTAC 2767
            +++ C     CSHSC+    G  C C  GF + ++  +C DI+EC+   ++C      CVN +G+Y C             G  C+D +E C  +    + C Q     L   +CT  C PGY  +  +C + +      C
Sbjct: 3691 DEDECAVDSPCSHSCNNNMGGFSCACPSGFTISTESNSCQDIDECSQGSHLCHP-NQQCVNTVGTYRCQAKCGLGFKPSLVGTSCEDVDE-CQESAV--SPCQQQCFNTLGSFRCT--CHPGYQLVGHRCLDINECLRNVC 3825          

HSP 2 Score: 53.5286 bits (127), Expect = 4.121e-6
Identity = 26/65 (40.00%), Postives = 34/65 (52.31%), Query Frame = 2
Query: 2399 CRQRYSCSHSCDPGNG-HRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECI 2590
            C  R  C H C    G ++CTC  G+ L S+G+TC DI+EC      CG     C N  G Y+C+
Sbjct: 4009 CAFRKPCQHECRNTIGSYQCTCPPGYQLLSNGRTCKDIDECTVQGVQCGP-NQMCFNTRGGYQCL 4072          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Xenopus
Match: ENSXETT00000024069.1 (hemicentin 2 [Source:NCBI gene;Acc:100490941])

HSP 1 Score: 64.3142 bits (155), Expect = 3.563e-9
Identity = 40/131 (30.53%), Postives = 60/131 (45.80%), Query Frame = 2
Query: 2384 LNQEVCRQRYSCSHSCDPGNGH-RCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECI----------CDGEICKDCNEKCLTNYFKKNSCAQSKHLQCSKCTS-------ECSPGYYI 2722
            L+++ C  R  CSH+C    G   C+C  G+ L  DG++C D++EC    + C + G  C+N  GSY C+           +G  C+D +E           CAQS   Q  +C +        C PGY +
Sbjct: 3684 LDEDECDLRNPCSHTCHNTVGSFACSCPVGYTLAPDGRSCRDVDECILGTHHC-EAGQQCINTGGSYHCLLRCGPGFRPNAEGTACEDVDE-----------CAQSSPCQ-QRCLNTIGSYRCACDPGYQL 3801          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Xenopus
Match: SCUBE1 (signal peptide, CUB domain, EGF-like 1 [Source:NCBI gene;Acc:100494412])

HSP 1 Score: 61.6178 bits (148), Expect = 1.845e-8
Identity = 48/136 (35.29%), Postives = 61/136 (44.85%), Query Frame = 2
Query: 2414 SCSHSCD--PGNGHRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECIC-DGEICKDCNEKCLTNYFKKNSCAQSKHLQCSKC--------TSECSPGYYIS---RKCTETSNIQCTACRPLC 2779
             C H C   PGN +RCTC  GF L  DG  C+D++EC  N   C +    CVN +GSYEC C DG    D    C+    +  +C    H     C          EC PG+ ++   R CT T N     C+  C
Sbjct:   60 GCVHECINIPGN-YRCTCYDGFMLAHDGHNCLDVDECLDNNGGCQQ---ICVNTMGSYECQCKDGFFLSDNQHTCIHRSNEGMNCMNKDHGCAHICRETPKVGVACECRPGFELAKNQRDCTLTCNYGNGGCQHTC 191          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Xenopus
Match: SCUBE1 (signal peptide, CUB domain, EGF-like 1 [Source:NCBI gene;Acc:100494412])

HSP 1 Score: 61.6178 bits (148), Expect = 1.925e-8
Identity = 48/136 (35.29%), Postives = 61/136 (44.85%), Query Frame = 2
Query: 2414 SCSHSCD--PGNGHRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECIC-DGEICKDCNEKCLTNYFKKNSCAQSKHLQCSKC--------TSECSPGYYIS---RKCTETSNIQCTACRPLC 2779
             C H C   PGN +RCTC  GF L  DG  C+D++EC  N   C +    CVN +GSYEC C DG    D    C+    +  +C    H     C          EC PG+ ++   R CT T N     C+  C
Sbjct:  141 GCVHECINIPGN-YRCTCYDGFMLAHDGHNCLDVDECLDNNGGCQQ---ICVNTMGSYECQCKDGFFLSDNQHTCIHRSNEGMNCMNKDHGCAHICRETPKVGVACECRPGFELAKNQRDCTLTCNYGNGGCQHTC 272          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Xenopus
Match: SCUBE1 (signal peptide, CUB domain, EGF-like 1 [Source:NCBI gene;Acc:100494412])

HSP 1 Score: 61.2326 bits (147), Expect = 2.158e-8
Identity = 48/136 (35.29%), Postives = 61/136 (44.85%), Query Frame = 2
Query: 2414 SCSHSCD--PGNGHRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECIC-DGEICKDCNEKCLTNYFKKNSCAQSKHLQCSKC--------TSECSPGYYIS---RKCTETSNIQCTACRPLC 2779
             C H C   PGN +RCTC  GF L  DG  C+D++EC  N   C +    CVN +GSYEC C DG    D    C+    +  +C    H     C          EC PG+ ++   R CT T N     C+  C
Sbjct:   92 GCVHECINIPGN-YRCTCYDGFMLAHDGHNCLDVDECLDNNGGCQQ---ICVNTMGSYECQCKDGFFLSDNQHTCIHRSNEGMNCMNKDHGCAHICRETPKVGVACECRPGFELAKNQRDCTLTCNYGNGGCQHTC 223          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Xenopus
Match: SCUBE1 (signal peptide, CUB domain, EGF-like 1 [Source:NCBI gene;Acc:100494412])

HSP 1 Score: 61.2326 bits (147), Expect = 2.579e-8
Identity = 48/136 (35.29%), Postives = 61/136 (44.85%), Query Frame = 2
Query: 2414 SCSHSCD--PGNGHRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECIC-DGEICKDCNEKCLTNYFKKNSCAQSKHLQCSKC--------TSECSPGYYIS---RKCTETSNIQCTACRPLC 2779
             C H C   PGN +RCTC  GF L  DG  C+D++EC  N   C +    CVN +GSYEC C DG    D    C+    +  +C    H     C          EC PG+ ++   R CT T N     C+  C
Sbjct:   65 GCVHECINIPGN-YRCTCYDGFMLAHDGHNCLDVDECLDNNGGCQQ---ICVNTMGSYECQCKDGFFLSDNQHTCIHRSNEGMNCMNKDHGCAHICRETPKVGVACECRPGFELAKNQRDCTLTCNYGNGGCQHTC 196          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Mouse
Match: Hmcn2 (hemicentin 2 [Source:MGI Symbol;Acc:MGI:2677838])

HSP 1 Score: 65.0846 bits (157), Expect = 1.572e-9
Identity = 33/83 (39.76%), Postives = 46/83 (55.42%), Query Frame = 2
Query: 2417 CSHSCDPGNGH-RCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECI----------CDGEICKDCNEKCL 2632
            CSH+C    GH  C+C  GF+L  D + C D++EC  N ++C +    CVN+LGSY C+           DG  C+D +E CL
Sbjct: 4679 CSHTCRNAPGHFSCSCPTGFSLAWDHRNCRDVDECAGNTHLC-QEEQRCVNLLGSYNCLASCRPGFRVTADGSNCEDVDE-CL 4759          

HSP 2 Score: 60.077 bits (144), Expect = 5.689e-8
Identity = 35/105 (33.33%), Postives = 48/105 (45.71%), Query Frame = 2
Query: 2399 CRQRYSCSHSCDPGNG-HRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECICDGEICKDCNEKCLTNYFKKNSCAQSKHLQCSKCTSECSP 2710
            CR R  C H+C    G + C C  G+ L   GK C DINEC  +   CG  G  C N  GS++C+         +  C T Y ++ S   +   +CS+  S   P
Sbjct: 4908 CRVRSLCQHACQNTEGSYYCLCPSGYRLLPSGKNCQDINECEEDGIECGP-GQMCFNTRGSFQCV---------DTPCPTTY-RQGSSPGTCFRRCSQDCSASGP 5001          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Mouse
Match: Hmcn1 (hemicentin 1 [Source:MGI Symbol;Acc:MGI:2685047])

HSP 1 Score: 63.5438 bits (153), Expect = 4.141e-9
Identity = 44/147 (29.93%), Postives = 66/147 (44.90%), Query Frame = 2
Query: 2387 NQEVCRQRYSCSHSCDPGNG-HRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECIC----------DGEICKDCNEKCLTNYFKKNSCAQSK--HLQCSKCTSE----CSPGYYI-SRKCTETSNIQCTACRP 2773
            +++ C     CSH+C    G + C+C +G  + +DG+TC DI+EC    + C + G  C N +GSY C+           DG  C+D NE           C +S   H +C          C  GY +  RKC + +  +   CRP
Sbjct: 5106 DEDECTAGNPCSHTCHNAIGAYYCSCPKGLTIAADGRTCQDIDECALGGHTC-RAGQDCDNTIGSYRCVVHCGTGFRRTSDGLSCQDINE-----------CQESSPCHQRCFNVIGSFHCGCEAGYQLKGRKCIDVNECRQNVCRP 5240          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Mouse
Match: Hmcn1 (hemicentin 1 [Source:MGI Symbol;Acc:MGI:2685047])

HSP 1 Score: 63.5438 bits (153), Expect = 4.396e-9
Identity = 44/147 (29.93%), Postives = 66/147 (44.90%), Query Frame = 2
Query: 2387 NQEVCRQRYSCSHSCDPGNG-HRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECIC----------DGEICKDCNEKCLTNYFKKNSCAQSK--HLQCSKCTSE----CSPGYYI-SRKCTETSNIQCTACRP 2773
            +++ C     CSH+C    G + C+C +G  + +DG+TC DI+EC    + C + G  C N +GSY C+           DG  C+D NE           C +S   H +C          C  GY +  RKC + +  +   CRP
Sbjct: 5106 DEDECTAGNPCSHTCHNAIGAYYCSCPKGLTIAADGRTCQDIDECALGGHTC-RAGQDCDNTIGSYRCVVHCGTGFRRTSDGLSCQDINE-----------CQESSPCHQRCFNVIGSFHCGCEAGYQLKGRKCIDVNECRQNVCRP 5240          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Mouse
Match: Nid2 (nidogen 2 [Source:MGI Symbol;Acc:MGI:1298229])

HSP 1 Score: 60.4622 bits (145), Expect = 3.323e-8
Identity = 37/107 (34.58%), Postives = 50/107 (46.73%), Query Frame = 2
Query: 2411 YSCSHSCD------PGNG--HRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECIC-DGEICKDCNEKCLTNYFKKNSCAQSKHLQCSKCTSEC 2704
            Y  SH+CD      PG G  + C C  GF  + DG++C+D+NEC T  + CG     CVN++GSY C C  G    D    C+      N C    H    +  + C
Sbjct:  787 YDGSHTCDTTARCHPGTGVDYTCECTPGF--QGDGRSCVDVNECATGFHRCGP-NSVCVNLVGSYRCECRSGYEFADDQHTCILIAPPPNPCLDGSHTCAPEGQARC 890          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Mouse
Match: Nid2 (nidogen 2 [Source:MGI Symbol;Acc:MGI:1298229])

HSP 1 Score: 59.3066 bits (142), Expect = 6.629e-8
Identity = 37/107 (34.58%), Postives = 50/107 (46.73%), Query Frame = 2
Query: 2411 YSCSHSCD------PGNG--HRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECIC-DGEICKDCNEKCLTNYFKKNSCAQSKHLQCSKCTSEC 2704
            Y  SH+CD      PG G  + C C  GF  + DG++C+D+NEC T  + CG     CVN++GSY C C  G    D    C+      N C    H    +  + C
Sbjct:  522 YDGSHTCDTTARCHPGTGVDYTCECTPGF--QGDGRSCVDVNECATGFHRCGP-NSVCVNLVGSYRCECRSGYEFADDQHTCILIAPPPNPCLDGSHTCAPEGQARC 625          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. UniProt/SwissProt
Match: sp|Q96RW7|HMCN1_HUMAN (Hemicentin-1 OS=Homo sapiens OX=9606 GN=HMCN1 PE=1 SV=2)

HSP 1 Score: 68.1662 bits (165), Expect = 1.491e-9
Identity = 46/147 (31.29%), Postives = 66/147 (44.90%), Query Frame = 2
Query: 2387 NQEVCRQRYSCSHSCDPGNG-HRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECIC----------DGEICKDCNEKCLTNYFKKNSCAQSK--HLQCSKCTSE----CSPGYYI-SRKCTETSNIQCTACRP 2773
            +++ C     CSHSC    G + C+C +G  + +DG+TC DI+EC    + C   G  C N +GSY C+           DG  C+D NE           C +S   H +C          C PGY +  RKC + +  +   CRP
Sbjct: 5107 DEDECAAGNPCSHSCHNAMGTYYCSCPKGLTIAADGRTCQDIDECALGRHTC-HAGQDCDNTIGSYRCVVRCGSGFRRTSDGLSCQDINE-----------CQESSPCHQRCFNAIGSFHCGCEPGYQLKGRKCMDVNECRQNVCRP 5241          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. UniProt/SwissProt
Match: sp|Q8NDA2|HMCN2_HUMAN (Hemicentin-2 OS=Homo sapiens OX=9606 GN=HMCN2 PE=2 SV=3)

HSP 1 Score: 65.855 bits (159), Expect = 6.374e-9
Identity = 34/82 (41.46%), Postives = 46/82 (56.10%), Query Frame = 2
Query: 2417 CSHSCDPGNGH-RCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYEC---------ICDGEICKDCNEKCL 2632
            CSH+C    G   CTC  GFAL  D + C D++EC  + ++C + G  CVN+LGSY C         + DG  C+D +E CL
Sbjct: 4639 CSHACLNAPGRFSCTCPTGFALAWDDRNCRDVDECAWDAHLC-REGQRCVNLLGSYRCLPDCGPGFRVADGAGCEDVDE-CL 4718          

HSP 2 Score: 60.077 bits (144), Expect = 3.720e-7
Identity = 28/65 (43.08%), Postives = 34/65 (52.31%), Query Frame = 2
Query: 2399 CRQRYSCSHSCDPGNG-HRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECI 2590
            CR R  C H+C    G ++C C  G+ L   GK C DINEC      CG  G  C N  GSY+C+
Sbjct: 4867 CRVRNLCQHACRNTEGSYQCLCPAGYRLLPSGKNCQDINECEEESIECGP-GQMCFNTRGSYQCV 4930          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. UniProt/SwissProt
Match: sp|A2AJ76|HMCN2_MOUSE (Hemicentin-2 OS=Mus musculus OX=10090 GN=Hmcn2 PE=1 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 1.100e-8
Identity = 33/83 (39.76%), Postives = 46/83 (55.42%), Query Frame = 2
Query: 2417 CSHSCDPGNGH-RCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECI----------CDGEICKDCNEKCL 2632
            CSH+C    GH  C+C  GF+L  D + C D++EC  N ++C +    CVN+LGSY C+           DG  C+D +E CL
Sbjct: 4679 CSHTCRNAPGHFSCSCPTGFSLAWDHRNCRDVDECAGNTHLC-QEEQRCVNLLGSYNCLASCRPGFRVTADGSNCEDVDE-CL 4759          

HSP 2 Score: 60.077 bits (144), Expect = 3.979e-7
Identity = 35/105 (33.33%), Postives = 48/105 (45.71%), Query Frame = 2
Query: 2399 CRQRYSCSHSCDPGNG-HRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECICDGEICKDCNEKCLTNYFKKNSCAQSKHLQCSKCTSECSP 2710
            CR R  C H+C    G + C C  G+ L   GK C DINEC  +   CG  G  C N  GS++C+         +  C T Y ++ S   +   +CS+  S   P
Sbjct: 4908 CRVRSLCQHACQNTEGSYYCLCPSGYRLLPSGKNCQDINECEEDGIECGP-GQMCFNTRGSFQCV---------DTPCPTTY-RQGSSPGTCFRRCSQDCSASGP 5001          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. UniProt/SwissProt
Match: sp|D3YXG0|HMCN1_MOUSE (Hemicentin-1 OS=Mus musculus OX=10090 GN=Hmcn1 PE=1 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 3.075e-8
Identity = 44/147 (29.93%), Postives = 66/147 (44.90%), Query Frame = 2
Query: 2387 NQEVCRQRYSCSHSCDPGNG-HRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECIC----------DGEICKDCNEKCLTNYFKKNSCAQSK--HLQCSKCTSE----CSPGYYI-SRKCTETSNIQCTACRP 2773
            +++ C     CSH+C    G + C+C +G  + +DG+TC DI+EC    + C + G  C N +GSY C+           DG  C+D NE           C +S   H +C          C  GY +  RKC + +  +   CRP
Sbjct: 5106 DEDECTAGNPCSHTCHNAIGAYYCSCPKGLTIAADGRTCQDIDECALGGHTC-RAGQDCDNTIGSYRCVVHCGTGFRRTSDGLSCQDINE-----------CQESSPCHQRCFNVIGSFHCGCEAGYQLKGRKCIDVNECRQNVCRP 5240          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. UniProt/SwissProt
Match: sp|B5DFC9|NID2_RAT (Nidogen-2 OS=Rattus norvegicus OX=10116 GN=Nid2 PE=2 SV=1)

HSP 1 Score: 60.8474 bits (146), Expect = 1.686e-7
Identity = 53/183 (28.96%), Postives = 80/183 (43.72%), Query Frame = 2
Query: 2186 QIYQFIDLKLTVFIPSHL-VDKNKSFKQNKIKSFQLYNNLSSNTMVKLGVFKRNSIDIYDMKNSLNILNQEVCRQRYSCSHSCD------PGNG--HRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECIC-DGEICKDCNEKCLTNYFKKNSCAQSKHLQCSKCTSEC 2704
            +I Q I  K     P HL V   +    ++  +F LY+      +++  V   N I   ++ ++   +N   C   Y  SH+CD      PG G  + C C  GF  + DG++C+D+NEC T  + CG     CVN++GSY C C  G    D    C+      N C    H    +  + C
Sbjct:  715 RIDQNITYKACSHAPRHLAVPATQQLTVDR--AFALYSE--EEGVLRFAV--TNQIGPVEVDSAPTAVNP--C---YDGSHTCDTTARCHPGTGVDYTCECTPGF--QGDGRSCVDVNECATGFHRCGP-NSVCVNLVGSYRCECRSGYEFADDRHTCVLIAPPPNPCLDGSHTCAPEGQARC 883          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. TrEMBL
Match: A0A074Z1E7 (Uncharacterized protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=T265_15584 PE=4 SV=1)

HSP 1 Score: 1026.16 bits (2652), Expect = 0.000e+0
Identity = 656/1972 (33.27%), Postives = 978/1972 (49.59%), Query Frame = 2
Query: 1931 ASTSPRSALKGS-RHGPRVSK--QFTTLGLLSFFTGMLICSVSGTNSRLSSSDITIINANYVIDDSAIPNITNNAIHQFSLDGNQFIQQIYQF---IDLKLTVFIPSHLV---DKNK----SFKQNKIK--------SFQLYNNLSSNTMVKLGV-FKRNSIDIYDMKNSLNILNQEVCRQRYSCSHSCDPGNGHRCTCQRGFA---------------------LE-SDGKTCMDINECNTN--LNICGKYGGTCVNILGSYECIC-DGEICKDCNEKCLTNYFKKNSCAQSKHLQCSKCTSECSPGYYISRKCTETSNIQCTACRPLCITGEFELSPCSGTSNRICKSRLSISGIELPDKKNVWYEDRRNLRDIHHIISLDEAAKLSQDKELILERESGYQIRLKFDSEITLQPLFEPVDHSVYNDNALF------------------------KINP-------SNYTLKYLCPYPMPPIYDLKMQMHYNVTTEVVNDRDLPGYRPLLQACSTYIQHGEFPETDKDIYRDS--------PDNSWQS-NYKSWTPSTVSCLDAGKLPSIFGDTLNEQLAIREGIYVEEKHYCSKIKSDCQRCLVDCAHNMINNLLTCKPTDSPADNGRSPRLELCFDCCAKENCSSVCDKYAQQRCAMHLCMSGPRMDLQLSPEWPKHDNFICHMKPSSLKPIFSLRWYLYKDNKKLTLDEFTEKMHFTEKPMGDQM---------------------SHKIKQVFKDLIHVTYSSNIHTLPNIISGTNDLQNAYIWNTERLPLTPGSA-----------------------SVKPGE--KLSSIKVWPYLPMGVNSGYWSQLAKYDCNKASEIVDRLNVYTSEIPPYRQLQDLKVERISQYKYRLSNHRLASSLNFTIPARASLLSAIFTPTWVDREQFLSASL--------------VYLGSDATQ--TENAFNG--------YWIVELIGQVNNFPGFFRLQLW---SHDSKLLNVQNPLT----------------------DSYKISRDDSF--------PLLDYDIGVYDEKNFKIHLRILAPESQPXXXXXXXXXXXXXXGELEIMVHRSRQDPQMMIQIEKYRRTPDGKYSEEIS-ILPEVMA--------VSREKSL-------------------KETSPFGIPPLVIYTVXXXXXXXXXXXXXXXXTRKEEHLC------------------------------EDIVFKSRHLVVFVIYLTLKAFYCFXXXXXXXXXXXXXYTREPYNQLTN---------HNSEYTNSTVAEKLLMDKMDTYLERELSRQLAHVTQIKTLCDKRLMDYYQKMNQRLELVSAQAAKRRSRVLISQAVVERAQYELRNMVNQLTRNLEDFNRTAKIYMKRIQHDMKMTKKKLSESEWLEGARLIYQEVLRKRNEGTISKDDPTKSFLAWLKITGE----------LPESPPQLT-LPSSFPFPDWAELNIPVPEPRLGSGL-----DAEYGPEYKPFNIKEKDIELEHSIWSFYDLPDESSSKNNPGYKSDHESKYQSNPTVFKDANNEEKGMIYTETIESIYRILIQLSWCHXXXXXXXXXXXWFLHRAAHTIDTIEQIFYGYPCFIDCTIKGTRRKKRNENNFKFMLKRTFCEAMESSFVPKFCGSAFSLFIIYLLSTHLNELISEEALDFVGYYDNMALPTHLRNRFINTQIVQSAQQLNDYELGSYELFIHQRQSEIQDILNSWVDWTTQLEQYQCELLRLYK------------------------------------------------TDDSGKLIADILNKPDKVPIPTHCKMTTEERQKEIEKLIEFKMSVCPVSMIIPRLFTEYNETEVSLQIVKSSRHWLRWTRRWMDTVIHCLFGYISAIILWNTVGATIWFYVKRFSVIRQKRIYETDVQSIPLSTTESEMKSSAL 6883
              T+PRSALK + R GP+VSK  +FTTL +L+F   +++ ++              +    V  D  I     N I  FS  G   +    +      +++T+++P  ++   D N+    S  + +IK        S QL+ N SS T V L    +R  + IYD  N+  IL   +CRQRY+C HSCDPG  H C CQRG+                      LE + G+ C+D++EC +    + C + GG C N  G Y C+C  G  C DC+  C   ++    C +++ ++C +C+  C  G Y +R C   S+  C ACRPLCI+ EFE +PC G+SNRICK +  I  + +P KKNVW+E+ +++RD    ++ D+ ++L  +K ++L+R SGYQ+RL FDS + L P+  PVDHS  NDN+LF                        + +P       +N TL  LCP+P+PP+Y L ++ H NVTT  V D  LPG+RP+L  C TY +HG FP  +   +  +        P N  +S +  + T   V+CL+  +LP+IFG   N +LA    IY EEK  C ++K+DCQ+CL  CA  + +N LTCKPT +PADNGRSPRLE+CFDCCA++NCS VCDKY+  RC M LC  G R+D  L+PEWPK   F+CH++P+S +PI+ L W L    + LT D F+  +       GD +                       +I Q ++ L++V Y+S +  LP++I GT+ +Q+AY W+ + +PL  GSA                       +V+ G   +L+SI+VWP  P+ V++  W +L+   C  A  ++++LNVYT  +PPY  + + KVE +  Y Y +S+ +    L   IP  ASLL A+F+P  V+R Q+L ASL              V +  D+++  +++ F+         YW+++L GQV+ FPG FRL+++   S D  +    N L+                      D Y    D+          PLLDYDIGV++E+ F++ + I  PE +PDY+KSF + + D K  L+I V R+ Q P  M     Y R PD      ++ +LP + A         S E  L                    E  PFG PP V + V+  L + LL LFIG +T+ +  L                                 IV +   +++ + YL LK+ Y F VT T L+IVI   TR+P NQLTN          N     S   +KLL + MD +L  EL RQ     +++  CD+ L   + +M +RL   S  AA RRSRVL+SQ V E A+        QL   L  FN++ +    R++ D++ T++ L  S+WL GAR+IY EV++ R       +DPT+SFL W K+ G            P   PQL   P   P     +  IP P PR  SGL     + EYGP Y PF +   + E   + WS  +   + S  +   +    ++++Q       D            +      + ++L W H+L   LLLD LW +HR  HT+DT E++ YG   FID T++G RR+   ++  +   KR F  AM+   V K CGS  +L  +   + HL+ L+S+E LD++GYYDN+ LP HL  R +N  I +SAQ+LN YE+   E  + +R  E Q +L+ W  W +++EQ QC +L  YK                                                 +D G  I       D   +P HC+MT  ER+ E+ +        CP++ I+P LF +YN ++   ++VK S  WL   R ++  + +CLF YISA+ILWN  G+ +WFY+ R +++ +K ++E+D+ S   + + SE  +  +
Sbjct:  779 GGTNPRSALKSADRSGPKVSKHLRFTTLTMLTFLWLLVVVALGSPE----------LGDQIVGHDRPI---RWNIIKPFSPTGADILSSTSKSNISPTVRVTIWLPRDMIPKMDGNRPRQFSSDKQEIKKGTRRSPDSIQLWLNASSGTEVWLSPRVERGVVHIYDATNAHQILGTRICRQRYACEHSCDPGARHDCICQRGYRPAGPKDRDRLLLHGNRLGNIDLENAKGRICLDVDECASAQLRSSCTRLGGVCTNRPGDYTCLCPSGYPCLDCDTTCPKGFWAHGDCGRNQSIECKRCSGPCPTGMYEARPCGPRSDRVCQACRPLCISEEFEFTPCKGSSNRICKRKSIIPELIVPYKKNVWFENLQHVRDTSLTLTPDDISRLPLNKSIVLDRASGYQVRLDFDS-LNLLPVLGPVDHSSGNDNSLFLASARVLDHSSTETDSYRWSSATGQYHPMQAYTLKANNTLSKLCPFPVPPLYRLGIRAHRNVTTSTVPDASLPGHRPVLSGCRTYRRHGYFPPVEVSPFHAAESAQSFGGPGNPTKSGDLSAATIPVVACLEPSRLPAIFGSHWNTELATPRSIYFEEKQLCGQLKADCQQCLAACAEELKSNSLTCKPTSNPADNGRSPRLEICFDCCARDNCSDVCDKYSAHRCHMQLCSYGLRLDFPLTPEWPKQGEFLCHVQPASSRPIYRLYWSLLYQGRPLTPDRFSAALVLPTSTKGDHLEDTDVSRRPVQQGSESWIFGHGGQISQTYRGLLNVQYASGLEHLPDMIGGTDTMQSAYFWSRQTIPLVSGSATNAAFDPISASASAATTGAMYANAVQSGSPTELASIQVWPSRPLLVSTAAWERLSGAPCAAADPLLEQLNVYTPALPPYIAMGEAKVEYVGNYLYTVSHTKAKPKLMIGIPKTASLLGAVFSPASVERGQYLRASLALAWFGPTDTNGDAVVIPPDSSKRPSDDVFSSSATDTRRRYWVIDLTGQVDQFPGLFRLRVYTDHSEDKDVGTNGNALSKAPSRRPHTVMTADATVETEDGDPYPTDLDNVVTSDEPSEEPLLDYDIGVFEERKFQLRILIPGPEHEPDYEKSFRLTVTDAKNRLDIRVKRTVQLPHEMALRRSYERLPDDDVRPVLADLLPSLAARQQTFWQQASAEPQLGTKGPKNSPIQPEQQTTTESELRPFGPPPSVFFAVICCLLLLLLCLFIGIITQPDPTLAWIKFPSEAKTKRMPTDDGEQIAMVRHPARYNSIVSRWCRVLLLIGYLCLKSAYTFGVTLTALVIVIRYVTRDPANQLTNLPEWTMGVQPNDLMDTSLTRQKLLQEAMDVHLRAELVRQQTLAKEMREACDRGLEVMFDQMEERLSAASKLAATRRSRVLLSQGVAELARVTAVASTLQLAEGLMAFNQSVEWAFHRLKSDLQETERALGNSDWLTGARIIYAEVVQLRGLHP-DPNDPTRSFLQWAKLLGPGGSGSLVDLLSPGQSPQLQHPPPILPLIQPDQFQIPTPSPR-SSGLTQGGDEPEYGPSYTPFILHPIEAEANEAYWSSLNTEADPSGLDTGDFLDSLDTEHQDA----TDGTEIPVEPSSQSSSNYSKWLDLKLGWVHVLGAALLLDALWLIHRVLHTVDTAERLLYGDTVFIDLTVEGLRRRLLQKSRLRIGCKRAFEAAMQPGTVRKLCGSVLALLAVSQGAAHLDRLLSQETLDYIGYYDNLILPVHLHARLVNVHITRSAQRLNQYEVAGIESEMSRRLREAQFLLHQWTAWLSEIEQEQCRVLLAYKAAAQQVRNRMATKLNRNPALNKLQLPVHMIHSGPSQAHAQPSDWSNLRANDGGTAIHQSKGTADAF-VPKHCRMTQSEREIELAETRRLDCPKCPLNAIVPHLFKDYNASQYFDEVVKQSEAWLSAARDYLSRIFYCLFVYISALILWNMAGSLVWFYLNRLNILPKKVLFESDISSWYAAHSPSEANAGGI 2729          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. TrEMBL
Match: A0A4S2LLF9 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008026 PE=4 SV=1)

HSP 1 Score: 1023.85 bits (2646), Expect = 0.000e+0
Identity = 660/1971 (33.49%), Postives = 982/1971 (49.82%), Query Frame = 2
Query: 1931 ASTSPRSALKGS-RHGPRVSK--QFTTLGLLSFFTGMLICSVSGTNSRLSSSDITIINANYVIDDSAIPNITNNAIHQFSLDGNQFIQQIYQF---IDLKLTVFIPSHLV---DKNK----SFKQNKIK--------SFQLYNNLSSNTMVKLGV-FKRNSIDIYDMKNSLNILNQEVCRQRYSCSHSCDPGNGHRCTCQRGFA---------------------LE-SDGKTCMDINECNTN--LNICGKYGGTCVNILGSYECIC-DGEICKDCNEKCLTNYFKKNSCAQSKHLQCSKCTSECSPGYYISRKCTETSNIQCTACRPLCITGEFELSPCSGTSNRICKSRLSISGIELPDKKNVWYEDRRNLRDIHHIISLDEAAKLSQDKELILERESGYQIRLKFDSEITLQPLFEPVDHSVYNDNALF------------------------KINP-------SNYTLKYLCPYPMPPIYDLKMQMHYNVTTEVVNDRDLPGYRPLLQACSTYIQHGEFPETDKDIYRDS--------PDNSWQS-NYKSWTPSTVSCLDAGKLPSIFGDTLNEQLAIREGIYVEEKHYCSKIKSDCQRCLVDCAHNMINNLLTCKPTDSPADNGRSPRLELCFDCCAKENCSSVCDKYAQQRCAMHLCMSGPRMDLQLSPEWPKHDNFICHMKPSSLKPIFSLRWYLYKDNKKLTLDEFTEKMHFTEKPMGDQM---------------------SHKIKQVFKDLIHVTYSSNIHTLPNIISGTNDLQNAYIWNTERLPLTPGSA-----------------------SVKPGE--KLSSIKVWPYLPMGVNSGYWSQLAKYDCNKASEIVDRLNVYTSEIPPYRQLQDLKVERISQYKYRLSNHRLASSLNFTIPARASLLSAIFTPTWVDREQFLSASL--------------VYLGSDATQ--TENAFNG--------YWIVELIGQVNNFPGFFRLQLW---SHDSKLLNVQNPLT----------------------DSYKISRDDSF--------PLLDYDIGVYDEKNFKIHLRILAPESQPXXXXXXXXXXXXXXGELEIMVHRSRQDPQMMIQIEKYRRTPDGKYSEE-ISILPEVMA----------------------------VSREKSLKETSPFGIPPLVIYTVXXXXXXXXXXXXXXXXTRKEEHLC------EDI-----------VFKSRH-------------LVVFVIYLTLKAFYCFXXXXXXXXXXXXXYTREPYNQLT---------NHNSEYTNSTVAEKLLMDKMDTYLERELSRQLAHVTQIKTLCDKRLMDYYQKMNQRLELVSAQAAKRRSRVLISQAVVERAQYELRNMVNQLTRNLEDFNRTAKIYMKRIQHDMKMTKKKLSESEWLEGARLIYQEVLRKRNEGTISKDDPTKSFLAWLKITGE----------LPESPPQLT-LPSSFPFPDWAELNIPVPEPRLGSGL-----DAEYGPEYKPFNIKEKDIELEHSIWSFYDLPDESSSKNNPGYKSDHESKYQSNPTVFKDANNEEKGMIYTETIESIYRILIQLSWCHXXXXXXXXXXXWFLHRAAHTIDTIEQIFYGYPCFIDCTIKGTRRKKRNENNFKFMLKRTFCEAMESSFVPKFCGSAFSLFIIYLLSTHLNELISEEALDFVGYYDNMALPTHLRNRFINTQIVQSAQQLNDYELGSYELFIHQRQSEIQDILNSWVDWTTQLEQYQCELLRLYKTDD-------SGKLIAD-ILNK-----------PDKVP----------------------------IPTHCKMTTEERQKEIEKLIEFKMSVCPVSMIIPRLFTEYNETEVSLQIVKSSRHWLRWTRRWMDTVIHCLFGYISAIILWNTVGATIWFYVKRFSVIRQKRIYETDVQSIPLSTTESEMKSSA 6880
              T+PRSALK + R GP+VSK  +FTTL +L+F   +++ ++              +    V  D  I     N I  FS      +    +      +++T+++P  ++   D N+    S  + +IK        S QL+ N SS T V L    +R  + IYD  N+  IL   +CRQRY+C HSCDPG  H C CQRG+                      LE + G+ C+D++EC +    + C + GG C N  G Y C+C  G  C DC+  C   ++    C +++ ++C +C+  C  G Y +R C   S+  C ACRPLCI+ EFE +PC G+SNRICK +  I  + +P KKNVW+E+ +++RD    ++ D+ ++L  +K ++L+R SGYQ+RL FDS + L P+  PVDHS  NDN+LF                        + +P       +N TL  LCP+P+PP+Y L ++ H NVTT  V D  LPG+RP+L  C TY +HG FP  +   +  +        P N  +S +  + T   V+CL+  +LP+IFG   N +LA    IY EEK  C ++K+DCQ CL  CA  + +N LTCKPT +PADNGRSPRLE+CFDCCA++NCS VCDKY+  RC M LC  G R+D  L+PEWPK   F+CH++P+S +PI+ L W L    + LT D F+  +       GD +                       +I Q ++ L++V Y S +  LP++I GT+ +Q+AY W+ + +PL  GSA                       +V+ G   +L+SI+VWP  P+ V++  W +L+   C  A  ++++LNVYT  +PPY  + + KVE +  Y Y +S+ +    L  ++P  ASLL A+F+P  V+R Q+L ASL              V +  D+++  + + F+         YW+++L GQV+ FPG FRL+++   S D       NPL+                      D Y    D+          PLLDYD+GV++E+ F++ + I  PE +PDY+KSF + I D K  L+I V R+ Q P  M     Y R PD       + +LP + A                              ++ S  E  PFG PP V + V+  L + LL LFIG +T+ +  L       ED            V   RH             +++ V YL LK+ Y F VT T L+IVI   TR+P +QLT           N     S   +KLL + MD +L  EL RQ     +++  CD+ L   + +M +RL   S  AA RRSRVL+SQ V E A+        QL   L  FN++ +    R++ D++ T++ L  S+WL GAR+IY EV++ R       +DPT+SFL W K+ G            P   PQL   P   P     +  IP P PR  SGL     + EYGP Y PF +   + E   + WS      + S  +  G+  + ++++Q       D            +      + ++L W H+L   LLLD LW +HR  HT+DT E++ YG   F+D T++G RR+   ++  +   KR F  AM+   V K CGS  +L  +   + HL+ L+S+E LD++GYYDN+ LP HL  R +N  I +SAQ+LN YE+   E  + +R  E Q +L+ W  W +++EQ QC +L  YK          + KLI +  LNK           P +V                             +P HC+MT  ER+ E+ +        CP++ I+P LF +YN ++   ++VK S  WL   R ++  + +CLF YISA+ILWN  G+ +WFY+ R +++ +K ++E+D+ S   + + SE  + A
Sbjct:  841 GGTNPRSALKSADRSGPKVSKHLRFTTLTMLTFLWLLVVVALGSPE----------LGDQIVGHDRPI---RWNVIKPFSPASADILSSTSKSNVSPTVRVTIWLPRDMIPKMDGNRPRQFSSDKQEIKKGTRRSPDSIQLWLNASSRTEVWLSPRVERGVVHIYDATNAHQILGTRICRQRYACEHSCDPGARHDCICQRGYRPAGPKDRDRLLLHGNRLGNIDLENAKGRICLDVDECASAQLRSSCTRLGGVCTNRPGDYTCLCPSGNPCLDCDTTCPKGFWAHGDCGRNQSIECKRCSGPCPTGMYEARSCGPRSDRVCQACRPLCISEEFEFTPCKGSSNRICKRKSIIPELIVPYKKNVWFENLQHVRDTSLTLTPDDISRLPLNKSIVLDRASGYQVRLDFDS-LNLLPVLGPVDHSSGNDNSLFLAAARVLDHSSTETDSYRWSSATGQYHPMQAYTLKANNTLSKLCPFPVPPLYRLGIRAHRNVTTSTVPDASLPGHRPVLSGCRTYRRHGYFPPVEVSPFHAAESVQPFGGPGNPTKSGDLSAATVPVVACLEPSRLPAIFGSHWNTELATPRSIYFEEKQLCGQLKADCQHCLAACAEELKSNSLTCKPTSNPADNGRSPRLEICFDCCARDNCSDVCDKYSAHRCHMQLCSYGLRLDFPLTPEWPKQGEFLCHVQPASSRPIYRLYWSLLYQGRPLTPDRFSAALVLPASTKGDHLEDTDVSRRPVQQGSESWIFGHGGQISQTYRGLLNVQYVSGLEHLPDMIGGTDTMQSAYFWSRQTIPLVSGSATNAAFDPISASASAATTGAMYANAVQSGSPTELASIQVWPSRPLLVSTAAWERLSGAPCAAADPLLEQLNVYTPALPPYIAMGEAKVEYVGNYLYTVSHTKAKPKLMISVPKTASLLGAVFSPASVERGQYLRASLALAWFGPMDTNEDAVVVPPDSSKRPSGDGFSSSATDTRRRYWVIDLTGQVDQFPGLFRLRVFADHSEDKDGGTNGNPLSNLPPRRPHTVMTADATVETEDGDPYPTDVDNVVTSDEPGEEPLLDYDVGVFEERKFQLRILIPGPEHEPDYEKSFRLTITDAKNRLDIRVKRTVQLPDEMALRRSYERLPDDDMRPVLVDLLPSLAARQQTFWQQASAEPQSILGTKDPKDSPIQPEQQTSESELQPFGPPPSVFFAVICCLLLLLLCLFIGIVTQPDPTLAWIKFPSEDKTKRVPTDDGEQVAVVRHPARYNSILSRWFRVLLLVGYLCLKSAYTFGVTLTALVIVIRYVTRDPASQLTKLPEWTMGAQSNDLMDTSLTRQKLLQEAMDVHLRAELVRQQTLAKEMREACDRGLEVMFDQMEERLSAASKLAATRRSRVLLSQGVAELARVTAVASTLQLAEGLMAFNQSVEWAFHRLKSDLQETERALGNSDWLTGARIIYAEVVQLRGLHP-DPNDPTRSFLQWAKLLGPGGSGSLVDLLSPGQSPQLQHPPPILPLIQPDQFQIPTPSPR-SSGLTQDGDEPEYGPSYTPFILHPIEAEANEAYWSTLHAETDPSGLDAGGFLDNLDTEHQDT----TDGTGMSIEPSSQSSSNYSRWLDLKLGWVHVLGAALLLDALWLIHRVLHTVDTAERLLYGDTVFVDLTVEGLRRRLLQKSRLRIGCKRAFEAAMQPGTVRKLCGSVLALLAVSQGAAHLDRLLSQETLDYIGYYDNLILPVHLHARLVNVHITRSAQRLNQYEVAGIESEMSRRLREAQFLLHQWTAWLSEIEQEQCRVLLAYKAAAQQVRNRMATKLIRNPALNKLQLPVHMIHSGPSQVNAQPSDWSNLRGNDGGTASHQSKGTADAFVPKHCRMTPSEREIELAEARRLDCPKCPLNAIVPHLFKDYNASQYFDEVVKQSEAWLSAARDYLSRIFYCLFVYISALILWNMAGSVVWFYLNRLNILPKKVLFESDISSWYAAHSPSEGNAGA 2791          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. TrEMBL
Match: A0A1S8X1B7 (Calcium binding EGF domain protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_03652 PE=4 SV=1)

HSP 1 Score: 998.808 bits (2581), Expect = 0.000e+0
Identity = 657/2030 (32.36%), Postives = 979/2030 (48.23%), Query Frame = 2
Query: 1931 ASTSPRSALKGS-RHGPRVSK--QFTTLGLLSFFTGMLICSVSGTNSRLSSSDITIINANYVIDDSAIPNITNNAIHQFSLDGNQFIQQIYQF---IDLKLTVFIPSHLV---DKNK----SFKQNKIK--------SFQLYNNLSSNTMVKLGV-FKRNSIDIYDMKNSLNILNQEVCRQRYSCSHSCDPGNGHRCTCQRGFA---------------------LE-SDGKTCMDINECNTN--LNICGKYGGTCVNILGSYECIC-DGEICKDCNEKCLTNYFKKNSCAQSKHLQCSKCTSECSPGYYISRKCTETSNIQCTACRPLCITGEFELSPCSGTSNRICKSRLS--------------------------------ISGIELPDKKNVWYEDRRNLRDIHHIISLDEAAKLSQDKELILERESGYQIRLKFDSEITLQPLFEPVDHSVYNDNALF------------------------KINP-------SNYTLKYLCPYPMPPIYDLKMQMHYNVTTEVVNDRDLPGYRPLLQACSTYIQHGEFPETDKDIYRDS--------PDNSWQS-NYKSWTPSTVSCLDAGKLPSIFGDTLNEQLAIREGIYVEEKHYCSKIKSDCQRCLVDCAHNMINNLLTCKPTDSPADNGRSPRLELCFDCCAKENCSSVCDKYAQQRCAMHLC--------------------------MSGPRMDLQLSPEWPKHDNFICHMKPSSLKPIFSLRWYLYKDNKKLTLDEFTEKMHFTEKPMGDQM---------------------SHKIKQVFKDLIHVTYSSNIHTLPNIISGTNDLQNAYIWNTERLPLTPGSA-----------------------SVKPGE--KLSSIKVWPYLPMGVNSGYWSQLAKYDCNKASEIVDRLNVYTSEIPPYRQLQDLKVERISQYKYRLSNHRLASSLNFTIPARASLLSAIFTPTWVDREQFLSASL--------------VYLGSDATQ--TENAFNG--------YWIVELIGQVNNFPGFFRLQLW---SHDSKLLNVQNPLT----------------------DSYKISRDDSF--------PLLDYDIGVYDEKNFKIHLRILAPESQPXXXXXXXXXXXXXXGELEIMVHRSRQDPQMMIQIEKYRRTPDGKYSEEIS-ILPEVMA--------VSREKSL-------------------KETSPFGIPPLVIYTVXXXXXXXXXXXXXXXXTRKEEHLC------------------------------EDIVFKSRHLVVFVIYLTLKAFYCFXXXXXXXXXXXXXYTREPYNQLTN---------HNSEYTNSTVAEKLLMDKMDTYLERELSRQLAHVTQIKTLCDKRLMDYYQKMNQRLELVSAQAAKRRSRVLISQAVVERAQYELRNMVNQLTRNLEDFNRTAKIYMKRIQHDMKMTKKKLSESEWLEGARLIYQEVLRKRNEGTISKDDPTKSFLAWLKITGE----------LPESPPQLT-LPSSFPFPDWAELNIPVPEPRLGSGL-----DAEYGPEYKPFNIKEKDIELEHSIWSFYDLPDESSSKNNPGYKSDHESKYQSNPTVFKDANNEEKGMIYTETIESIYRILIQLSWCHXXXXXXXXXXXWFLHRAAHTIDTIEQIFYGYPCFIDCTIKGTRRKKRNENNFKFMLKRTFCEAMESSFVPKFCGSAFSLFIIYLLSTHLNELISEEALDFVGYYDNMALPTHLRNRFINTQIVQSAQQLNDYELGSYELFIHQRQSEIQDILNSWVDWTTQLEQYQCELLRLYK------------------------------------------------TDDSGKLIADILNKPDKVPIPTHCKMTTEERQKEIEKLIEFKMSVCPVSMIIPRLFTEYNETEVSLQIVKSSRHWLRWTRRWMDTVIHCLFGYISAIILWNTVGATIWFYVKRFSVIRQKRIYETDVQSIPLSTTESEMKSSAL 6883
              T+PRSALK + R GP+VSK  +FTTL +L+F   +++ ++              +    V  D  I     N I  FS  G   +    +      +++T+++P  ++   D N+    S  + +IK        S QL+ N SS T V L    +R  + IYD  N+  IL   +CRQRY+C HSCDPG  H C CQRG+                      LE + G+ C+D++EC +    + C + GG C N  G Y C+C  G  C DC+  C   ++    C +++ ++C +C+  C  G Y +R C   S+  C ACRPLCI+ EFE +PC G+SNRICK + S                                I  + +P KKNVW+E+ +++RD    ++ D+ ++L  +K ++L+R SGYQ+RL FDS + L P+  PVDHS  NDN+LF                        + +P       +N TL  LCP+P+PP+Y L ++ H NVTT  V D  LPG+RP+L  C TY +HG FP  +   +  +        P N  +S +  + T   V+CL+  +LP+IFG   N +LA    IY EEK  C ++K+DCQ+CL  CA  + +N LTCKPT +PADNGRSPRLE+CFDCCA++NCS VCDKY+  RC M LC                            G R+D  L+PEWPK   F+CH++P+S +PI+ L W L    + LT D F+  +       GD +                       +I Q ++ L++V Y+S +  LP++I GT+ +Q+AY W+ + +PL  GSA                       +V+ G   +L+SI+VWP  P+ V++  W +L+   C  A  ++++LNVYT  +PPY  + + KVE +  Y Y +S+ +    L   IP  ASLL A+F+P  V+R Q+L ASL              V +  D+++  +++ F+         YW+++L GQV+ FPG FRL+++   S D  +    N L+                      D Y    D+          PLLDYDIGV++E+ F++ + I  PE +PDY+KSF + + D K  L+I V R+ Q P  M     Y R PD      ++ +LP + A         S E  L                    E  PFG PP V + V+  L + LL LFIG +T+ +  L                                 IV +   +++ + YL LK+ Y F VT T L+IVI   TR+P NQLTN          N     S   +KLL + MD +L  EL RQ     +++  CD+ L   + +M +RL   S  AA RRSRVL+SQ V E A+        QL   L  FN++ +    R++ D++ T++ L  S+WL GAR+IY EV++ R       +DPT+SFL W K+ G            P   PQL   P   P     +  IP P PR  SGL     + EYGP Y PF +   + E   + WS  +   + S  +   +    ++++Q       D            +      + ++L W H+L   LLLD LW +HR  HT+DT E++ YG   FID T++G RR+   ++  +   KR F  AM+   V K CGS  +L  +   + HL+ L+S+E LD++GYYDN+ LP HL  R +N  I +SAQ+LN YE+   E  + +R  E Q +L+ W  W +++EQ QC +L  YK                                                 +D G  I       D   +P HC+MT  ER+ E+ +        CP++ I+P LF +YN ++   ++VK S  WL   R ++  + +CLF YISA+ILWN  G+ +WFY+ R +++ +K ++E+D+ S   + + SE  +  +
Sbjct:  745 GGTNPRSALKSADRSGPKVSKHLRFTTLTMLTFLWLLVVVALGSPE----------LGDQIVGHDRPI---RWNIIKPFSPTGADILSSTSKSNISPTVRVTIWLPRDMIPKMDGNRPRQFSSDKQEIKKGTRRSPDSIQLWLNASSGTEVWLSPRVERGVVHIYDATNAHQILGTRICRQRYACEHSCDPGARHDCICQRGYRPAGPKDRDRLLLHGNRLGNIDLENAKGRICLDVDECASAQLRSSCTRLGGVCTNRPGDYTCLCPSGYPCLDCDTTCPKGFWAHGDCGRNQSIECKRCSGPCPTGMYEARPCGPRSDRVCQACRPLCISEEFEFTPCKGSSNRICKRKSSAGARSHLFIFEYLTVTIHRDLNSSLFVLGKSIIPELIVPYKKNVWFENLQHVRDTSLTLTPDDISRLPLNKSIVLDRASGYQVRLDFDS-LNLLPVLGPVDHSSGNDNSLFLASARVLDHSSTETDSYRWSSATGQYHPMQAYTLKANNTLSKLCPFPVPPLYRLGIRAHRNVTTSTVPDASLPGHRPVLSGCRTYRRHGYFPPVEVSPFHAAESAQSFGGPGNPTKSGDLSAATIPVVACLEPSRLPAIFGSHWNTELATPRSIYFEEKQLCGQLKADCQQCLAACAEELKSNSLTCKPTSNPADNGRSPRLEICFDCCARDNCSDVCDKYSAHRCHMQLCSYGMLLTFPRHNSQLHLSCFLPSHCESQGLRLDFPLTPEWPKQGEFLCHVQPASSRPIYRLYWSLLYQGRPLTPDRFSAALVLPTSTKGDHLEDTDVSRRPVQQGSESWIFGHGGQISQTYRGLLNVQYASGLEHLPDMIGGTDTMQSAYFWSRQTIPLVSGSATNAAFDPISASASAATTGAMYANAVQSGSPTELASIQVWPSRPLLVSTAAWERLSGAPCAAADPLLEQLNVYTPALPPYIAMGEAKVEYVGNYLYTVSHTKAKPKLMIGIPKTASLLGAVFSPASVERGQYLRASLALAWFGPTDTNGDAVVIPPDSSKRPSDDVFSSSATDTRRRYWVIDLTGQVDQFPGLFRLRVYTDHSEDKDVGTNGNALSKAPSRRPHTVMTADATVETEDGDPYPTDLDNVVTSDEPSEEPLLDYDIGVFEERKFQLRILIPGPEHEPDYEKSFRLTVTDAKNRLDIRVKRTVQLPHEMALRRSYERLPDDDVRPVLADLLPSLAARQQTFWQQASAEPQLGTKGPKNSPIQPEQQTTTESELRPFGPPPSVFFAVICCLLLLLLCLFIGIITQPDPTLAWIKFPSEAKTKRMPTDDGEQIAMVRHPARYNSIVSRWCRVLLLIGYLCLKSAYTFGVTLTALVIVIRYVTRDPANQLTNLPEWTMGVQPNDLMDTSLTRQKLLQEAMDVHLRAELVRQQTLAKEMREACDRGLEVMFDQMEERLSAASKLAATRRSRVLLSQGVAELARVTAVASTLQLAEGLMAFNQSVEWAFHRLKSDLQETERALGNSDWLTGARIIYAEVVQLRGLHP-DPNDPTRSFLQWAKLLGPGGSGSLVDLLSPGQSPQLQHPPPILPLIQPDQFQIPTPSPR-SSGLTQGGDEPEYGPSYTPFILHPIEAEANEAYWSSLNTEADPSGLDTGDFLDSLDTEHQDA----TDGTEIPVEPSSQSSSNYSKWLDLKLGWVHVLGAALLLDALWLIHRVLHTVDTAERLLYGDTVFIDLTVEGLRRRLLQKSRLRIGCKRAFEAAMQPGTVRKLCGSVLALLAVSQGAAHLDRLLSQETLDYIGYYDNLILPVHLHARLVNVHITRSAQRLNQYEVAGIESEMSRRLREAQFLLHQWTAWLSEIEQEQCRVLLAYKAAAQQVRNRMATKLNRNPALNKLQLPVHMIHSGPSQAHAQPSDWSNLRANDGGTAIHQSKGTADAF-VPKHCRMTQSEREIELAETRRLDCPKCPLNAIVPHLFKDYNASQYFDEVVKQSEAWLSAARDYLSRIFYCLFVYISALILWNMAGSLVWFYLNRLNILPKKVLFESDISSWYAAHSPSEANAGGI 2753          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. TrEMBL
Match: G7YIX4 (Uncharacterized protein OS=Clonorchis sinensis OX=79923 GN=CLF_109073 PE=4 SV=1)

HSP 1 Score: 993.801 bits (2568), Expect = 0.000e+0
Identity = 632/1872 (33.76%), Postives = 932/1872 (49.79%), Query Frame = 2
Query: 2207 LKLTVFIPSHLVDK-----NKSFKQNK--IK--------SFQLYNNLSSNTMVKLGV-FKRNSIDIYDMKNSLNILNQEVCRQRYSCSHSCDPGNGHRCTCQRGFA---------------------LE-SDGKTCMDINECNTN--LNICGKYGGTCVNILGSYECIC-DGEICKDCNEKCLTNYFKKNSCAQSKHLQCSKCTSECSPGYYISRKCTETSNIQCTACRPLCITGEFELSPCSGTSNRICKSRLSISGIELPDKKNVWYEDRRNLRDIHHIISLDEAAKLSQDKELILERESGYQIRLKFDSEITLQPLFEPVDHSVYNDNALF------------------------KINP-------SNYTLKYLCPYPMPPIYDLKMQMHYNVTTEVVNDRDLPGYRPLLQACSTYIQHGEFPETDKDIYRDS--------PDNSWQS-NYKSWTPSTVSCLDAGKLPSIFGDTLNEQLAIREGIYVEEKHYCSKIKSDCQRCLVDCAHNMINNLLTCKPTDSPADNGRSPRLELCFDCCAKENCSSVCDKYAQQRCAMHLCMSGPRMDLQLSPEWPKHDNFICHMKPSSLKPIFSLRWYLYKDNKKLTLDEFTEKMHFTEKPMGDQM---------------------SHKIKQVFKDLIHVTYSSNIHTLPNIISGTNDLQNAYIWNTERLPLTPGSA-----------------------SVKPGE--KLSSIKVWPYLPMGVNSGYWSQLAKYDCNKASEIVDRLNVYTSEIPPYRQLQDLKVERISQYKYRLSNHRLASSLNFTIPARASLLSAIFTPTWVDREQFLSASLVYLGSDATQT-ENAF-----------------------NGYWIVELIGQVNNFPGFFRLQLWSHDSKLLN-------------------------VQNPLTDSYKISRDDSF--------PLLDYDIGVYDEKNFKIHLRILAPESQPXXXXXXXXXXXXXXGELEIMVHRSRQDPQMMIQIEKYRRTPDGKYSEE-ISILPEVMA--------VSREKSL------------------KETSPFGIPPLVIYTVXXXXXXXXXXXXXXXXTRKEEHLCEDIVFKS------------------RH-------------LVVFVIYLTLKAFYCFXXXXXXXXXXXXXYTREPYNQLTN---------HNSEYTNSTVAEKLLMDKMDTYLERELSRQLAHVTQIKTLCDKRLMDYYQKMNQRLELVSAQAAKRRSRVLISQAVVERAQYELRNMVNQLTRNLEDFNRTAKIYMKRIQHDMKMTKKKLSESEWLEGARLIYQEVLRKRNEGTISKDDPTKSFLAWLKITGE----------LPESPPQLT-LPSSFPFPDWAELNIPVPEPRLGS----GLDAEYGPEYKPFNIKEKDIELEHSIWSFYDLPDESSSKNNPGYKSDHESKYQSNPTVFKDANNEEKGMIYTETIESIYRILIQLSWCHXXXXXXXXXXXWFLHRAAHTIDTIEQIFYGYPCFIDCTIKGTRRKKRNENNFKFMLKRTFCEAMESSFVPKFCGSAFSLFIIYLLSTHLNELISEEALDFVGYYDNMALPTHLRNRFINTQIVQSAQQLNDYELGSYELFIHQRQSEIQDILNSWVDWTTQLEQYQCELLRLYK--TDDSGKLIADILNKP---DKVPIPT------------------------------------------HCKMTTEERQKEIEKLIEFKMSVCPVSMIIPRLFTEYNETEVSLQIVKSSRHWLRWTRRWMDTVIHCLFGYISAIILWNTVGATIWFYVKRFSVIRQKRIYETDVQSIPLSTTESEMKSSAL 6883
            +++T+++P  ++ K      + F  NK  IK        S QL+ N SS T V L    +R  + IYD  N+  IL   +CRQRY+C HSCDPG  H C CQRG+                      LE + G+ C+D++EC +    + C + GG C N  G Y C+C  G+ C DC+  C   ++    C +++ ++C +C+  C  G Y +R C   S+  C ACRPLCI+ EFE +PC G+SNRICK +  I  + +P KKNVW+E+ +++RD    ++ D+ ++L  +K ++L+R SGYQ+RL FDS + L P+  PVDHS  NDN+LF                        + +P       +N TL  LCP+P+PP+Y L ++ H NVTT  V D  LPG+RP+L  C TY +HG FP  +   +  +        P N  +S +  + T   V+CL+  +LP+IFG   N +LA    IY EEK  C ++K+DCQ CL  CA  + +N LTCKPT +PADNGRSPRLE+CFDCCA++NC+ VCDKY+  RC M LC  G R+D  L+PEWPK   F+CH++P+S +PI+ L W L    + LT D F+  +       GD +                       +I Q ++ L++V Y+S +  LP++I GT+ +Q+AY W+ + +PL  GSA                       +V+ G   +L+SI+VWP  P+ V++  W +L+   C  A  ++++LNVYT  +PPY  + + KVE +  Y Y +S+ +    L  +IP  ASLL A+F+P  V+R Q+L A+L       T T E+A                          YW+++L GQV+ FPG FRL++++   +  N                         V+    D Y    D+          PLLDYDIGV++E+ F++ + I  PE +PDY+KSF + I D K  L+I V R+ Q P  M     Y R PD       + +LP + A         S E  L                   E  PFG PP V + V+  L + LL LFIG +T+ +  L   I F S                  RH             +++ V YL LK+ Y F VT T L+IVI   TR+P NQLTN          N     S   +KLL + MD +L  EL RQ     +++  CD+ L   + +M +RL   S  AA RRSRVL+SQ V E A+        QL   L  FN++ +    R++ D++ T++ L  S+WL GAR+IY EV++ R       +DPT+SFL W K+ G            P   PQL   P   P     +  IP P PR       G + EYGP Y PF +   + E   + WS      + S  +   +  + ++++Q       D            +      + ++L W H+L   LLLD LW +HR  HT+DT E++ YG   FID T++G RR+   ++  +   KR F  AM+   V K CGS  +L  +   + HL+ L+S+E LD++GYYDN+ LP HL  R +N  I +SAQ+LN YE+   E  + +R  E Q +L+ W  W + +EQ QC +L  YK         +A  LN+    +K+ +P                                           HC+MT  ER+ E+ +        CP++ I+P LF +YN ++   ++VK S  WL   R ++  V +CLF YISA+ILWN  G+ +WFY+ R +++ +K ++E+D+ S   + + SE  +S +
Sbjct:   57 VRVTIWLPRDMIPKMDGNRPRQFSSNKQEIKKGTRRSPDSIQLWLNASSGTEVWLSPRVERGVVHIYDATNAHQILGTRICRQRYACEHSCDPGARHDCICQRGYRPAGPKDRDRLLLHGNRLGNIDLENAKGRICLDVDECASAQLRSSCTRLGGVCTNRPGDYTCLCPSGDPCLDCDTTCPKGFWAHGDCGRNQSIECKRCSGPCPTGMYEARPCGPRSDRVCQACRPLCISEEFEFTPCKGSSNRICKRKSIIPELIVPYKKNVWFENLQHVRDTSLTLTPDDISRLPLNKSIVLDRASGYQVRLDFDS-LNLLPVLGPVDHSSGNDNSLFLAAARVLDHSSTETDSYRWSSATGQYHPMQAYTLKANNTLSKLCPFPVPPLYRLGIRAHRNVTTSTVPDASLPGHRPVLSGCRTYRRHGYFPPVEVSPFHAAESVQSFGGPGNPTKSGDLSAATVPVVACLEPSRLPAIFGSHWNTELATPRSIYFEEKQLCGQLKADCQHCLAACAEELKSNSLTCKPTSNPADNGRSPRLEICFDCCARDNCTDVCDKYSAHRCHMQLCSYGLRLDFPLTPEWPKQGEFLCHVQPASSRPIYRLYWSLLYQGRPLTPDRFSAALVLPTSTKGDHLEDTDVSRRPVQQGSESWIFGHGGQISQTYRGLLNVQYASGLEHLPDMIGGTDTMQSAYFWSRQTIPLVSGSATNAAFDPISSSASAATTGAMYANAVQSGSPTELASIQVWPSRPLLVSTAAWERLSGAPCAAADPLLEQLNVYTPALPPYIAMGEAKVEYVGNYLYTVSHTKAKPKLMISIPKTASLLGAVFSPASVERGQYLRATLALAWFGPTDTNEDAVVRPPDSSKRPSDDVFSYSASDTRRRYWVIDLTGQVDQFPGLFRLRVFTDHGEDKNGGTSGNPSSNAPSRRPHTIMTADATVETEDGDPYPTDVDNVVTSDEPSEEPLLDYDIGVFEERKFQLRILIPGPEHEPDYEKSFRLTITDAKNRLDIRVKRTVQLPGEMALRRSYERLPDDDMRPVLVDLLPSLAARQQTFWQQASAEPQLGTKDPKNSPIQPEQQTSESELRPFGPPPSVFFAVIFCLLLLLLCLFIGIITQPDPTLAW-IKFPSADKTKRVPTDDGEQIAMVRHPARYNSILSRWCRVLLLVGYLCLKSAYTFGVTLTALVIVIRYVTRDPANQLTNLPEWTVGAQSNDLMDTSLTRQKLLQEAMDVHLRAELVRQQTLAKEMREACDRGLEVMFDQMEERLSAASKLAATRRSRVLLSQGVAELARVTAVASTLQLAEGLMAFNQSVEWAFHRLKSDLQETERALGNSDWLTGARIIYAEVVQLRGLHP-DPNDPTRSFLQWAKLLGPGGSGSLVDLLSPGQSPQLQHPPPILPLIQPDQFQIPTPSPRSSGMTQDGDEPEYGPSYTPFILHPIEAEANEAYWSNLHPETDPSGLDAGDFLDNLDTEHQDA----TDGTGIPIEPSSRSSSNYSRWLDLKLGWVHVLGAALLLDALWLIHRVLHTVDTAERLLYGDTVFIDLTVEGLRRRLLQKSRLRIGCKRAFEAAMQPGTVRKLCGSVLALLAVSQGAAHLDRLLSQETLDYIGYYDNLILPVHLHARLVNVHITRSAQRLNQYEVAGIESEMSRRLREAQFLLHQWTAWLSDIEQEQCRVLLAYKAAAQQVRNRMATKLNRNPALNKLQLPVHMIHSGPSQVNAQSSDWSNLRGNGGGTASHQSKGTADAFVPKHCRMTQSEREIELAETRRLDCPKCPLNAIVPHLFKDYNASQYFDEVVKQSEAWLSAARDYLSRVFYCLFVYISALILWNMAGSVVWFYLNRLNILPKKVLFESDISSWYAAHSPSEANASGI 1921          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. TrEMBL
Match: A0A3Q0KR77 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 644.04 bits (1660), Expect = 0.000e+0
Identity = 395/1222 (32.32%), Postives = 611/1222 (50.00%), Query Frame = 2
Query: 1919 DESGASTSPRSALKGS-RHGPRVSK--QFTTLGLLSFFTGMLIC-----SVSGTNSRLSSSDITI----------------INAN-YVIDDSAIPNIT---------NNAIHQFSL--------DGNQFIQQIYQFIDLKLTVFIPSHLV-------DKNKSFKQNKIK------SFQLYNNLSSNTMVKLG-VFKRNSIDIYDMKNSLNILNQEVCRQRYSCSHSCDPGNGHRCTCQRGF---------------------ALES-DGKTCMDINECN--TNLNICGKYGGTCVNILGSYECIC-DGEICKDCNEKCLTNYFKKNSCAQSKHLQCSKCTSECSPGYYISRKCTETSNIQCTACRPLCITGEFELSPCSGTSNRICKSRLSISGIELPDKKNVWYEDRRNLRDIHHIISLDEAAKLSQDKELILERESGYQIRLKFDSEITLQPLFEPVDHSVYNDNALF----------KINPSNY---------------------TLKYLCPYPMPPIYDLKMQMHYNVTTEVVNDRDLPGYRPLLQACSTYIQHGEFPETDKDIYRDSPDN---SWQSNYKSW------------TPSTVSCLDAGKLPSIFGDTLNEQLAIREGIYVEEKHYCSKIKSDCQRCLVDCAHNMINNLLTCKPTDSPADNGRSPRLELCFDCCAKENCSSVCDKYAQQRCAMHLCMSGPRMDLQLSPEWPKHDNFICHMKPSSLKPIFSLRWYLYKDNKKLTLDEFTEKMHFTEKPMGDQMSHK-----------------------IKQVFKDLIHVTYSSNIHTLPNIISGTNDLQNAYIWNTERLPLTPGSAS------------------------------VKPGEKLSSIKVWPYLPMGVNSGYWSQLAKYDCNKASEIVDRLNVYTSEIPPYRQLQDLKVERISQYKYRLSNHRLASSLNFTIPARASLLSAIFTPTWVDREQFLSASLVY------------LGSDATQTENAFNG---------------YWIVELIGQVNNFPGFFRLQLW------------------------------------------------SHDSKLLNVQNPLTDSYKISRDDSFPLLDYDIGVYDEKNFKIHLRILAPESQPXXXXXXXXXXXXXXGELEIMVHRSRQDPQMMIQIEKYRRTPDGKYSEE-ISILPEVMAVSREKSLKET 4816
            + S  S +PRSALK S + GP+V+K  +FTTL +++    + I      S+   N   S ++ +I                I AN Y    +  P IT         +N   +  L        + N       QF+   +T+++P  ++       D++ ++ +NK +      + QL+ N SS T V++    KR+SI IYD+ ++ +IL   +CRQRY+C HSCDPG GH C CQRG+                     ALE+  G+ C+DI+EC+  +    C + GG C N  G Y C+C  G+ C  C+  C   Y+    C +++ ++C +C++ C PG Y  + CT+ S+  C ACRPLCI+ EFELSPC G+SNRICK +  I  + +P K+N+W+E+R+ +++    +  D+  +L  +K +I++R SGYQ+RL FD  + L P+  PVDHS  NDN LF           + P +Y                     TL  LCPYP+PP+Y L M+++ NVTT  V D  LPG+RP+L +C TY QHG FP  + D ++   ++   S+ S  KS             TP+ V+CL+ G+LPSIFG   N +LA    IY EEK  C ++K DCQ CL  CA  +  + LTCKPT   ADNGRSPRLE CFDCCA++NC+ VCDKY   RC + LC  G R+D  L PEWPK   F+CH+ P+  +PI+ L+W L    + LT D F   +      +  + S K                       I Q ++ L+++ Y+S +  LP++I GT+ +Q+AY W+ + +PL  GS +                                   +++SI+VWP  P+ V++  W++L+   C  +  ++++LN+YT  +PPY  + ++KVE +  Y Y +S+ R+   L+F++P  +SLL A+F P  V+R  +L ASL              + +D+ ++                     +W+++L GQV+ FPG FRL ++                                                S D  + N+   L  + KIS ++  PLLDYD+GV++E+ F++ + I  P  +PDY+KSF + I+D    L+I V R+ Q    M     Y +  DG      + +LP + A  R+++++++
Sbjct:  892 NSSTTSNNPRSALKSSDKTGPKVNKHLRFTTLTIIALLLMLAIVIASPDSIGSLNEAKSKTETSIFFQSNDQPMKMVRYNVIKANIYQSKANTAPTITGFSSLVPESSNKESKTQLKNSLLKTNNNNLESTSTSQFV--HVTIWLPKKMIPTGEPNQDESSNWNKNKKQPNLTPQTIQLWLNQSSGTEVRIAEPIKRSSIHIYDVVDTRHILGTRICRQRYACDHSCDPGAGHACICQRGYRLAGPKDRARLASIGDRIGNMALENVQGRICLDIDECDKPSLRRECARLGGVCTNRPGDYACLCPSGQPCITCDTNCPKGYWMSGVCGRNQSVECKRCSTSCPPGMYEYKPCTQHSDRVCRACRPLCISEEFELSPCKGSSNRICKRKDLIPELVVPYKRNIWFENRKKVQEATVTLHPDDIGRLPLNKSIIIDRGSGYQVRLDFDI-LNLMPVLGPVDHSSSNDNHLFLSAASLLDQSLLEPDSYRWSSATGQYHTVHAYSLKANNTLSKLCPYPVPPLYRLGMRVYRNVTTATVPDASLPGHRPVLASCRTYKQHGYFPPLELDGFQSESEHYTQSFSSESKSIYDQPKTGTNGNPTPAVVACLEPGRLPSIFGSHWNAELASPRSIYYEEKQLCGQLKLDCQHCLASCAEELKASSLTCKPTSGAADNGRSPRLETCFDCCARDNCTDVCDKYPSHRCHVQLCSHGLRLDFSLIPEWPKQGEFLCHVHPAPSRPIYRLQWTLLYQGRPLTPDRFPASLVLPLSSITKENSDKNGVNTNINGWNLAGGLSGTSGSTITQTYRGLLNIQYTSGLEHLPDVIGGTDTMQSAYFWSKQTIPLVSGSGTGITYDPITSHSSPSPSPSDRFYSNTMLYTPSGVSNEIASIQVWPSQPLKVSTSAWTRLSGAPCATSEPLIEQLNIYTPALPPYIAMGEVKVEYLGNYMYAVSHSRIKPKLSFSLPKSSSLLGAVFYPASVERGHYLRASLALAWLTDSEIRHSDILTDSQKSTTKVRNSESSSASTASLKKQRFWVIDLTGQVDQFPGLFRLLVYPDNVEDDSDDGRNYNINVSNSNYLPRNRQNTQSQASSPDAIVEIEDNTSDDIDVDNLNTGLDLNGKISEEE--PLLDYDVGVFEERKFQVRILIPGPTIEPDYEKSFRLVILDASNRLDIRVKRAVQPLDEMALRRTYGQLSDGDGRPTLVDLLPSLAA--RQQAIQDS 2106          

HSP 2 Score: 378.252 bits (970), Expect = 2.106e-101
Identity = 248/716 (34.64%), Postives = 367/716 (51.26%), Query Frame = 2
Query: 4946 SRHLVVFVI--YLTLKAFYCFXXXXXXXXXXXXXYTRE---------PYNQLTNHNSEYTNSTVA-EKLLMDKMDTYLERELSRQLAHVTQIKTLCDKRLMDYYQKMNQRLELVSAQAAKRRSRVLISQAVVERAQYELRNMVNQLTRNLEDFNRTAKIYMKRIQHDMKMTKKKLSESEWLEGARLIYQEVLRKRNEGTISKDDPTKSFLAWLKITGELPE----SPPQLTLPSSFPFPDWAELNIPVP--------EPRLGSGLDAEYGPEYKPFNIKEKDIELEHSIWSFY-------------DLPDESSSKNNPGYKSDHESKYQSNPTVFKDANNEEK--GMIYTETIESIYRIL-IQLSWCHXXXXXXXXXXXWFLHRAAHTIDTIEQIFYGYPCFIDCTIKGTRRKKRNENNFKFMLKRTFCEAMESSFVPKFCGSAFSLFIIYLLSTHLNELISEEALDFVGYYDNMALPTHLRNRFINTQIVQSAQQLNDYELGSYELFIHQRQSEIQDILNSWVDWTTQLEQYQCELLRLYKTDDSG---KLIADI--------LNKP------DKVP----------------------------IPTHCKMTTEERQKEIEKLIEFKMSVCPVSMIIPRLFTEYNETEVSLQIVKSSRHWLRWTRRWMDTVIHCLFGYISAIILWNTVGATIWFYVKRFSVIRQKRIYETDVQS 6838
            SR   VF++  YL LK+ Y F VT T L I+I   T E          +N L + + +   +++  +KLL D MD +L+ EL RQ   V +++ +CD+ +   +++MN+RL+ +S+ +A RRSRVL+SQAV E A+        QL   L  FN TA+  M R+Q D+  T++ L  S+WL GAR+IY EV+R R   T   +DPT+SFLAW K+            PQL+LP + P  +  +  IP P          +L S  + EYGP Y PF  +  D+E     WS Y             DL D+S + +    K+ H ++     T    +N +++  G     T E  +      L+W H+L   L LD LW +HR  HT+DT E+I YG   FID T +G RR+    N  +   K  F   M+ + + K C S  +L I+   S HL+ L+S+E LD++GYYDN+ LP HL  R +N  + +SAQ+LN YEL S E  + +R  E Q +L+ W  W   +EQ QC LL  YK        K++A +        LN P      +K P                            +P HC+MT  ER  E+ +  +  +  CP+  I+P+LF +YN +    ++V  S  WL   R ++   + C+F YISAIILWNT+G+ IW  + R +++ QK ++++DV S
Sbjct: 2219 SRWFRVFLLMGYLCLKSAYTFGVTLTALAIIIRYMTCEYDNKLGNLPEWNSLNDQSGQIMGTSLTRQKLLQDAMDIHLKNELIRQQTEVKRLRNICDRSVEAMFEQMNKRLDSISSLSASRRSRVLLSQAVAELARATATASALQLAEGLISFNETAEWAMNRLQADLVETERALGNSDWLTGARIIYSEVVRLRTL-TPDPNDPTRSFLAWTKLISAETNFNNIKGPQLSLPVNLPSLEPEQFVIPTPTIKRSQATHGKLSSSDEPEYGPVYVPFVSQSIDVETSGEFWSPYHAENSLSDVGGIIDLSDKSRNNDKNSLKTKHSNETTDTATAITSSNGDDRDSGDSSKSTNEENWIFSDFDLNWVHILGAALFLDALWLIHRVLHTVDTAERILYGDVVFIDLTEEGLRRRMTERNKLQKGFKHAFQTIMQPNTIRKLCASVIALLIVTQASAHLDRLLSQEMLDYIGYYDNLVLPVHLHARLVNVHVTRSAQRLNQYELTSLESEVSRRLRETQFLLHQWTLWLNGVEQEQCRLLLAYKAAAQNLRTKMLAQLNRNSALAKLNLPIHMINKEKQPSTSDWNQHSSFKIDDIERHNEYSVADAIVPKHCRMTQSERDIELAEARQIDIPYCPLKPIVPKLFKDYNASLYFTEVVLQSEKWLSTARDYLGRFLFCVFIYISAIILWNTMGSVIWLILNRLNLLPQKVLFKSDVSS 2933          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Cavefish
Match: scube2 (signal peptide, CUB domain, EGF-like 2 [Source:NCBI gene;Acc:503728])

HSP 1 Score: 61.6178 bits (148), Expect = 1.255e-8
Identity = 48/136 (35.29%), Postives = 62/136 (45.59%), Query Frame = 2
Query: 2414 SCSHSCD--PGNGHRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECIC-DGEICKDCNEKCLTNYFKKNSCAQSKHLQCSKC--------TSECSPGYYIS---RKCTETSNIQCTACRPLC 2779
             C H C+  PGN +RCTC  GF L  DG  C+D++EC  N   C      CVN +GSYEC C DG    D    C+    +  SC    H     C        + EC PG+ ++   R CT T       C+ +C
Sbjct:   84 GCVHECNNIPGN-YRCTCHDGFNLAHDGHNCLDVDECLCNNGGCQH---VCVNTMGSYECRCKDGFFLSDNQHTCIHRSVEGLSCMNKDHGCAHICRETPKGGVSCECRPGFELAKNQRGCTLTCIHGNGGCQHIC 215          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Cavefish
Match: scube2 (signal peptide, CUB domain, EGF-like 2 [Source:NCBI gene;Acc:503728])

HSP 1 Score: 60.8474 bits (146), Expect = 1.937e-8
Identity = 48/136 (35.29%), Postives = 62/136 (45.59%), Query Frame = 2
Query: 2414 SCSHSCD--PGNGHRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECIC-DGEICKDCNEKCLTNYFKKNSCAQSKHLQCSKC--------TSECSPGYYIS---RKCTETSNIQCTACRPLC 2779
             C H C+  PGN +RCTC  GF L  DG  C+D++EC  N   C      CVN +GSYEC C DG    D    C+    +  SC    H     C        + EC PG+ ++   R CT T       C+ +C
Sbjct:   84 GCVHECNNIPGN-YRCTCHDGFNLAHDGHNCLDVDECLCNNGGCQH---VCVNTMGSYECRCKDGFFLSDNQHTCIHRSVEGLSCMNKDHGCAHICRETPKGGVSCECRPGFELAKNQRGCTLTCIHGNGGCQHIC 215          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Cavefish
Match: nid2a (nidogen 2a (osteonidogen) [Source:ZFIN;Acc:ZDB-GENE-030827-2])

HSP 1 Score: 60.077 bits (144), Expect = 3.212e-8
Identity = 31/85 (36.47%), Postives = 43/85 (50.59%), Query Frame = 2
Query: 2411 YSCSHSCD------PGNGHRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECIC--------DGEICKDCNE 2623
            YS +H CD      PG G   +CQ       DG++C D++EC   L++CG     CVN+ GS+ C C        DG  C+D +E
Sbjct:  676 YSGNHDCDTTAQCLPGEGSSFSCQCATGYTGDGRSCYDVDECVEGLSVCGSQ-SECVNLPGSHTCRCLSGYEFEQDGRTCRDVDE 759          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Cavefish
Match: scube3 (signal peptide, CUB and EGF-like domain-containing protein 3 [Source:NCBI gene;Acc:103030172])

HSP 1 Score: 59.6918 bits (143), Expect = 4.513e-8
Identity = 46/136 (33.82%), Postives = 62/136 (45.59%), Query Frame = 2
Query: 2414 SCSHSCD--PGNGHRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECIC-DGEICKDCNEKCLTNYFKKNSCAQSKHLQCSKC--------TSECSPGYYIS---RKCTETSNIQCTACRPLC 2779
             C H C   PGN +RCTC  GF L  DG  C+D++EC+     C +    CVN++GSYEC C +G    D    C+    +  SC    H     C          EC PG+ ++   R C  T N     C+ +C
Sbjct:   64 GCVHDCINIPGN-YRCTCYDGFRLAHDGHNCLDVDECSEGNGGCQQ---VCVNMMGSYECRCKEGFFLSDNQHTCIQRPKEGPSCMDKNHGCAHICREAPKGGIACECRPGFQLTKNNRDCKLTCNYGNGGCQHIC 195          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Cavefish
Match: thbd (thrombomodulin [Source:NCBI gene;Acc:103037465])

HSP 1 Score: 58.151 bits (139), Expect = 8.134e-8
Identity = 33/64 (51.56%), Postives = 40/64 (62.50%), Query Frame = 2
Query: 2405 QRYSCSHSC-DPGNGHRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECIC 2593
             +  CSHSC   G  + C C  GFAL+ DGKTC DINEC+  L   GKY   CVN++G +EC C
Sbjct:  258 HKAGCSHSCLSKGKDYACLCGSGFALDVDGKTCKDINECDDRLCP-GKY-FHCVNMIGGFECRC 319          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000328.1 (pep scaffold:Pmarinus_7.0:GL477118:5217:33136:-1 gene:ENSPMAG00000000285.1 transcript:ENSPMAT00000000328.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.7658 bits (138), Expect = 3.277e-8
Identity = 38/88 (43.18%), Postives = 51/88 (57.95%), Query Frame = 2
Query: 2399 CRQRYS--CSHSCD--PGNGHRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECIC---------DGEICKDCNE 2623
            CRQ     CSH+C+  PG+ H C+C RGF L +DGKTC D NEC +  + C +    C N++GSY+C C         DG  C+D +E
Sbjct:  790 CRQYPGRLCSHTCENVPGSYH-CSCSRGFQLGTDGKTCEDTNECES--SPCSQ---ECANVIGSYQCYCRRGFQPSEVDGVTCEDVDE 871          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005512.1 (pep scaffold:Pmarinus_7.0:GL476588:676692:709720:-1 gene:ENSPMAG00000005015.1 transcript:ENSPMAT00000005512.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.9138 bits (128), Expect = 4.959e-8
Identity = 30/62 (48.39%), Postives = 35/62 (56.45%), Query Frame = 2
Query: 2414 SCSHSCD--PGNGHRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECIC 2593
             C H C   PGN +RCTC  GF L  DG  C D++EC  N   C      CVN +GSYEC+C
Sbjct:   82 GCVHECINIPGN-YRCTCYDGFMLAEDGHNCFDVDECEVNNGGCQH---VCVNTMGSYECLC 139          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010139.1 (pep scaffold:Pmarinus_7.0:GL476784:79088:131893:1 gene:ENSPMAG00000009155.1 transcript:ENSPMAT00000010139.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.9878 bits (123), Expect = 1.973e-6
Identity = 49/159 (30.82%), Postives = 71/159 (44.65%), Query Frame = 2
Query: 2195 QFIDLKLTVFIPSHLVDKNKSFKQNKIKSFQLYNNLSSNTMVKL--GVFKRNS--IDIYDMKNSLNILNQEVCRQRYSCSHSCDPGNGHRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECICD--------GEICKDCNEKCLT 2635
            +F D    +       D N+    N   + +  N   S   V+   G   RN   ID+ +  +  N+ +  +C      S+SC P       C  GF L S+GK C DI+EC   + +CG  GG CVN  GS++C C         G+ C+D NE CL+
Sbjct:  812 EFCDAGHVMNTRGQCEDVNECRNPNTCPTAKCVNTPGSYECVRCPSGFEGRNGHCIDVDECADG-NVCSNGICANTEG-SYSCTP-------CGTGFRLTSNGKACEDIDECQNGI-VCG--GGDCVNTRGSFQCECQPGYHLSSGGDQCEDINE-CLS 957          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002704.1 (pep scaffold:Pmarinus_7.0:GL476354:513769:588114:-1 gene:ENSPMAG00000002318.1 transcript:ENSPMAT00000002704.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.2174 bits (121), Expect = 4.160e-6
Identity = 24/48 (50.00%), Postives = 34/48 (70.83%), Query Frame = 2
Query: 2450 RCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECIC 2593
            +C C+ GF L+++GK C DI+EC  + +ICG   GTCVN  GS++C C
Sbjct:  992 KCNCENGFVLDAEGKNCTDIDECKISHDICGM--GTCVNTPGSFDCEC 1037          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Nematostella
Match: EDO28820 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5E3])

HSP 1 Score: 53.9138 bits (128), Expect = 3.267e-7
Identity = 28/53 (52.83%), Postives = 36/53 (67.92%), Query Frame = 2
Query: 2444 GHRCTCQRGFALESDGKT--CMDINECNTNLNICGKYGGTCVNILGSYECICD 2596
            G RC C  G+AL ++GK   C+D+NEC+ N N C + GG CVN  GSY C+CD
Sbjct:  111 GARCECVAGYALNTEGKITRCVDVNECDENPNFC-RPGGRCVNTPGSYRCLCD 162          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Nematostella
Match: EDO26743 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TB74])

HSP 1 Score: 48.521 bits (114), Expect = 1.626e-6
Identity = 34/78 (43.59%), Postives = 41/78 (52.56%), Query Frame = 2
Query: 2417 CSHSCDP-GNGHRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECIC--------DGEICKDCNE 2623
            C HSC+    G++C C  G+AL SDG TC DI+EC TN   C      C N  GSY C+C        D   C+D NE
Sbjct:    4 CQHSCENFDGGYKCACANGYALRSDG-TCTDIDECATNNGNCQH---KCYNTAGSYRCMCHSGYALTADKHACQDVNE 77          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Nematostella
Match: EDO34702 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNM6])

HSP 1 Score: 48.1358 bits (113), Expect = 2.191e-6
Identity = 34/78 (43.59%), Postives = 41/78 (52.56%), Query Frame = 2
Query: 2417 CSHSCDP-GNGHRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECIC--------DGEICKDCNE 2623
            C HSC+    G++C C  G+AL SDG TC DI+EC TN   C      C N  GSY C+C        D   C+D NE
Sbjct:    1 CQHSCENFDGGYKCACANGYALRSDG-TCTDIDECATNNGNCQH---KCYNTAGSYRCMCHSGYALTADKHACQDVNE 74          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Nematostella
Match: EDO25700 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DVQ9])

HSP 1 Score: 45.8246 bits (107), Expect = 7.044e-6
Identity = 26/60 (43.33%), Postives = 35/60 (58.33%), Query Frame = 2
Query: 2450 RCTCQRGFALESDGKTCM-DINECNTNLNICGKYGGTCVNILGSYECIC------DGEIC 2608
             C+C  G+A   DG+TC+ DI+EC++  + C   G TC N +GSY C C      DGE C
Sbjct:   28 TCSCNAGYA--GDGETCVEDIDECSSGAHTCAPSGSTCTNTVGSYTCACNVGYTGDGETC 85          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Medaka
Match: scube2 (signal peptide, CUB domain and EGF like domain containing 2 [Source:NCBI gene;Acc:101161226])

HSP 1 Score: 64.6994 bits (156), Expect = 1.208e-9
Identity = 70/236 (29.66%), Postives = 99/236 (41.95%), Query Frame = 2
Query: 2414 SCSHSCD--PGNGHRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECIC-DGEICKDCNEKCLTNYFKKNSCAQSKHLQCSKC--------TSECSPGYYIS---RKCTETSNIQCTACRPLCITGEFELSPCSGTSNRICKSRLSISGIELPDKKN-VWYEDRRNLRDIHHIISLDEAAKLSQDKELILE-------------RESGYQIRLKFDSEITLQP 3037
             C H C+  PGN +RCTC  GF L  DG  C+D++EC  N   C     TCVN +GSYEC C +G    D    C+    +  +C   +H     C          EC PG+ ++   R CT T N     C+  C   E       G   R C +R ++     PDKK+ V   +       H+  S  EA K  + + L++E             +++   +R       TLQP
Sbjct:   80 GCVHECNNIPGN-YRCTCYDGFNLAHDGHNCLDVDECKFNNGGCQH---TCVNTMGSYECRCKEGFFLSDNQHTCIHRSVEGLNCMNKEHGCAHICKETPKGGVACECRPGFVLAKNQRGCTLTCNHGNGGCQHTCEDTE------DGPICR-CHARYTLQ----PDKKSCVERNEATTESSDHNATSFTEADKRVK-RRLLMETCAVNNGGCDSTCKDTSTGVRCSCPVGFTLQP 299          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Medaka
Match: hmcn1 (hemicentin 1 [Source:NCBI gene;Acc:101172646])

HSP 1 Score: 59.6918 bits (143), Expect = 5.397e-8
Identity = 37/99 (37.37%), Postives = 51/99 (51.52%), Query Frame = 2
Query: 2357 YDMKNSLNILNQEVCRQRYSCSHSC--DPGNGHRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECI---CDGEICKDCNEKCLTN 2638
            ++ +  L ++N+  C  R +C H C   PG+ HRC C  G+ L  +GKTC D++EC      CG     C N+ GSYECI   C     +D    CL N
Sbjct: 5148 FESRGGLCLINE--CEMRDTCQHECMNTPGS-HRCLCPAGYRLMMNGKTCQDVDECLEQNIQCG-MNRMCFNMRGSYECIDTPCPPNYQRDPATFCLKN 5242          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Medaka
Match: scube1 (signal peptide, CUB and EGF-like domain-containing protein 1 [Source:NCBI gene;Acc:105357050])

HSP 1 Score: 56.9954 bits (136), Expect = 3.058e-7
Identity = 46/137 (33.58%), Postives = 61/137 (44.53%), Query Frame = 2
Query: 2414 SCSHSCD--PGNGHRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECIC-DGEICKDCNEKCLTNYFKKNSCAQSKHLQCSKC---------TSECSPGYYISRK---CTETSNIQCTACRPLC 2779
             C H C   PGN +RCTC  GF L  DG  C+D++EC  N   C +    CVN +GSYEC C +G    D    C+       +C    H     C         T EC PG+ +++    CT T +     C+  C
Sbjct:  114 GCVHECINIPGN-YRCTCYDGFKLADDGHNCLDVDECLDNNGGCQQ---VCVNTMGSYECQCTEGFFLSDNQHTCIHRSEDGMNCMNKDHGCAHICREAPGKGGVTCECRPGFELAKNQKDCTLTCHYGNGGCQHTC 246          

HSP 2 Score: 56.9954 bits (136), Expect = 3.110e-7
Identity = 33/88 (37.50%), Postives = 44/88 (50.00%), Query Frame = 2
Query: 2333 FKRNSIDIYDMKNSLNILNQEVCRQRYSCSHSC-DPGNGHRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECIC 2593
            F   S+   D +    +L +        C  +C D   G RC+C  GF L+SDGKTC DI+EC  N   C  +   C N +GS+EC C
Sbjct:  283 FNATSVADVDKRVKRRLLMETCAVNNGGCDRTCKDTATGVRCSCPVGFTLQSDGKTCKDIDECQENNGGCDHF---CRNTVGSFECSC 367          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Medaka
Match: scube1 (signal peptide, CUB and EGF-like domain-containing protein 1 [Source:NCBI gene;Acc:105357050])

HSP 1 Score: 56.225 bits (134), Expect = 4.868e-7
Identity = 46/137 (33.58%), Postives = 61/137 (44.53%), Query Frame = 2
Query: 2414 SCSHSCD--PGNGHRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECIC-DGEICKDCNEKCLTNYFKKNSCAQSKHLQCSKC---------TSECSPGYYISRK---CTETSNIQCTACRPLC 2779
             C H C   PGN +RCTC  GF L  DG  C+D++EC  N   C +    CVN +GSYEC C +G    D    C+       +C    H     C         T EC PG+ +++    CT T +     C+  C
Sbjct:  114 GCVHECINIPGN-YRCTCYDGFKLADDGHNCLDVDECLDNNGGCQQ---VCVNTMGSYECQCTEGFFLSDNQHTCIHRSEDGMNCMNKDHGCAHICREAPGKGGVTCECRPGFELAKNQKDCTLTCHYGNGGCQHTC 246          

HSP 2 Score: 54.299 bits (129), Expect = 1.802e-6
Identity = 29/61 (47.54%), Postives = 36/61 (59.02%), Query Frame = 2
Query: 2414 SCSHSC-DPGNGHRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECIC 2593
             C  +C D   G RC+C  GF L+SDGKTC DI+EC  N   C  +   C N +GS+EC C
Sbjct:  280 GCDRTCKDTATGVRCSCPVGFTLQSDGKTCKDIDECQENNGGCDHF---CRNTVGSFECSC 337          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Medaka
Match: scube1 (signal peptide, CUB and EGF-like domain-containing protein 1 [Source:NCBI gene;Acc:105357050])

HSP 1 Score: 55.8398 bits (133), Expect = 6.500e-7
Identity = 46/137 (33.58%), Postives = 61/137 (44.53%), Query Frame = 2
Query: 2414 SCSHSCD--PGNGHRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECIC-DGEICKDCNEKCLTNYFKKNSCAQSKHLQCSKC---------TSECSPGYYISRK---CTETSNIQCTACRPLC 2779
             C H C   PGN +RCTC  GF L  DG  C+D++EC  N   C +    CVN +GSYEC C +G    D    C+       +C    H     C         T EC PG+ +++    CT T +     C+  C
Sbjct:  106 GCVHECINIPGN-YRCTCYDGFKLADDGHNCLDVDECLDNNGGCQQ---VCVNTMGSYECQCTEGFFLSDNQHTCIHRSEDGMNCMNKDHGCAHICREAPGKGGVTCECRPGFELAKNQKDCTLTCHYGNGGCQHTC 238          

HSP 2 Score: 53.9138 bits (128), Expect = 2.212e-6
Identity = 29/61 (47.54%), Postives = 36/61 (59.02%), Query Frame = 2
Query: 2414 SCSHSC-DPGNGHRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECIC 2593
             C  +C D   G RC+C  GF L+SDGKTC DI+EC  N   C  +   C N +GS+EC C
Sbjct:  272 GCDRTCKDTATGVRCSCPVGFTLQSDGKTCKDIDECQENNGGCDHF---CRNTVGSFECSC 329          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Planmine SMEST
Match: SMESG000065173.1 (SMESG000065173.1)

HSP 1 Score: 4587.71 bits (11898), Expect = 0.000e+0
Identity = 2266/2283 (99.26%), Postives = 2269/2283 (99.39%), Query Frame = 2
Query:   44 MSFYKKQLTLIDEEELLGDYSTGKYPTNVIIQNPFKGTIEFLESESDKFQILINASYNSEIYSSEDIVKFNLNKHGDSLNIKLMTDVVESTVYRSTSFINDNNQKSSEFLPLYLLITCISILVSLTFVFSIFFAYWWNKNKRPHITRPLQYKIDTDSTKHPLLISEPNTPHLLHNQMHGNFLSSKDQLNNPDLTTNSCQLMNPLRYNSMVSCSTGIDTLTNQGNIGISDRMPFVLTGGFDDYPMDNVDVMNSLNATGSLDNYFNQGPLMVSTNTTSMSYSTLPLNFSMTHSSRCNAGMDNSNHYMTYNPTQMIRSTDSGKITVSTTKFVSDPSYGINRHLAKDFLDENIIERIGMNFLSQISENDASHFNVEDMDAHNKQCPLDSMGMYQQLSRNTGQGSDETSGILSDSSGSTLDRPAQSSNAKISSGFSIVPSVINSGERFVSLDANDQRYIPLSDVIAEVANCPQHSYLIKAGQFQGVNMVQQIPMNQKSSCSPPMISVDWNIPSSSCGAQIPVYHGVQVHGAPIDRKLSSGTLNKSNIYQPVIVSEDSIFYTDKAKNVLISPVSGDQKNIIGGTLGRQNKNTPKPPRRDGTDKTSNIKEQQHLVDVNKTDTFEVDDECGEDDESGASTSPRSALKGSRHGPRVSKQ--FTTLGLLSFFTGMLICSVSGTNSRLSSSDITIINANYVIDDSAIPNITNNAIHQFSLDGNQFIQQIYQFIDLKLTVFIPSHLVDKNKSFKQNKIKSFQLYNNLSSNTMVKLGVFKRNSIDIYDMKNSLNILNQEVCRQRYSCSHSCDPGNGHRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECICDGEICKDCNEKCLTNYFKKNSCAQSKHLQCSKCTSECSPGYYISRKCTETSNIQCTACRPLCITGEFELSPCSGTSNRICKSRLSISGIELPDKKNVWYEDRRNLRDIHHIISLDEAAKLSQDKELILERESGYQIRLKFDSEITLQPLFEPVDHSVYNDNALFKINPSNYTLKYLCPYPMPPIYDLKMQMHYNVTTEVVNDRDLPGYRPLLQACSTYIQHGEFPETDKDIYRDSPDNSWQSNYKSWTPSTVSCLDAGKLPSIFGDTLNEQLAIREGIYVEEKHYCSKIKSDCQRCLVDCAHNMINNLLTCKPTDSPADNGRSPRLELCFDCCAKENCSSVCDKYAQQRCAMHLCMSGPRMDLQLSPEWPKHDNFICHMKPSSLKPIFSLRWYLYKDNKKLTLDEFTEKMHFTEKPMGDQMSHKIKQVFKDLIHVTYSSNIHTLPNIISGTNDLQNAYIWNTERLPLTPGSASVKPGEKLSSIKVWPYLPMGVNSGYWSQLAKYDCNKASEIVDRLNVYTSEIPPYRQLQDLKVERISQYKYRLSNHRLASSLNFTIPARASLLSAIFTPTWVDREQFLSASLVYLGSDATQTENAFNGYWIVELIGQVNNFPGFFRLQLWSHDSKLLNVQNPLTDSYKISRDDSFPLLDYDIGVYDEKNFKIHLRILAPESQPXXXXXXXXXXXXXXGELEIMVHRSRQDPQMMIQIEKYRRTPDGKYSEEISILPEVMAVSREKSLKETSPFGIPPLVIYTVXXXXXXXXXXXXXXXXTRKEEHLCEDIVFKSRHLVVFVIYLTLKAFYCFXXXXXXXXXXXXXYTREPYNQLTNHNSEYTNSTVAEKLLMDKMDTYLERELSRQLAHVTQIKTLCDKRLMDYYQKMNQRLELVSAQAAKRRSRVLISQAVVERAQYELRNMVNQLTRNLEDFNRTAKIYMKRIQHDMKMTKKKLSESEWLEGARLIYQEVLRKRNEGTISKDDPTKSFLAWLKITGELPESPPQLTLPSSFPFPDWAELNIPVPEPRLGSGLDAEYGPEYKPFNIKEKDIELEHSIWSFYDLPDESSSKNNPGYKSDHESKYQSNPTVFKDANNEEKGMIYTETIESIYRILIQLSWCHXXXXXXXXXXXWFLHRAAHTIDTIEQIFYGYPCFIDCTIKGTRRKKRNENNFKFMLKRTFCEAMESSFVPKFCGSAFSLFIIYLLSTHLNELISEEALDFVGYYDNMALPTHLRNRFINTQIVQSAQQLNDYELGSYELFIHQRQSEIQDILNSWVDWTTQLEQYQCELLRLYKTDDSGKLIADILNKPDKVPIPTHCKMTTEERQKEIEKLIEFKMSVCPVSMIIPRLFTEYNETEVSLQIVKSSRHWLRWTRRWMDTVIHCLFGYISAIILWNTVGATIWFYVKRFSVIRQKRIYETDVQSIPLSTTESEMKSSALQ 6886
            MSFYKKQLTLIDEEELLGDYSTGKYPTNVIIQNPFKGTIEFLESESDKFQILINASYNSEIYSSEDIVKFNLNKHGDSLNIKLMTDVVESTVYRSTSFINDNNQKSSEFLPLY+LITCISILVSLTFVFSIFFAYWWNKNKRPHITRPLQYKIDTDSTKHPLLISEPNTPHLLHNQMHGNFLSSKDQLNNPDLTTNSCQLMNPLRYNSMVSCSTGIDTLTNQGNIGISDRMPFVLTGGFDDYPMDNVDVMNSLNATGSLDNYFNQGPLMVSTNTTSMSYSTLPLNFSMTHSSRCNAGMDNSNHYMTYNPTQMIRSTDSGKITVSTT    +PSYGINRHLAKDFLDENIIERIGMNFLSQISENDASHFNVEDMDAHNKQCPLDSMGMYQQLSRNTGQGSDETSGILSDSSGSTLDRPAQ     ISSGFSIVPSVINSGERFVSLDANDQRYIPLSDVIAEVANCPQHSYLIKAGQFQGVNMVQQIPMNQKSSCSPPMISVDWNIPSSSCGAQIPVYHGVQVHGAPIDRKLSSGTLNKSNIYQPVIVSEDSIFYTDKAKNVLISPVSGDQK IIGGTLGRQNKNTPKPPRRDGTDKTSNIKEQQHLVDVNKTDTFEVDDECGEDDESGASTSPRSALKGSRHGPRVSKQ  FTTLGLLSFFTGMLICSVSGTNSRLSSSDITIINANYVIDDSAIPNITNNAIHQFSLDGNQFIQQIYQFIDLKLTVFIPSHLVDKNKSF+QNKIKSFQLYNNLSSNTMVKLGVFKRNSIDIYDMKNSLNILNQEVCRQRYSCSHSCDPGNGHRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECICDGEICKDCNEKCLTNYFKKNSCAQSKHLQCSKCTSECSPGYYISRKCTETSNIQCTACRPLCITGEFELSPCSGTSNRICKSRLSISGIELPDKKNVWYEDRRNLRDIHHIISLDEAAKLSQDKELILERESGYQIRLKFDSEITLQPLFEPVDHSVYNDNALFKINPSNYTLKYLCPYPMPPIYDLKMQMHYNVTTEVVNDRDLPGYRPLLQACSTYIQHGEFPETDKDIYRDSPDNSWQSNYKSWTPSTVSCLDAGKLPSIFGDTLNEQLAIREGIYVEEKHYCSKIKSDCQRCLVDCAHNMINNLLTCKPTDSPADNGRSPRLELCFDCCAKENCSSVCDKYAQQRCAMHLCMSGPRMDLQLSPEWPKHDNFICHMKPSSLKPIFSLRWYLYKDNKKLTLDEFTEKMHFTEKPMGDQMSHKIKQVFKDLIHVTYSSNIHTLPNIISGTNDLQNAYIWNTERLPLTPGSA VKPGEKLSSIKVWPYLPMGVNSGYWSQLAKYDCNKASEIVDRLNVYTSEIPPYRQLQDLKVERISQYKYRLSNHRLASSLNFTIPARASLLSAIFTPTWVDREQFLSASLVYLGSDATQTENAFNGYWIVELIGQVNNFPGFFRLQLWSHDSKLLNVQNPLTDSYKISRDDSFPLLDYDIGVYDEKNFKIHLRILAPESQPDYDKSFIIKIIDIKGELEIMVHRSRQDPQMMIQIEKYRRTPDGKYSEEISILPEVMAVSREKSLKETSPFGIPPLVIYTVLAVLTICLLLLFIGHLTRKEEHLCEDIVFKSRHLVVFVIYLTLKAFYCFTVTTTTLLIVIVIYTREPYNQLTNHNSEYTNSTVAEKLLM KMDTYLERELSRQLAHVTQIKTLCDKRLMDYYQKMNQRLELVSAQAAKRRSRVLISQAVVERAQYELRNMVNQLTRNLEDFNRTAKIYMKRIQHDMKMTKKKLSESEWLEGARLIYQEVLRKRNEGTISKDDPTKSFLAWLKITGELPESPPQLTLPSSFPFPDWAELNIPVPEPRLGSGLDAEYGPEYKPFNIKEKDIELEHSIWSFYDLPDESSSKNNPGYKSDHESKYQSNPTVFKDANNEEKGMIYTETIESIYRILIQLSWCHLLTLTLLLDLLWFLHRAAHTIDTIEQIFYGYPCFIDCTIKGTRRKKRNENNFKFMLKRTFCEAMESSFVPKFCGSAFSLFIIYLLSTHLNELISEEALDFVGYYDNMALPTHLRNRFINTQIVQSAQQLNDYELGSYELFIHQRQSEIQDILNSWVDWTTQLEQYQCELLRLYKTDDSGKLIADILNKPDKVPIPTHCKMTTEERQKEIEKLIEFKMSVCPVSMIIPRLFTEYNETEVSLQIVKSSRHWLRWTRRWMDTVIHCLFGYISAIILWNTVGATIWFYVKRFSVIRQKRIYETDVQSIPLSTTESEMKSSALQ
Sbjct:    1 MSFYKKQLTLIDEEELLGDYSTGKYPTNVIIQNPFKGTIEFLESESDKFQILINASYNSEIYSSEDIVKFNLNKHGDSLNIKLMTDVVESTVYRSTSFINDNNQKSSEFLPLYVLITCISILVSLTFVFSIFFAYWWNKNKRPHITRPLQYKIDTDSTKHPLLISEPNTPHLLHNQMHGNFLSSKDQLNNPDLTTNSCQLMNPLRYNSMVSCSTGIDTLTNQGNIGISDRMPFVLTGGFDDYPMDNVDVMNSLNATGSLDNYFNQGPLMVSTNTTSMSYSTLPLNFSMTHSSRCNAGMDNSNHYMTYNPTQMIRSTDSGKITVSTT----NPSYGINRHLAKDFLDENIIERIGMNFLSQISENDASHFNVEDMDAHNKQCPLDSMGMYQQLSRNTGQGSDETSGILSDSSGSTLDRPAQ-----ISSGFSIVPSVINSGERFVSLDANDQRYIPLSDVIAEVANCPQHSYLIKAGQFQGVNMVQQIPMNQKSSCSPPMISVDWNIPSSSCGAQIPVYHGVQVHGAPIDRKLSSGTLNKSNIYQPVIVSEDSIFYTDKAKNVLISPVSGDQKTIIGGTLGRQNKNTPKPPRRDGTDKTSNIKEQQHLVDVNKTDTFEVDDECGEDDESGASTSPRSALKGSRHGPRVSKQLRFTTLGLLSFFTGMLICSVSGTNSRLSSSDITIINANYVIDDSAIPNITNNAIHQFSLDGNQFIQQIYQFIDLKLTVFIPSHLVDKNKSFQQNKIKSFQLYNNLSSNTMVKLGVFKRNSIDIYDMKNSLNILNQEVCRQRYSCSHSCDPGNGHRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECICDGEICKDCNEKCLTNYFKKNSCAQSKHLQCSKCTSECSPGYYISRKCTETSNIQCTACRPLCITGEFELSPCSGTSNRICKSRLSISGIELPDKKNVWYEDRRNLRDIHHIISLDEAAKLSQDKELILERESGYQIRLKFDSEITLQPLFEPVDHSVYNDNALFKINPSNYTLKYLCPYPMPPIYDLKMQMHYNVTTEVVNDRDLPGYRPLLQACSTYIQHGEFPETDKDIYRDSPDNSWQSNYKSWTPSTVSCLDAGKLPSIFGDTLNEQLAIREGIYVEEKHYCSKIKSDCQRCLVDCAHNMINNLLTCKPTDSPADNGRSPRLELCFDCCAKENCSSVCDKYAQQRCAMHLCMSGPRMDLQLSPEWPKHDNFICHMKPSSLKPIFSLRWYLYKDNKKLTLDEFTEKMHFTEKPMGDQMSHKIKQVFKDLIHVTYSSNIHTLPNIISGTNDLQNAYIWNTERLPLTPGSAPVKPGEKLSSIKVWPYLPMGVNSGYWSQLAKYDCNKASEIVDRLNVYTSEIPPYRQLQDLKVERISQYKYRLSNHRLASSLNFTIPARASLLSAIFTPTWVDREQFLSASLVYLGSDATQTENAFNGYWIVELIGQVNNFPGFFRLQLWSHDSKLLNVQNPLTDSYKISRDDSFPLLDYDIGVYDEKNFKIHLRILAPESQPDYDKSFIIKIIDIKGELEIMVHRSRQDPQMMIQIEKYRRTPDGKYSEEISILPEVMAVSREKSLKETSPFGIPPLVIYTVLAVLTICLLLLFIGHLTRKEEHLCEDIVFKSRHLVVFVIYLTLKAFYCFTVTTTTLLIVIVIYTREPYNQLTNHNSEYTNSTVAEKLLMYKMDTYLERELSRQLAHVTQIKTLCDKRLMDYYQKMNQRLELVSAQAAKRRSRVLISQAVVERAQYELRNMVNQLTRNLEDFNRTAKIYMKRIQHDMKMTKKKLSESEWLEGARLIYQEVLRKRNEGTISKDDPTKSFLAWLKITGELPESPPQLTLPSSFPFPDWAELNIPVPEPRLGSGLDAEYGPEYKPFNIKEKDIELEHSIWSFYDLPDESSSKNNPGYKSDHESKYQSNPTVFKDANNEEKGMIYTETIESIYRILIQLSWCHLLTLTLLLDLLWFLHRAAHTIDTIEQIFYGYPCFIDCTIKGTRRKKRNENNFKFMLKRTFCEAMESSFVPKFCGSAFSLFIIYLLSTHLNELISEEALDFVGYYDNMALPTHLRNRFINTQIVQSAQQLNDYELGSYELFIHQRQSEIQDILNSWVDWTTQLEQYQCELLRLYKTDDSGKLIADILNKPDKVPIPTHCKMTTEERQKEIEKLIEFKMSVCPVSMIIPRLFTEYNETEVSLQIVKSSRHWLRWTRRWMDTVIHCLFGYISAIILWNTVGATIWFYVKRFSVIRQKRIYETDVQSIPLSTTESEMKSSALQ 2274          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Planmine SMEST
Match: SMESG000065173.1 (SMESG000065173.1)

HSP 1 Score: 4509.52 bits (11695), Expect = 0.000e+0
Identity = 2238/2283 (98.03%), Postives = 2245/2283 (98.34%), Query Frame = 2
Query:   44 MSFYKKQLTLIDEEELLGDYSTGKYPTNVIIQNPFKGTIEFLESESDKFQILINASYNSEIYSSEDIVKFNLNKHGDSLNIKLMTDVVESTVYRSTSFINDNNQKSSEFLPLYLLITCISILVSLTFVFSIFFAYWWNKNKRPHITRPLQYKIDTDSTKHPLLISEPNTPHLLHNQMHGNFLSSKDQLNNPDLTTNSCQLMNPLRYNSMVSCSTGIDTLTNQGNIGISDRMPFVLTGGFDDYPMDNVDVMNSLNATGSLDNYFNQGPLMVSTNTTSMSYSTLPLNFSMTHSSRCNAGMDNSNHYMTYNPTQMIRSTDSGKITVSTTKFVSDPSYGINRHLAKDFLDENIIERIGMNFLSQISENDASHFNVEDMDAHNKQCPLDSMGMYQQLSRNTGQGSDETSGILSDSSGSTLDRPAQSSNAKISSGFSIVPSVINSGERFVSLDANDQRYIPLSDVIAEVANCPQHSYLIKAGQFQGVNMVQQIPMNQKSSCSPPMISVDWNIPSSSCGAQIPVYHGVQVHGAPIDRKLSSGTLNKSNIYQPVIVSEDSIFYTDKAKNVLISPVSGDQKNIIGGTLGRQNKNTPKPPRRDGTDKTSNIKEQQHLVDVNKTDTFEVDDECGEDDESGASTSPRSALKGSRHGPRVSKQ--FTTLGLLSFFTGMLICSVSGTNSRLSSSDITIINANYVIDDSAIPNITNNAIHQFSLDGNQFIQQIYQFIDLKLTVFIPSHLVDKNKSFKQNKIKSFQLYNNLSSNTMVKLGVFKRNSIDIYDMKNSLNILNQEVCRQRYSCSHSCDPGNGHRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECICDGEICKDCNEKCLTNYFKKNSCAQSKHLQCSKCTSECSPGYYISRKCTETSNIQCTACRPLCITGEFELSPCSGTSNRICKSRLSISGIELPDKKNVWYEDRRNLRDIHHIISLDEAAKLSQDKELILERESGYQIRLKFDSEITLQPLFEPVDHSVYNDNALFKINPSNYTLKYLCPYPMPPIYDLKMQMHYNVTTEVVNDRDLPGYRPLLQACSTYIQHGEFPETDKDIYRDSPDNSWQSNYKSWTPSTVSCLDAGKLPSIFGDTLNEQLAIREGIYVEEKHYCSKIKSDCQRCLVDCAHNMINNLLTCKPTDSPADNGRSPRLELCFDCCAKENCSSVCDKYAQQRCAMHLCMSGPRMDLQLSPEWPKHDNFICHMKPSSLKPIFSLRWYLYKDNKKLTLDEFTEKMHFTEKPMGDQMSHKIKQVFKDLIHVTYSSNIHTLPNIISGTNDLQNAYIWNTERLPLTPGSASVKPGEKLSSIKVWPYLPMGVNSGYWSQLAKYDCNKASEIVDRLNVYTSEIPPYRQLQDLKVERISQYKYRLSNHRLASSLNFTIPARASLLSAIFTPTWVDREQFLSASLVYLGSDATQTENAFNGYWIVELIGQVNNFPGFFRLQLWSHDSKLLNVQNPLTDSYKISRDDSFPLLDYDIGVYDEKNFKIHLRILAPESQPXXXXXXXXXXXXXXGELEIMVHRSRQDPQMMIQIEKYRRTPDGKYSEEISILPEVMAVSREKSLKETSPFGIPPLVIYTVXXXXXXXXXXXXXXXXTRKEEHLCEDIVFKSRHLVVFVIYLTLKAFYCFXXXXXXXXXXXXXYTREPYNQLTNHNSEYTNSTVAEKLLMDKMDTYLERELSRQLAHVTQIKTLCDKRLMDYYQKMNQRLELVSAQAAKRRSRVLISQAVVERAQYELRNMVNQLTRNLEDFNRTAKIYMKRIQHDMKMTKKKLSESEWLEGARLIYQEVLRKRNEGTISKDDPTKSFLAWLKITGELPESPPQLTLPSSFPFPDWAELNIPVPEPRLGSGLDAEYGPEYKPFNIKEKDIELEHSIWSFYDLPDESSSKNNPGYKSDHESKYQSNPTVFKDANNEEKGMIYTETIESIYRILIQLSWCHXXXXXXXXXXXWFLHRAAHTIDTIEQIFYGYPCFIDCTIKGTRRKKRNENNFKFMLKRTFCEAMESSFVPKFCGSAFSLFIIYLLSTHLNELISEEALDFVGYYDNMALPTHLRNRFINTQIVQSAQQLNDYELGSYELFIHQRQSEIQDILNSWVDWTTQLEQYQCELLRLYKTDDSGKLIADILNKPDKVPIPTHCKMTTEERQKEIEKLIEFKMSVCPVSMIIPRLFTEYNETEVSLQIVKSSRHWLRWTRRWMDTVIHCLFGYISAIILWNTVGATIWFYVKRFSVIRQKRIYETDVQSIPLSTTESEMKSSALQ 6886
            MSFYKKQLTLIDEEELLGDYSTGKYPTNVIIQNPFKGTIEFLESESDKFQILINASYNSEIYSSEDIVKFNLNKHGDSLNIKLMTDVVESTVYRSTSFINDNNQKSSEFLPLY+LITCISILVSLTFVFSIFFAYWWNKNKRPHITRPLQYKIDT     P++                  ++ KDQLNNPDLTTNSCQLMNPLRYNSMVSCSTGIDTLTNQGNIGISDRMPFVLTGGFDDYPMDNVDVMNSLNATGSLDNYFNQGPLMVSTNTTSMSYSTLPLNFSMTHSSRCNAGMDNSNHYMTYNPTQMIRSTDSGKITVSTT    +PSYGINRHLAKDFLDENIIERIGMNFLSQISENDASHFNVEDMDAHNKQCPLDSMGMYQQLSRNTGQGSDETSGILSDSSGSTLDRPAQ     ISSGFSIVPSVINSGERFVSLDANDQRYIPLSDVIAEVANCPQHSYLIKAGQFQGVNMVQQIPMNQKSSCSPPMISVDWNIPSSSCGAQIPVYHGVQVHGAPIDRKLSSGTLNKSNIYQPVIVSEDSIFYTDKAKNVLISPVSGDQK IIGGTLGRQNKNTPKPPRRDGTDKTSNIKEQQHLVDVNKTDTFEVDDECGEDDESGASTSPRSALKGSRHGPRVSKQ  FTTLGLLSFFTGMLICSVSGTNSRLSSSDITIINANYVIDDSAIPNITNNAIHQFSLDGNQFIQQIYQFIDLKLTVFIPSHLVDKNKSF+QNKIKSFQLYNNLSSNTMVKLGVFKRNSIDIYDMKNSLNILNQEVCRQRYSCSHSCDPGNGHRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECICDGEICKDCNEKCLTNYFKKNSCAQSKHLQCSKCTSECSPGYYISRKCTETSNIQCTACRPLCITGEFELSPCSGTSNRICKSRLSISGIELPDKKNVWYEDRRNLRDIHHIISLDEAAKLSQDKELILERESGYQIRLKFDSEITLQPLFEPVDHSVYNDNALFKINPSNYTLKYLCPYPMPPIYDLKMQMHYNVTTEVVNDRDLPGYRPLLQACSTYIQHGEFPETDKDIYRDSPDNSWQSNYKSWTPSTVSCLDAGKLPSIFGDTLNEQLAIREGIYVEEKHYCSKIKSDCQRCLVDCAHNMINNLLTCKPTDSPADNGRSPRLELCFDCCAKENCSSVCDKYAQQRCAMHLCMSGPRMDLQLSPEWPKHDNFICHMKPSSLKPIFSLRWYLYKDNKKLTLDEFTEKMHFTEKPMGDQMSHKIKQVFKDLIHVTYSSNIHTLPNIISGTNDLQNAYIWNTERLPLTPGSA VKPGEKLSSIKVWPYLPMGVNSGYWSQLAKYDCNKASEIVDRLNVYTSEIPPYRQLQDLKVERISQYKYRLSNHRLASSLNFTIPARASLLSAIFTPTWVDREQFLSASLVYLGSDATQTENAFNGYWIVELIGQVNNFPGFFRLQLWSHDSKLLNVQNPLTDSYKISRDDSFPLLDYDIGVYDEKNFKIHLRILAPESQPDYDKSFIIKIIDIKGELEIMVHRSRQDPQMMIQIEKYRRTPDGKYSEEISILPEVMAVSREKSLKETSPFGIPPLVIYTVLAVLTICLLLLFIGHLTRKEEHLCEDIVFKSRHLVVFVIYLTLKAFYCFTVTTTTLLIVIVIYTREPYNQLTNHNSEYTNSTVAEKLLM KMDTYLERELSRQLAHVTQIKTLCDKRLMDYYQKMNQRLELVSAQAAKRRSRVLISQAVVERAQYELRNMVNQLTRNLEDFNRTAKIYMKRIQHDMKMTKKKLSESEWLEGARLIYQEVLRKRNEGTISKDDPTKSFLAWLKITGELPESPPQLTLPSSFPFPDWAELNIPVPEPRLGSGLDAEYGPEYKPFNIKEKDIELEHSIWSFYDLPDESSSKNNPGYKSDHESKYQSNPTVFKDANNEEKGMIYTETIESIYRILIQLSWCHLLTLTLLLDLLWFLHRAAHTIDTIEQIFYGYPCFIDCTIKGTRRKKRNENNFKFMLKRTFCEAMESSFVPKFCGSAFSLFIIYLLSTHLNELISEEALDFVGYYDNMALPTHLRNRFINTQIVQSAQQLNDYELGSYELFIHQRQSEIQDILNSWVDWTTQLEQYQCELLRLYKTDDSGKLIADILNKPDKVPIPTHCKMTTEERQKEIEKLIEFKMSVCPVSMIIPRLFTEYNETEVSLQIVKSSRHWLRWTRRWMDTVIHCLFGYISAIILWNTVGATIWFYVKRFSVIRQKRIYETDVQSIPLSTTESEMKSSALQ
Sbjct:    1 MSFYKKQLTLIDEEELLGDYSTGKYPTNVIIQNPFKGTIEFLESESDKFQILINASYNSEIYSSEDIVKFNLNKHGDSLNIKLMTDVVESTVYRSTSFINDNNQKSSEFLPLYVLITCISILVSLTFVFSIFFAYWWNKNKRPHITRPLQYKIDT----VPMM-----------------SITRKDQLNNPDLTTNSCQLMNPLRYNSMVSCSTGIDTLTNQGNIGISDRMPFVLTGGFDDYPMDNVDVMNSLNATGSLDNYFNQGPLMVSTNTTSMSYSTLPLNFSMTHSSRCNAGMDNSNHYMTYNPTQMIRSTDSGKITVSTT----NPSYGINRHLAKDFLDENIIERIGMNFLSQISENDASHFNVEDMDAHNKQCPLDSMGMYQQLSRNTGQGSDETSGILSDSSGSTLDRPAQ-----ISSGFSIVPSVINSGERFVSLDANDQRYIPLSDVIAEVANCPQHSYLIKAGQFQGVNMVQQIPMNQKSSCSPPMISVDWNIPSSSCGAQIPVYHGVQVHGAPIDRKLSSGTLNKSNIYQPVIVSEDSIFYTDKAKNVLISPVSGDQKTIIGGTLGRQNKNTPKPPRRDGTDKTSNIKEQQHLVDVNKTDTFEVDDECGEDDESGASTSPRSALKGSRHGPRVSKQLRFTTLGLLSFFTGMLICSVSGTNSRLSSSDITIINANYVIDDSAIPNITNNAIHQFSLDGNQFIQQIYQFIDLKLTVFIPSHLVDKNKSFQQNKIKSFQLYNNLSSNTMVKLGVFKRNSIDIYDMKNSLNILNQEVCRQRYSCSHSCDPGNGHRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECICDGEICKDCNEKCLTNYFKKNSCAQSKHLQCSKCTSECSPGYYISRKCTETSNIQCTACRPLCITGEFELSPCSGTSNRICKSRLSISGIELPDKKNVWYEDRRNLRDIHHIISLDEAAKLSQDKELILERESGYQIRLKFDSEITLQPLFEPVDHSVYNDNALFKINPSNYTLKYLCPYPMPPIYDLKMQMHYNVTTEVVNDRDLPGYRPLLQACSTYIQHGEFPETDKDIYRDSPDNSWQSNYKSWTPSTVSCLDAGKLPSIFGDTLNEQLAIREGIYVEEKHYCSKIKSDCQRCLVDCAHNMINNLLTCKPTDSPADNGRSPRLELCFDCCAKENCSSVCDKYAQQRCAMHLCMSGPRMDLQLSPEWPKHDNFICHMKPSSLKPIFSLRWYLYKDNKKLTLDEFTEKMHFTEKPMGDQMSHKIKQVFKDLIHVTYSSNIHTLPNIISGTNDLQNAYIWNTERLPLTPGSAPVKPGEKLSSIKVWPYLPMGVNSGYWSQLAKYDCNKASEIVDRLNVYTSEIPPYRQLQDLKVERISQYKYRLSNHRLASSLNFTIPARASLLSAIFTPTWVDREQFLSASLVYLGSDATQTENAFNGYWIVELIGQVNNFPGFFRLQLWSHDSKLLNVQNPLTDSYKISRDDSFPLLDYDIGVYDEKNFKIHLRILAPESQPDYDKSFIIKIIDIKGELEIMVHRSRQDPQMMIQIEKYRRTPDGKYSEEISILPEVMAVSREKSLKETSPFGIPPLVIYTVLAVLTICLLLLFIGHLTRKEEHLCEDIVFKSRHLVVFVIYLTLKAFYCFTVTTTTLLIVIVIYTREPYNQLTNHNSEYTNSTVAEKLLMYKMDTYLERELSRQLAHVTQIKTLCDKRLMDYYQKMNQRLELVSAQAAKRRSRVLISQAVVERAQYELRNMVNQLTRNLEDFNRTAKIYMKRIQHDMKMTKKKLSESEWLEGARLIYQEVLRKRNEGTISKDDPTKSFLAWLKITGELPESPPQLTLPSSFPFPDWAELNIPVPEPRLGSGLDAEYGPEYKPFNIKEKDIELEHSIWSFYDLPDESSSKNNPGYKSDHESKYQSNPTVFKDANNEEKGMIYTETIESIYRILIQLSWCHLLTLTLLLDLLWFLHRAAHTIDTIEQIFYGYPCFIDCTIKGTRRKKRNENNFKFMLKRTFCEAMESSFVPKFCGSAFSLFIIYLLSTHLNELISEEALDFVGYYDNMALPTHLRNRFINTQIVQSAQQLNDYELGSYELFIHQRQSEIQDILNSWVDWTTQLEQYQCELLRLYKTDDSGKLIADILNKPDKVPIPTHCKMTTEERQKEIEKLIEFKMSVCPVSMIIPRLFTEYNETEVSLQIVKSSRHWLRWTRRWMDTVIHCLFGYISAIILWNTVGATIWFYVKRFSVIRQKRIYETDVQSIPLSTTESEMKSSALQ 2253          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Planmine SMEST
Match: SMESG000065173.1 (SMESG000065173.1)

HSP 1 Score: 4242.57 bits (11002), Expect = 0.000e+0
Identity = 2096/2107 (99.48%), Postives = 2098/2107 (99.57%), Query Frame = 2
Query:  572 MHGNFLSSKDQLNNPDLTTNSCQLMNPLRYNSMVSCSTGIDTLTNQGNIGISDRMPFVLTGGFDDYPMDNVDVMNSLNATGSLDNYFNQGPLMVSTNTTSMSYSTLPLNFSMTHSSRCNAGMDNSNHYMTYNPTQMIRSTDSGKITVSTTKFVSDPSYGINRHLAKDFLDENIIERIGMNFLSQISENDASHFNVEDMDAHNKQCPLDSMGMYQQLSRNTGQGSDETSGILSDSSGSTLDRPAQSSNAKISSGFSIVPSVINSGERFVSLDANDQRYIPLSDVIAEVANCPQHSYLIKAGQFQGVNMVQQIPMNQKSSCSPPMISVDWNIPSSSCGAQIPVYHGVQVHGAPIDRKLSSGTLNKSNIYQPVIVSEDSIFYTDKAKNVLISPVSGDQKNIIGGTLGRQNKNTPKPPRRDGTDKTSNIKEQQHLVDVNKTDTFEVDDECGEDDESGASTSPRSALKGSRHGPRVSKQ--FTTLGLLSFFTGMLICSVSGTNSRLSSSDITIINANYVIDDSAIPNITNNAIHQFSLDGNQFIQQIYQFIDLKLTVFIPSHLVDKNKSFKQNKIKSFQLYNNLSSNTMVKLGVFKRNSIDIYDMKNSLNILNQEVCRQRYSCSHSCDPGNGHRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECICDGEICKDCNEKCLTNYFKKNSCAQSKHLQCSKCTSECSPGYYISRKCTETSNIQCTACRPLCITGEFELSPCSGTSNRICKSRLSISGIELPDKKNVWYEDRRNLRDIHHIISLDEAAKLSQDKELILERESGYQIRLKFDSEITLQPLFEPVDHSVYNDNALFKINPSNYTLKYLCPYPMPPIYDLKMQMHYNVTTEVVNDRDLPGYRPLLQACSTYIQHGEFPETDKDIYRDSPDNSWQSNYKSWTPSTVSCLDAGKLPSIFGDTLNEQLAIREGIYVEEKHYCSKIKSDCQRCLVDCAHNMINNLLTCKPTDSPADNGRSPRLELCFDCCAKENCSSVCDKYAQQRCAMHLCMSGPRMDLQLSPEWPKHDNFICHMKPSSLKPIFSLRWYLYKDNKKLTLDEFTEKMHFTEKPMGDQMSHKIKQVFKDLIHVTYSSNIHTLPNIISGTNDLQNAYIWNTERLPLTPGSASVKPGEKLSSIKVWPYLPMGVNSGYWSQLAKYDCNKASEIVDRLNVYTSEIPPYRQLQDLKVERISQYKYRLSNHRLASSLNFTIPARASLLSAIFTPTWVDREQFLSASLVYLGSDATQTENAFNGYWIVELIGQVNNFPGFFRLQLWSHDSKLLNVQNPLTDSYKISRDDSFPLLDYDIGVYDEKNFKIHLRILAPESQPXXXXXXXXXXXXXXGELEIMVHRSRQDPQMMIQIEKYRRTPDGKYSEEISILPEVMAVSREKSLKETSPFGIPPLVIYTVXXXXXXXXXXXXXXXXTRKEEHLCEDIVFKSRHLVVFVIYLTLKAFYCFXXXXXXXXXXXXXYTREPYNQLTNHNSEYTNSTVAEKLLMDKMDTYLERELSRQLAHVTQIKTLCDKRLMDYYQKMNQRLELVSAQAAKRRSRVLISQAVVERAQYELRNMVNQLTRNLEDFNRTAKIYMKRIQHDMKMTKKKLSESEWLEGARLIYQEVLRKRNEGTISKDDPTKSFLAWLKITGELPESPPQLTLPSSFPFPDWAELNIPVPEPRLGSGLDAEYGPEYKPFNIKEKDIELEHSIWSFYDLPDESSSKNNPGYKSDHESKYQSNPTVFKDANNEEKGMIYTETIESIYRILIQLSWCHXXXXXXXXXXXWFLHRAAHTIDTIEQIFYGYPCFIDCTIKGTRRKKRNENNFKFMLKRTFCEAMESSFVPKFCGSAFSLFIIYLLSTHLNELISEEALDFVGYYDNMALPTHLRNRFINTQIVQSAQQLNDYELGSYELFIHQRQSEIQDILNSWVDWTTQLEQYQCELLRLYKTDDSGKLIADILNKPDKVPIPTHCKMTTEERQKEIEKLIEFKMSVCPVSMIIPRLFTEYNETEVSLQIVKSSRHWLRWTRRWMDTVIHCLFGYISAIILWNTVGATIWFYVKRFSVIRQKRIYETDVQSIPLSTTESEMKSSALQ 6886
            MHGNFLSSKDQLNNPDLTTNSCQLMNPLRYNSMVSCSTGIDTLTNQGNIGISDRMPFVLTGGFDDYPMDNVDVMNSLNATGSLDNYFNQGPLMVSTNTTSMSYSTLPLNFSMTHSSRCNAGMDNSNHYMTYNPTQMIRSTDSGKITVSTT    +PSYGINRHLAKDFLDENIIERIGMNFLSQISENDASHFNVEDMDAHNKQCPLDSMGMYQQLSRNTGQGSDETSGILSDSSGSTLDRPAQSSNAKISSGFSIVPSVINSGERFVSLDANDQRYIPLSDVIAEVANCPQHSYLIKAGQFQGVNMVQQIPMNQKSSCSPPMISVDWNIPSSSCGAQIPVYHGVQVHGAPIDRKLSSGTLNKSNIYQPVIVSEDSIFYTDKAKNVLISPVSGDQK IIGGTLGRQNKNTPKPPRRDGTDKTSNIKEQQHLVDVNKTDTFEVDDECGEDDESGASTSPRSALKGSRHGPRVSKQ  FTTLGLLSFFTGMLICSVSGTNSRLSSSDITIINANYVIDDSAIPNITNNAIHQFSLDGNQFIQQIYQFIDLKLTVFIPSHLVDKNKSF+QNKIKSFQLYNNLSSNTMVKLGVFKRNSIDIYDMKNSLNILNQEVCRQRYSCSHSCDPGNGHRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECICDGEICKDCNEKCLTNYFKKNSCAQSKHLQCSKCTSECSPGYYISRKCTETSNIQCTACRPLCITGEFELSPCSGTSNRICKSRLSISGIELPDKKNVWYEDRRNLRDIHHIISLDEAAKLSQDKELILERESGYQIRLKFDSEITLQPLFEPVDHSVYNDNALFKINPSNYTLKYLCPYPMPPIYDLKMQMHYNVTTEVVNDRDLPGYRPLLQACSTYIQHGEFPETDKDIYRDSPDNSWQSNYKSWTPSTVSCLDAGKLPSIFGDTLNEQLAIREGIYVEEKHYCSKIKSDCQRCLVDCAHNMINNLLTCKPTDSPADNGRSPRLELCFDCCAKENCSSVCDKYAQQRCAMHLCMSGPRMDLQLSPEWPKHDNFICHMKPSSLKPIFSLRWYLYKDNKKLTLDEFTEKMHFTEKPMGDQMSHKIKQVFKDLIHVTYSSNIHTLPNIISGTNDLQNAYIWNTERLPLTPGSA VKPGEKLSSIKVWPYLPMGVNSGYWSQLAKYDCNKASEIVDRLNVYTSEIPPYRQLQDLKVERISQYKYRLSNHRLASSLNFTIPARASLLSAIFTPTWVDREQFLSASLVYLGSDATQTENAFNGYWIVELIGQVNNFPGFFRLQLWSHDSKLLNVQNPLTDSYKISRDDSFPLLDYDIGVYDEKNFKIHLRILAPESQPDYDKSFIIKIIDIKGELEIMVHRSRQDPQMMIQIEKYRRTPDGKYSEEISILPEVMAVSREKSLKETSPFGIPPLVIYTVLAVLTICLLLLFIGHLTRKEEHLCEDIVFKSRHLVVFVIYLTLKAFYCFTVTTTTLLIVIVIYTREPYNQLTNHNSEYTNSTVAEKLLM KMDTYLERELSRQLAHVTQIKTLCDKRLMDYYQKMNQRLELVSAQAAKRRSRVLISQAVVERAQYELRNMVNQLTRNLEDFNRTAKIYMKRIQHDMKMTKKKLSESEWLEGARLIYQEVLRKRNEGTISKDDPTKSFLAWLKITGELPESPPQLTLPSSFPFPDWAELNIPVPEPRLGSGLDAEYGPEYKPFNIKEKDIELEHSIWSFYDLPDESSSKNNPGYKSDHESKYQSNPTVFKDANNEEKGMIYTETIESIYRILIQLSWCHLLTLTLLLDLLWFLHRAAHTIDTIEQIFYGYPCFIDCTIKGTRRKKRNENNFKFMLKRTFCEAMESSFVPKFCGSAFSLFIIYLLSTHLNELISEEALDFVGYYDNMALPTHLRNRFINTQIVQSAQQLNDYELGSYELFIHQRQSEIQDILNSWVDWTTQLEQYQCELLRLYKTDDSGKLIADILNKPDKVPIPTHCKMTTEERQKEIEKLIEFKMSVCPVSMIIPRLFTEYNETEVSLQIVKSSRHWLRWTRRWMDTVIHCLFGYISAIILWNTVGATIWFYVKRFSVIRQKRIYETDVQSIPLSTTESEMKSSALQ
Sbjct:    1 MHGNFLSSKDQLNNPDLTTNSCQLMNPLRYNSMVSCSTGIDTLTNQGNIGISDRMPFVLTGGFDDYPMDNVDVMNSLNATGSLDNYFNQGPLMVSTNTTSMSYSTLPLNFSMTHSSRCNAGMDNSNHYMTYNPTQMIRSTDSGKITVSTT----NPSYGINRHLAKDFLDENIIERIGMNFLSQISENDASHFNVEDMDAHNKQCPLDSMGMYQQLSRNTGQGSDETSGILSDSSGSTLDRPAQSSNAKISSGFSIVPSVINSGERFVSLDANDQRYIPLSDVIAEVANCPQHSYLIKAGQFQGVNMVQQIPMNQKSSCSPPMISVDWNIPSSSCGAQIPVYHGVQVHGAPIDRKLSSGTLNKSNIYQPVIVSEDSIFYTDKAKNVLISPVSGDQKTIIGGTLGRQNKNTPKPPRRDGTDKTSNIKEQQHLVDVNKTDTFEVDDECGEDDESGASTSPRSALKGSRHGPRVSKQLRFTTLGLLSFFTGMLICSVSGTNSRLSSSDITIINANYVIDDSAIPNITNNAIHQFSLDGNQFIQQIYQFIDLKLTVFIPSHLVDKNKSFQQNKIKSFQLYNNLSSNTMVKLGVFKRNSIDIYDMKNSLNILNQEVCRQRYSCSHSCDPGNGHRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECICDGEICKDCNEKCLTNYFKKNSCAQSKHLQCSKCTSECSPGYYISRKCTETSNIQCTACRPLCITGEFELSPCSGTSNRICKSRLSISGIELPDKKNVWYEDRRNLRDIHHIISLDEAAKLSQDKELILERESGYQIRLKFDSEITLQPLFEPVDHSVYNDNALFKINPSNYTLKYLCPYPMPPIYDLKMQMHYNVTTEVVNDRDLPGYRPLLQACSTYIQHGEFPETDKDIYRDSPDNSWQSNYKSWTPSTVSCLDAGKLPSIFGDTLNEQLAIREGIYVEEKHYCSKIKSDCQRCLVDCAHNMINNLLTCKPTDSPADNGRSPRLELCFDCCAKENCSSVCDKYAQQRCAMHLCMSGPRMDLQLSPEWPKHDNFICHMKPSSLKPIFSLRWYLYKDNKKLTLDEFTEKMHFTEKPMGDQMSHKIKQVFKDLIHVTYSSNIHTLPNIISGTNDLQNAYIWNTERLPLTPGSAPVKPGEKLSSIKVWPYLPMGVNSGYWSQLAKYDCNKASEIVDRLNVYTSEIPPYRQLQDLKVERISQYKYRLSNHRLASSLNFTIPARASLLSAIFTPTWVDREQFLSASLVYLGSDATQTENAFNGYWIVELIGQVNNFPGFFRLQLWSHDSKLLNVQNPLTDSYKISRDDSFPLLDYDIGVYDEKNFKIHLRILAPESQPDYDKSFIIKIIDIKGELEIMVHRSRQDPQMMIQIEKYRRTPDGKYSEEISILPEVMAVSREKSLKETSPFGIPPLVIYTVLAVLTICLLLLFIGHLTRKEEHLCEDIVFKSRHLVVFVIYLTLKAFYCFTVTTTTLLIVIVIYTREPYNQLTNHNSEYTNSTVAEKLLMYKMDTYLERELSRQLAHVTQIKTLCDKRLMDYYQKMNQRLELVSAQAAKRRSRVLISQAVVERAQYELRNMVNQLTRNLEDFNRTAKIYMKRIQHDMKMTKKKLSESEWLEGARLIYQEVLRKRNEGTISKDDPTKSFLAWLKITGELPESPPQLTLPSSFPFPDWAELNIPVPEPRLGSGLDAEYGPEYKPFNIKEKDIELEHSIWSFYDLPDESSSKNNPGYKSDHESKYQSNPTVFKDANNEEKGMIYTETIESIYRILIQLSWCHLLTLTLLLDLLWFLHRAAHTIDTIEQIFYGYPCFIDCTIKGTRRKKRNENNFKFMLKRTFCEAMESSFVPKFCGSAFSLFIIYLLSTHLNELISEEALDFVGYYDNMALPTHLRNRFINTQIVQSAQQLNDYELGSYELFIHQRQSEIQDILNSWVDWTTQLEQYQCELLRLYKTDDSGKLIADILNKPDKVPIPTHCKMTTEERQKEIEKLIEFKMSVCPVSMIIPRLFTEYNETEVSLQIVKSSRHWLRWTRRWMDTVIHCLFGYISAIILWNTVGATIWFYVKRFSVIRQKRIYETDVQSIPLSTTESEMKSSALQ 2103          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Planmine SMEST
Match: SMESG000065173.1 (SMESG000065173.1)

HSP 1 Score: 4232.17 bits (10975), Expect = 0.000e+0
Identity = 2091/2105 (99.33%), Postives = 2093/2105 (99.43%), Query Frame = 2
Query:  572 MHGNFLSSKDQLNNPDLTTNSCQLMNPLRYNSMVSCSTGIDTLTNQGNIGISDRMPFVLTGGFDDYPMDNVDVMNSLNATGSLDNYFNQGPLMVSTNTTSMSYSTLPLNFSMTHSSRCNAGMDNSNHYMTYNPTQMIRSTDSGKITVSTTKFVSDPSYGINRHLAKDFLDENIIERIGMNFLSQISENDASHFNVEDMDAHNKQCPLDSMGMYQQLSRNTGQGSDETSGILSDSSGSTLDRPAQSSNAKISSGFSIVPSVINSGERFVSLDANDQRYIPLSDVIAEVANCPQHSYLIKAGQFQGVNMVQQIPMNQKSSCSPPMISVDWNIPSSSCGAQIPVYHGVQVHGAPIDRKLSSGTLNKSNIYQPVIVSEDSIFYTDKAKNVLISPVSGDQKNIIGGTLGRQNKNTPKPPRRDGTDKTSNIKEQQHLVDVNKTDTFEVDDECGEDDESGASTSPRSALKGSRHGPRVSKQFTTLGLLSFFTGMLICSVSGTNSRLSSSDITIINANYVIDDSAIPNITNNAIHQFSLDGNQFIQQIYQFIDLKLTVFIPSHLVDKNKSFKQNKIKSFQLYNNLSSNTMVKLGVFKRNSIDIYDMKNSLNILNQEVCRQRYSCSHSCDPGNGHRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECICDGEICKDCNEKCLTNYFKKNSCAQSKHLQCSKCTSECSPGYYISRKCTETSNIQCTACRPLCITGEFELSPCSGTSNRICKSRLSISGIELPDKKNVWYEDRRNLRDIHHIISLDEAAKLSQDKELILERESGYQIRLKFDSEITLQPLFEPVDHSVYNDNALFKINPSNYTLKYLCPYPMPPIYDLKMQMHYNVTTEVVNDRDLPGYRPLLQACSTYIQHGEFPETDKDIYRDSPDNSWQSNYKSWTPSTVSCLDAGKLPSIFGDTLNEQLAIREGIYVEEKHYCSKIKSDCQRCLVDCAHNMINNLLTCKPTDSPADNGRSPRLELCFDCCAKENCSSVCDKYAQQRCAMHLCMSGPRMDLQLSPEWPKHDNFICHMKPSSLKPIFSLRWYLYKDNKKLTLDEFTEKMHFTEKPMGDQMSHKIKQVFKDLIHVTYSSNIHTLPNIISGTNDLQNAYIWNTERLPLTPGSASVKPGEKLSSIKVWPYLPMGVNSGYWSQLAKYDCNKASEIVDRLNVYTSEIPPYRQLQDLKVERISQYKYRLSNHRLASSLNFTIPARASLLSAIFTPTWVDREQFLSASLVYLGSDATQTENAFNGYWIVELIGQVNNFPGFFRLQLWSHDSKLLNVQNPLTDSYKISRDDSFPLLDYDIGVYDEKNFKIHLRILAPESQPXXXXXXXXXXXXXXGELEIMVHRSRQDPQMMIQIEKYRRTPDGKYSEEISILPEVMAVSREKSLKETSPFGIPPLVIYTVXXXXXXXXXXXXXXXXTRKEEHLCEDIVFKSRHLVVFVIYLTLKAFYCFXXXXXXXXXXXXXYTREPYNQLTNHNSEYTNSTVAEKLLMDKMDTYLERELSRQLAHVTQIKTLCDKRLMDYYQKMNQRLELVSAQAAKRRSRVLISQAVVERAQYELRNMVNQLTRNLEDFNRTAKIYMKRIQHDMKMTKKKLSESEWLEGARLIYQEVLRKRNEGTISKDDPTKSFLAWLKITGELPESPPQLTLPSSFPFPDWAELNIPVPEPRLGSGLDAEYGPEYKPFNIKEKDIELEHSIWSFYDLPDESSSKNNPGYKSDHESKYQSNPTVFKDANNEEKGMIYTETIESIYRILIQLSWCHXXXXXXXXXXXWFLHRAAHTIDTIEQIFYGYPCFIDCTIKGTRRKKRNENNFKFMLKRTFCEAMESSFVPKFCGSAFSLFIIYLLSTHLNELISEEALDFVGYYDNMALPTHLRNRFINTQIVQSAQQLNDYELGSYELFIHQRQSEIQDILNSWVDWTTQLEQYQCELLRLYKTDDSGKLIADILNKPDKVPIPTHCKMTTEERQKEIEKLIEFKMSVCPVSMIIPRLFTEYNETEVSLQIVKSSRHWLRWTRRWMDTVIHCLFGYISAIILWNTVGATIWFYVKRFSVIRQKRIYETDVQSIPLSTTESEMKSSALQ 6886
            MHGNFLSSKDQLNNPDLTTNSCQLMNPLRYNSMVSCSTGIDTLTNQGNIGISDRMPFVLTGGFDDYPMDNVDVMNSLNATGSLDNYFNQGPLMVSTNTTSMSYSTLPLNFSMTHSSRCNAGMDNSNHYMTYNPTQMIRSTDSGKITVSTT    +PSYGINRHLAKDFLDENIIERIGMNFLSQISENDASHFNVEDMDAHNKQCPLDSMGMYQQLSRNTGQGSDETSGILSDSSGSTLDRPAQ     ISSGFSIVPSVINSGERFVSLDANDQRYIPLSDVIAEVANCPQHSYLIKAGQFQGVNMVQQIPMNQKSSCSPPMISVDWNIPSSSCGAQIPVYHGVQVHGAPIDRKLSSGTLNKSNIYQPVIVSEDSIFYTDKAKNVLISPVSGDQK IIGGTLGRQNKNTPKPPRRDGTDKTSNIKEQQHLVDVNKTDTFEVDDECGEDDESGASTSPRSALKGSRHGPRVSKQFTTLGLLSFFTGMLICSVSGTNSRLSSSDITIINANYVIDDSAIPNITNNAIHQFSLDGNQFIQQIYQFIDLKLTVFIPSHLVDKNKSF+QNKIKSFQLYNNLSSNTMVKLGVFKRNSIDIYDMKNSLNILNQEVCRQRYSCSHSCDPGNGHRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECICDGEICKDCNEKCLTNYFKKNSCAQSKHLQCSKCTSECSPGYYISRKCTETSNIQCTACRPLCITGEFELSPCSGTSNRICKSRLSISGIELPDKKNVWYEDRRNLRDIHHIISLDEAAKLSQDKELILERESGYQIRLKFDSEITLQPLFEPVDHSVYNDNALFKINPSNYTLKYLCPYPMPPIYDLKMQMHYNVTTEVVNDRDLPGYRPLLQACSTYIQHGEFPETDKDIYRDSPDNSWQSNYKSWTPSTVSCLDAGKLPSIFGDTLNEQLAIREGIYVEEKHYCSKIKSDCQRCLVDCAHNMINNLLTCKPTDSPADNGRSPRLELCFDCCAKENCSSVCDKYAQQRCAMHLCMSGPRMDLQLSPEWPKHDNFICHMKPSSLKPIFSLRWYLYKDNKKLTLDEFTEKMHFTEKPMGDQMSHKIKQVFKDLIHVTYSSNIHTLPNIISGTNDLQNAYIWNTERLPLTPGSA VKPGEKLSSIKVWPYLPMGVNSGYWSQLAKYDCNKASEIVDRLNVYTSEIPPYRQLQDLKVERISQYKYRLSNHRLASSLNFTIPARASLLSAIFTPTWVDREQFLSASLVYLGSDATQTENAFNGYWIVELIGQVNNFPGFFRLQLWSHDSKLLNVQNPLTDSYKISRDDSFPLLDYDIGVYDEKNFKIHLRILAPESQPDYDKSFIIKIIDIKGELEIMVHRSRQDPQMMIQIEKYRRTPDGKYSEEISILPEVMAVSREKSLKETSPFGIPPLVIYTVLAVLTICLLLLFIGHLTRKEEHLCEDIVFKSRHLVVFVIYLTLKAFYCFTVTTTTLLIVIVIYTREPYNQLTNHNSEYTNSTVAEKLLM KMDTYLERELSRQLAHVTQIKTLCDKRLMDYYQKMNQRLELVSAQAAKRRSRVLISQAVVERAQYELRNMVNQLTRNLEDFNRTAKIYMKRIQHDMKMTKKKLSESEWLEGARLIYQEVLRKRNEGTISKDDPTKSFLAWLKITGELPESPPQLTLPSSFPFPDWAELNIPVPEPRLGSGLDAEYGPEYKPFNIKEKDIELEHSIWSFYDLPDESSSKNNPGYKSDHESKYQSNPTVFKDANNEEKGMIYTETIESIYRILIQLSWCHLLTLTLLLDLLWFLHRAAHTIDTIEQIFYGYPCFIDCTIKGTRRKKRNENNFKFMLKRTFCEAMESSFVPKFCGSAFSLFIIYLLSTHLNELISEEALDFVGYYDNMALPTHLRNRFINTQIVQSAQQLNDYELGSYELFIHQRQSEIQDILNSWVDWTTQLEQYQCELLRLYKTDDSGKLIADILNKPDKVPIPTHCKMTTEERQKEIEKLIEFKMSVCPVSMIIPRLFTEYNETEVSLQIVKSSRHWLRWTRRWMDTVIHCLFGYISAIILWNTVGATIWFYVKRFSVIRQKRIYETDVQSIPLSTTESEMKSSALQ
Sbjct:    1 MHGNFLSSKDQLNNPDLTTNSCQLMNPLRYNSMVSCSTGIDTLTNQGNIGISDRMPFVLTGGFDDYPMDNVDVMNSLNATGSLDNYFNQGPLMVSTNTTSMSYSTLPLNFSMTHSSRCNAGMDNSNHYMTYNPTQMIRSTDSGKITVSTT----NPSYGINRHLAKDFLDENIIERIGMNFLSQISENDASHFNVEDMDAHNKQCPLDSMGMYQQLSRNTGQGSDETSGILSDSSGSTLDRPAQ-----ISSGFSIVPSVINSGERFVSLDANDQRYIPLSDVIAEVANCPQHSYLIKAGQFQGVNMVQQIPMNQKSSCSPPMISVDWNIPSSSCGAQIPVYHGVQVHGAPIDRKLSSGTLNKSNIYQPVIVSEDSIFYTDKAKNVLISPVSGDQKTIIGGTLGRQNKNTPKPPRRDGTDKTSNIKEQQHLVDVNKTDTFEVDDECGEDDESGASTSPRSALKGSRHGPRVSKQFTTLGLLSFFTGMLICSVSGTNSRLSSSDITIINANYVIDDSAIPNITNNAIHQFSLDGNQFIQQIYQFIDLKLTVFIPSHLVDKNKSFQQNKIKSFQLYNNLSSNTMVKLGVFKRNSIDIYDMKNSLNILNQEVCRQRYSCSHSCDPGNGHRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECICDGEICKDCNEKCLTNYFKKNSCAQSKHLQCSKCTSECSPGYYISRKCTETSNIQCTACRPLCITGEFELSPCSGTSNRICKSRLSISGIELPDKKNVWYEDRRNLRDIHHIISLDEAAKLSQDKELILERESGYQIRLKFDSEITLQPLFEPVDHSVYNDNALFKINPSNYTLKYLCPYPMPPIYDLKMQMHYNVTTEVVNDRDLPGYRPLLQACSTYIQHGEFPETDKDIYRDSPDNSWQSNYKSWTPSTVSCLDAGKLPSIFGDTLNEQLAIREGIYVEEKHYCSKIKSDCQRCLVDCAHNMINNLLTCKPTDSPADNGRSPRLELCFDCCAKENCSSVCDKYAQQRCAMHLCMSGPRMDLQLSPEWPKHDNFICHMKPSSLKPIFSLRWYLYKDNKKLTLDEFTEKMHFTEKPMGDQMSHKIKQVFKDLIHVTYSSNIHTLPNIISGTNDLQNAYIWNTERLPLTPGSAPVKPGEKLSSIKVWPYLPMGVNSGYWSQLAKYDCNKASEIVDRLNVYTSEIPPYRQLQDLKVERISQYKYRLSNHRLASSLNFTIPARASLLSAIFTPTWVDREQFLSASLVYLGSDATQTENAFNGYWIVELIGQVNNFPGFFRLQLWSHDSKLLNVQNPLTDSYKISRDDSFPLLDYDIGVYDEKNFKIHLRILAPESQPDYDKSFIIKIIDIKGELEIMVHRSRQDPQMMIQIEKYRRTPDGKYSEEISILPEVMAVSREKSLKETSPFGIPPLVIYTVLAVLTICLLLLFIGHLTRKEEHLCEDIVFKSRHLVVFVIYLTLKAFYCFTVTTTTLLIVIVIYTREPYNQLTNHNSEYTNSTVAEKLLMYKMDTYLERELSRQLAHVTQIKTLCDKRLMDYYQKMNQRLELVSAQAAKRRSRVLISQAVVERAQYELRNMVNQLTRNLEDFNRTAKIYMKRIQHDMKMTKKKLSESEWLEGARLIYQEVLRKRNEGTISKDDPTKSFLAWLKITGELPESPPQLTLPSSFPFPDWAELNIPVPEPRLGSGLDAEYGPEYKPFNIKEKDIELEHSIWSFYDLPDESSSKNNPGYKSDHESKYQSNPTVFKDANNEEKGMIYTETIESIYRILIQLSWCHLLTLTLLLDLLWFLHRAAHTIDTIEQIFYGYPCFIDCTIKGTRRKKRNENNFKFMLKRTFCEAMESSFVPKFCGSAFSLFIIYLLSTHLNELISEEALDFVGYYDNMALPTHLRNRFINTQIVQSAQQLNDYELGSYELFIHQRQSEIQDILNSWVDWTTQLEQYQCELLRLYKTDDSGKLIADILNKPDKVPIPTHCKMTTEERQKEIEKLIEFKMSVCPVSMIIPRLFTEYNETEVSLQIVKSSRHWLRWTRRWMDTVIHCLFGYISAIILWNTVGATIWFYVKRFSVIRQKRIYETDVQSIPLSTTESEMKSSALQ 2096          
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Planmine SMEST
Match: SMESG000065173.1 (SMESG000065173.1)

HSP 1 Score: 317.775 bits (813), Expect = 2.519e-99
Identity = 154/155 (99.35%), Postives = 155/155 (100.00%), Query Frame = 2
Query:   44 MSFYKKQLTLIDEEELLGDYSTGKYPTNVIIQNPFKGTIEFLESESDKFQILINASYNSEIYSSEDIVKFNLNKHGDSLNIKLMTDVVESTVYRSTSFINDNNQKSSEFLPLYLLITCISILVSLTFVFSIFFAYWWNKNKRPHITRPLQYKIDT 508
            MSFYKKQLTLIDEEELLGDYSTGKYPTNVIIQNPFKGTIEFLESESDKFQILINASYNSEIYSSEDIVKFNLNKHGDSLNIKLMTDVVESTVYRSTSFINDNNQKSSEFLPLY+LITCISILVSLTFVFSIFFAYWWNKNKRPHITRPLQYKIDT
Sbjct:    1 MSFYKKQLTLIDEEELLGDYSTGKYPTNVIIQNPFKGTIEFLESESDKFQILINASYNSEIYSSEDIVKFNLNKHGDSLNIKLMTDVVESTVYRSTSFINDNNQKSSEFLPLYVLITCISILVSLTFVFSIFFAYWWNKNKRPHITRPLQYKIDT 155          
The following BLAST results are available for this feature:
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HMCN13.157e-1031.29hemicentin 1 [Source:HGNC Symbol;Acc:HGNC:19194][more]
HMCN21.327e-941.46hemicentin 2 [Source:HGNC Symbol;Acc:HGNC:21293][more]
SCUBE24.687e-833.54signal peptide, CUB domain and EGF like domain con... [more]
SCUBE25.898e-833.54signal peptide, CUB domain and EGF like domain con... [more]
SCUBE26.097e-833.54signal peptide, CUB domain and EGF like domain con... [more]
back to top
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fbl-18.558e-727.08Fibulin-1 [Source:UniProtKB/Swiss-Prot;Acc:O77469... [more]
fbl-19.438e-754.17Fibulin-1 [Source:UniProtKB/Swiss-Prot;Acc:O77469... [more]
fbl-19.647e-727.16Fibulin-1 [Source:UniProtKB/Swiss-Prot;Acc:O77469... [more]
fbl-11.363e-654.17Fibulin-1 [Source:UniProtKB/Swiss-Prot;Acc:O77469... [more]
mec-12.471e-638.75pep chromosome:WBcel235:V:6956537:6961338:1 gene:W... [more]
back to top
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
frac7.384e-636.90gene:FBgn0035798 transcript:FBtr0331840[more]
frac7.384e-636.90gene:FBgn0035798 transcript:FBtr0331839[more]
back to top
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hmcn16.439e-1030.88hemicentin 1 [Source:ZFIN;Acc:ZDB-GENE-041014-322][more]
hmcn16.439e-1030.88hemicentin 1 [Source:ZFIN;Acc:ZDB-GENE-041014-322][more]
scube24.848e-834.56signal peptide, CUB domain, EGF-like 2 [Source:NCB... [more]
scube11.794e-734.56signal peptide, CUB domain, EGF-like 1 [Source:ZFI... [more]
hmcn22.226e-727.66hemicentin 2 [Source:ZFIN;Acc:ZDB-GENE-030131-9765... [more]
back to top
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000024069.13.563e-930.53hemicentin 2 [Source:NCBI gene;Acc:100490941][more]
SCUBE11.845e-835.29signal peptide, CUB domain, EGF-like 1 [Source:NCB... [more]
SCUBE11.925e-835.29signal peptide, CUB domain, EGF-like 1 [Source:NCB... [more]
SCUBE12.158e-835.29signal peptide, CUB domain, EGF-like 1 [Source:NCB... [more]
SCUBE12.579e-835.29signal peptide, CUB domain, EGF-like 1 [Source:NCB... [more]
back to top
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hmcn21.572e-939.76hemicentin 2 [Source:MGI Symbol;Acc:MGI:2677838][more]
Hmcn14.141e-929.93hemicentin 1 [Source:MGI Symbol;Acc:MGI:2685047][more]
Hmcn14.396e-929.93hemicentin 1 [Source:MGI Symbol;Acc:MGI:2685047][more]
Nid23.323e-834.58nidogen 2 [Source:MGI Symbol;Acc:MGI:1298229][more]
Nid26.629e-834.58nidogen 2 [Source:MGI Symbol;Acc:MGI:1298229][more]
back to top
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96RW7|HMCN1_HUMAN1.491e-931.29Hemicentin-1 OS=Homo sapiens OX=9606 GN=HMCN1 PE=1... [more]
sp|Q8NDA2|HMCN2_HUMAN6.374e-941.46Hemicentin-2 OS=Homo sapiens OX=9606 GN=HMCN2 PE=2... [more]
sp|A2AJ76|HMCN2_MOUSE1.100e-839.76Hemicentin-2 OS=Mus musculus OX=10090 GN=Hmcn2 PE=... [more]
sp|D3YXG0|HMCN1_MOUSE3.075e-829.93Hemicentin-1 OS=Mus musculus OX=10090 GN=Hmcn1 PE=... [more]
sp|B5DFC9|NID2_RAT1.686e-728.96Nidogen-2 OS=Rattus norvegicus OX=10116 GN=Nid2 PE... [more]
back to top
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A074Z1E70.000e+033.27Uncharacterized protein (Fragment) OS=Opisthorchis... [more]
A0A4S2LLF90.000e+033.49Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A1S8X1B70.000e+032.36Calcium binding EGF domain protein (Fragment) OS=O... [more]
G7YIX40.000e+033.76Uncharacterized protein OS=Clonorchis sinensis OX=... [more]
A0A3Q0KR772.106e-10132.32Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
back to top
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scube21.255e-835.29signal peptide, CUB domain, EGF-like 2 [Source:NCB... [more]
scube21.937e-835.29signal peptide, CUB domain, EGF-like 2 [Source:NCB... [more]
nid2a3.212e-836.47nidogen 2a (osteonidogen) [Source:ZFIN;Acc:ZDB-GEN... [more]
scube34.513e-833.82signal peptide, CUB and EGF-like domain-containing... [more]
thbd8.134e-851.56thrombomodulin [Source:NCBI gene;Acc:103037465][more]
back to top
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000000328.13.277e-843.18pep scaffold:Pmarinus_7.0:GL477118:5217:33136:-1 g... [more]
ENSPMAT00000005512.14.959e-848.39pep scaffold:Pmarinus_7.0:GL476588:676692:709720:-... [more]
ENSPMAT00000010139.11.973e-630.82pep scaffold:Pmarinus_7.0:GL476784:79088:131893:1 ... [more]
ENSPMAT00000002704.14.160e-650.00pep scaffold:Pmarinus_7.0:GL476354:513769:588114:-... [more]
back to top
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO288203.267e-752.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO267431.626e-643.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO347022.191e-643.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO257007.044e-643.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
back to top
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scube21.208e-929.66signal peptide, CUB domain and EGF like domain con... [more]
hmcn15.397e-837.37hemicentin 1 [Source:NCBI gene;Acc:101172646][more]
scube13.058e-733.58signal peptide, CUB and EGF-like domain-containing... [more]
scube14.868e-733.58signal peptide, CUB and EGF-like domain-containing... [more]
scube16.500e-733.58signal peptide, CUB and EGF-like domain-containing... [more]
back to top
BLAST of TNFR CD27 30 40 95 cysteine rich region vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000065173.10.000e+099.26SMESG000065173.1[more]
SMESG000065173.10.000e+098.03SMESG000065173.1[more]
SMESG000065173.10.000e+099.48SMESG000065173.1[more]
SMESG000065173.10.000e+099.33SMESG000065173.1[more]
SMESG000065173.12.519e-9999.35SMESG000065173.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022087 ID=SMED30022087|Name=TNFR CD27 30 40 95 cysteine rich region|organism=Schmidtea mediterranea sexual|type=transcript|length=6980bp
TAATTTAGTTATCATTTAATGATTAAATAAATAACAAAACTAAATGTCAT
TTTATAAAAAGCAACTAACGCTTATTGATGAAGAGGAATTATTGGGTGAT
TATTCAACTGGAAAATATCCAACCAATGTGATAATTCAAAATCCTTTTAA
AGGAACTATTGAATTCCTTGAATCGGAGAGTGATAAGTTCCAGATTCTTA
TTAATGCTAGCTATAATTCTGAGATTTATTCTAGTGAAGATATTGTTAAA
TTTAATCTAAACAAGCATGGTGACAGTTTAAATATTAAATTAATGACTGA
CGTCGTCGAATCTACGGTTTATCGTTCGACTTCGTTTATTAATGATAACA
ATCAAAAATCGTCAGAATTTCTACCTCTTTACCTGTTGATTACTTGCATT
TCGATTTTGGTATCTCTTACATTTGTTTTTTCGATTTTCTTTGCATATTG
GTGGAATAAAAATAAGCGGCCTCATATTACTCGACCGTTGCAGTACAAAA
TCGACACAGATTCAACGAAGCATCCTCTACTTATCAGCGAGCCTAATACG
CCTCATCTCCTTCACAATCAGATGCATGGCAACTTTTTATCGAGCAAGGA
TCAACTTAATAATCCTGATCTGACCACTAACAGCTGTCAGTTAATGAATC
CTCTGAGATACAATTCTATGGTTTCTTGCAGTACTGGCATAGATACTCTG
ACTAACCAGGGAAATATTGGTATCAGCGACCGTATGCCATTCGTGTTAAC
AGGCGGGTTTGATGATTATCCCATGGATAATGTCGATGTAATGAATTCGT
TGAACGCCACTGGCTCTTTGGATAATTATTTTAATCAGGGTCCTTTAATG
GTGTCAACAAACACAACATCAATGAGTTATTCGACACTGCCTCTGAATTT
CAGCATGACCCACAGTAGTAGATGCAACGCTGGCATGGACAATTCCAATC
ATTATATGACGTATAATCCTACTCAAATGATCCGATCTACTGATTCTGGG
AAAATTACAGTTTCTACTACAAAATTTGTTTCAGATCCCTCATATGGCAT
TAATAGACATTTAGCTAAAGATTTCCTCGATGAAAATATTATTGAAAGGA
TCGGCATGAACTTTCTTTCTCAGATTTCAGAGAATGACGCTTCGCACTTC
AATGTTGAAGATATGGACGCTCATAATAAACAATGTCCGTTAGACAGCAT
GGGTATGTATCAACAGTTATCTAGAAATACAGGTCAAGGTAGTGACGAAA
CCAGTGGCATTCTATCTGATTCCAGTGGCAGTACACTCGATAGACCAGCG
CAATCTTCTAATGCCAAGATTTCTTCTGGATTCTCTATTGTGCCGTCTGT
AATCAATTCCGGAGAGCGTTTTGTTTCGCTAGATGCCAATGATCAACGAT
ATATTCCTTTGTCTGATGTAATCGCTGAAGTTGCCAATTGTCCTCAGCAT
AGTTATCTTATTAAAGCTGGCCAGTTTCAAGGAGTAAATATGGTTCAGCA
GATTCCGATGAATCAGAAATCGTCTTGCTCACCTCCAATGATATCAGTGG
ACTGGAATATTCCTTCTAGTAGTTGTGGAGCTCAGATACCTGTTTACCAT
GGTGTTCAAGTTCACGGTGCCCCAATAGATCGTAAGTTGAGCTCAGGGAC
ACTTAATAAATCAAATATTTATCAGCCTGTGATTGTATCCGAGGATTCCA
TTTTCTATACAGACAAAGCAAAAAATGTTTTAATTAGTCCAGTAAGTGGA
GATCAGAAAAATATTATTGGAGGAACATTGGGACGGCAGAATAAGAACAC
ACCAAAACCTCCTAGGCGAGATGGTACTGATAAGACTAGTAATATTAAGG
AGCAACAGCATCTCGTAGATGTTAATAAAACTGATACTTTTGAAGTAGAT
GATGAATGTGGAGAAGATGATGAGTCAGGAGCCTCTACAAGTCCTCGATC
GGCTCTAAAAGGGTCACGGCATGGCCCTCGAGTCAGCAAACAGTTTACCA
CCCTTGGTTTACTGTCTTTTTTCACTGGAATGCTGATCTGTTCCGTGTCT
GGAACGAATTCCCGACTCAGTTCCTCGGACATTACAATTATCAATGCCAA
CTATGTGATAGATGACAGTGCTATACCAAATATCACTAACAATGCTATCC
ACCAATTTTCACTTGATGGCAATCAATTCATCCAACAAATTTACCAGTTC
ATTGATCTGAAATTGACAGTTTTTATACCGTCTCATCTTGTTGATAAAAA
TAAGTCTTTTAAACAAAATAAAATCAAATCGTTCCAACTATACAACAACC
TTTCAAGTAATACAATGGTAAAATTGGGAGTATTCAAAAGGAATTCAATT
GATATTTATGACATGAAGAATAGTTTGAATATTCTCAATCAGGAAGTGTG
TCGTCAACGGTATTCATGTAGCCATTCTTGTGATCCAGGAAATGGCCACA
GATGCACTTGCCAAAGGGGTTTTGCATTAGAATCTGATGGGAAAACTTGT
ATGGACATCAATGAGTGCAACACCAATTTGAATATTTGCGGTAAATATGG
AGGTACTTGTGTTAATATTCTCGGTTCATACGAATGCATTTGTGATGGAG
AAATTTGTAAAGATTGCAACGAAAAGTGCCTGACCAATTATTTTAAAAAA
AATAGCTGTGCACAATCTAAACATCTTCAGTGCTCGAAATGTACAAGTGA
ATGTTCTCCTGGATATTACATCTCGAGGAAATGCACGGAAACTTCAAACA
TTCAATGCACTGCCTGTCGTCCTCTCTGTATCACTGGAGAATTTGAGTTA
TCTCCTTGTTCTGGTACTTCAAACAGAATTTGTAAATCGAGGTTAAGCAT
TTCAGGAATAGAATTACCGGATAAAAAAAATGTTTGGTATGAAGACAGGC
GCAATTTGCGCGATATACATCATATCATTTCGTTAGACGAAGCTGCTAAA
TTGTCCCAAGATAAAGAGCTCATCCTTGAAAGGGAAAGCGGTTACCAAAT
TCGTTTGAAATTTGATAGCGAGATTACTCTTCAACCTTTATTTGAGCCGG
TTGACCATTCCGTATATAATGATAACGCCTTGTTCAAGATTAATCCTAGC
AATTATACTCTGAAGTATTTATGTCCTTATCCAATGCCTCCGATTTACGA
TTTGAAAATGCAAATGCATTATAATGTGACTACTGAGGTTGTCAATGATC
GAGACCTTCCAGGTTATCGACCACTTCTACAAGCGTGTTCAACATATATC
CAACATGGAGAATTCCCAGAAACTGATAAAGATATTTATCGTGATTCTCC
TGATAATTCCTGGCAGAGCAATTATAAATCCTGGACACCGTCAACGGTAT
CTTGTCTGGATGCTGGAAAGCTACCATCAATTTTCGGGGATACTCTAAAT
GAACAACTGGCTATACGAGAAGGAATTTATGTAGAAGAAAAGCATTATTG
TTCAAAGATTAAATCCGATTGCCAGCGATGTCTGGTGGATTGTGCTCATA
ATATGATTAATAATTTGTTAACATGTAAACCAACTGATAGTCCAGCCGAC
AATGGAAGGAGTCCAAGGTTGGAGCTTTGTTTCGACTGCTGTGCTAAAGA
AAATTGCTCATCAGTTTGTGATAAATATGCCCAGCAGCGATGTGCAATGC
ACTTATGTATGTCAGGACCAAGAATGGATTTACAACTGTCTCCAGAATGG
CCTAAACACGACAATTTCATTTGTCACATGAAACCCAGTTCATTGAAACC
CATATTTTCTCTACGGTGGTATTTATACAAAGACAATAAAAAGCTAACAT
TAGATGAGTTTACCGAGAAGATGCATTTTACAGAAAAGCCTATGGGCGAT
CAAATGAGCCACAAAATAAAACAAGTGTTTAAAGACCTCATTCATGTCAC
ATACTCTTCTAATATCCACACGCTTCCCAATATTATTAGTGGTACCAACG
ATTTGCAAAATGCATACATTTGGAATACAGAAAGACTGCCTTTAACTCCT
GGAAGTGCCTCTGTTAAACCGGGAGAGAAATTGTCTAGTATTAAGGTATG
GCCATATCTTCCCATGGGGGTAAACAGTGGCTATTGGAGTCAACTGGCAA
AATACGATTGCAACAAAGCAAGTGAAATAGTTGACAGATTAAATGTTTAC
ACAAGTGAAATTCCTCCCTATCGTCAATTGCAAGATTTAAAAGTTGAAAG
AATTTCTCAGTATAAATATCGACTATCTAATCATCGTTTGGCGTCCAGTC
TCAATTTCACGATACCTGCAAGAGCCTCGTTGCTTAGTGCTATTTTCACT
CCAACATGGGTCGATCGGGAGCAGTTCCTTTCTGCCAGTTTGGTCTACCT
AGGATCAGATGCCACTCAAACCGAAAATGCATTCAATGGCTACTGGATAG
TTGAGTTGATTGGACAAGTTAATAATTTTCCTGGATTCTTCCGACTTCAA
CTCTGGAGTCACGACAGTAAACTGTTAAACGTACAAAATCCTTTAACTGA
TTCGTACAAAATTTCTCGAGATGACAGCTTTCCATTGCTGGATTATGATA
TCGGAGTTTATGATGAAAAGAATTTCAAAATTCATTTGCGCATTCTGGCA
CCAGAATCTCAACCGGACTATGATAAATCATTTATCATAAAAATTATTGA
CATTAAAGGAGAATTAGAAATTATGGTTCATAGATCAAGACAAGATCCTC
AAATGATGATTCAAATTGAGAAATACAGACGCACTCCAGATGGAAAATAT
TCCGAAGAGATTTCTATATTACCGGAAGTTATGGCCGTTAGTCGTGAGAA
GAGTTTAAAGGAAACTTCTCCTTTCGGTATTCCTCCATTAGTTATATACA
CTGTTCTTGCCGTTCTGACCATCTGTTTGCTGCTGTTGTTCATTGGTCAT
CTAACGAGGAAAGAGGAGCACCTCTGTGAGGACATTGTATTTAAGAGTCG
GCATTTGGTCGTATTTGTCATCTATTTGACTCTTAAGGCTTTTTACTGTT
TTACAGTTACAACGACGACTCTTCTAATCGTCATTGTTATATATACTAGA
GAACCCTATAATCAACTGACAAATCACAACAGTGAATATACTAACAGTAC
AGTAGCGGAGAAATTATTGATGGACAAAATGGACACATATTTGGAAAGGG
AATTATCCCGTCAGTTGGCACATGTGACGCAAATCAAAACTTTATGTGAT
AAGCGATTAATGGACTATTATCAAAAAATGAATCAAAGACTGGAATTAGT
ATCTGCTCAAGCTGCTAAACGGCGATCTAGAGTTCTTATTTCTCAAGCTG
TTGTAGAACGTGCTCAGTATGAATTAAGAAATATGGTAAATCAACTAACC
CGTAATTTGGAAGATTTTAATAGAACTGCCAAAATTTATATGAAAAGAAT
TCAGCATGATATGAAAATGACAAAGAAGAAATTGTCTGAAAGTGAATGGC
TAGAAGGGGCTAGATTAATTTATCAAGAAGTATTACGAAAGAGAAACGAA
GGAACTATTTCAAAAGACGATCCAACAAAAAGTTTTTTAGCTTGGCTTAA
AATTACTGGTGAATTGCCTGAATCACCACCCCAGTTGACATTGCCCAGTT
CTTTTCCATTTCCAGATTGGGCGGAATTGAATATACCAGTTCCTGAACCC
AGACTTGGAAGTGGTCTTGATGCTGAATACGGACCGGAATACAAGCCTTT
TAATATCAAGGAAAAAGATATTGAACTCGAACACTCTATTTGGTCATTCT
ATGATCTCCCTGACGAGTCTTCGTCGAAAAATAATCCTGGATATAAGAGT
GATCATGAATCAAAATATCAGTCTAATCCGACTGTCTTCAAAGATGCCAA
CAATGAAGAGAAGGGAATGATATATACGGAAACGATCGAATCAATCTATC
GAATTCTAATTCAATTATCGTGGTGCCATCTTTTGACATTGACACTTTTA
CTTGATCTTTTATGGTTTCTCCATAGAGCTGCACATACAATTGATACAAT
TGAACAGATTTTCTATGGCTACCCATGCTTTATAGATTGTACCATTAAAG
GAACAAGGCGAAAGAAAAGAAATGAAAATAACTTCAAATTTATGCTTAAA
CGAACATTTTGTGAGGCCATGGAATCATCGTTTGTTCCCAAATTCTGTGG
CTCTGCTTTCTCTTTGTTTATTATTTATCTTTTATCCACGCATCTGAACG
AATTGATCTCTGAGGAAGCGTTGGATTTTGTCGGCTATTATGACAATATG
GCGTTACCTACTCATTTGCGAAATCGGTTTATAAATACGCAAATAGTCCA
ATCAGCACAGCAATTGAATGATTATGAACTGGGTTCATATGAATTGTTTA
TTCACCAGCGGCAATCGGAAATTCAGGATATTCTCAACTCGTGGGTGGAT
TGGACAACACAATTAGAGCAATATCAGTGTGAACTGCTCAGGCTTTACAA
AACTGATGATTCTGGTAAACTGATAGCCGATATTTTAAATAAACCAGATA
AGGTTCCTATACCTACCCACTGCAAAATGACGACAGAAGAAAGACAGAAA
GAAATTGAAAAGTTGATAGAATTCAAGATGTCAGTTTGCCCGGTTTCAAT
GATTATTCCACGGCTGTTCACAGAGTACAACGAGACAGAGGTATCGTTGC
AAATCGTTAAATCGTCTCGACATTGGTTGCGATGGACGCGTCGATGGATG
GACACAGTTATTCATTGTTTATTCGGCTACATATCTGCAATTATTCTCTG
GAACACTGTCGGAGCAACAATTTGGTTTTATGTGAAAAGATTCTCTGTAA
TTCGTCAGAAAAGAATTTATGAAACTGATGTTCAGTCTATTCCGCTGTCG
ACAACAGAATCGGAAATGAAATCTTCAGCTTTACAATAATTTATGAGGCT
TCGTTTACTTGAAATTTTATTCAGATATTTGTTTTTTCATCATTTGTAGA
ATTTAGATGTTTTTATAAATGAATATTCTC
back to top

protein sequence of SMED30022087-orf-1

>SMED30022087-orf-1 ID=SMED30022087-orf-1|Name=SMED30022087-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2282bp
MSFYKKQLTLIDEEELLGDYSTGKYPTNVIIQNPFKGTIEFLESESDKFQ
ILINASYNSEIYSSEDIVKFNLNKHGDSLNIKLMTDVVESTVYRSTSFIN
DNNQKSSEFLPLYLLITCISILVSLTFVFSIFFAYWWNKNKRPHITRPLQ
YKIDTDSTKHPLLISEPNTPHLLHNQMHGNFLSSKDQLNNPDLTTNSCQL
MNPLRYNSMVSCSTGIDTLTNQGNIGISDRMPFVLTGGFDDYPMDNVDVM
NSLNATGSLDNYFNQGPLMVSTNTTSMSYSTLPLNFSMTHSSRCNAGMDN
SNHYMTYNPTQMIRSTDSGKITVSTTKFVSDPSYGINRHLAKDFLDENII
ERIGMNFLSQISENDASHFNVEDMDAHNKQCPLDSMGMYQQLSRNTGQGS
DETSGILSDSSGSTLDRPAQSSNAKISSGFSIVPSVINSGERFVSLDAND
QRYIPLSDVIAEVANCPQHSYLIKAGQFQGVNMVQQIPMNQKSSCSPPMI
SVDWNIPSSSCGAQIPVYHGVQVHGAPIDRKLSSGTLNKSNIYQPVIVSE
DSIFYTDKAKNVLISPVSGDQKNIIGGTLGRQNKNTPKPPRRDGTDKTSN
IKEQQHLVDVNKTDTFEVDDECGEDDESGASTSPRSALKGSRHGPRVSKQ
FTTLGLLSFFTGMLICSVSGTNSRLSSSDITIINANYVIDDSAIPNITNN
AIHQFSLDGNQFIQQIYQFIDLKLTVFIPSHLVDKNKSFKQNKIKSFQLY
NNLSSNTMVKLGVFKRNSIDIYDMKNSLNILNQEVCRQRYSCSHSCDPGN
GHRCTCQRGFALESDGKTCMDINECNTNLNICGKYGGTCVNILGSYECIC
DGEICKDCNEKCLTNYFKKNSCAQSKHLQCSKCTSECSPGYYISRKCTET
SNIQCTACRPLCITGEFELSPCSGTSNRICKSRLSISGIELPDKKNVWYE
DRRNLRDIHHIISLDEAAKLSQDKELILERESGYQIRLKFDSEITLQPLF
EPVDHSVYNDNALFKINPSNYTLKYLCPYPMPPIYDLKMQMHYNVTTEVV
NDRDLPGYRPLLQACSTYIQHGEFPETDKDIYRDSPDNSWQSNYKSWTPS
TVSCLDAGKLPSIFGDTLNEQLAIREGIYVEEKHYCSKIKSDCQRCLVDC
AHNMINNLLTCKPTDSPADNGRSPRLELCFDCCAKENCSSVCDKYAQQRC
AMHLCMSGPRMDLQLSPEWPKHDNFICHMKPSSLKPIFSLRWYLYKDNKK
LTLDEFTEKMHFTEKPMGDQMSHKIKQVFKDLIHVTYSSNIHTLPNIISG
TNDLQNAYIWNTERLPLTPGSASVKPGEKLSSIKVWPYLPMGVNSGYWSQ
LAKYDCNKASEIVDRLNVYTSEIPPYRQLQDLKVERISQYKYRLSNHRLA
SSLNFTIPARASLLSAIFTPTWVDREQFLSASLVYLGSDATQTENAFNGY
WIVELIGQVNNFPGFFRLQLWSHDSKLLNVQNPLTDSYKISRDDSFPLLD
YDIGVYDEKNFKIHLRILAPESQPDYDKSFIIKIIDIKGELEIMVHRSRQ
DPQMMIQIEKYRRTPDGKYSEEISILPEVMAVSREKSLKETSPFGIPPLV
IYTVLAVLTICLLLLFIGHLTRKEEHLCEDIVFKSRHLVVFVIYLTLKAF
YCFTVTTTTLLIVIVIYTREPYNQLTNHNSEYTNSTVAEKLLMDKMDTYL
ERELSRQLAHVTQIKTLCDKRLMDYYQKMNQRLELVSAQAAKRRSRVLIS
QAVVERAQYELRNMVNQLTRNLEDFNRTAKIYMKRIQHDMKMTKKKLSES
EWLEGARLIYQEVLRKRNEGTISKDDPTKSFLAWLKITGELPESPPQLTL
PSSFPFPDWAELNIPVPEPRLGSGLDAEYGPEYKPFNIKEKDIELEHSIW
SFYDLPDESSSKNNPGYKSDHESKYQSNPTVFKDANNEEKGMIYTETIES
IYRILIQLSWCHLLTLTLLLDLLWFLHRAAHTIDTIEQIFYGYPCFIDCT
IKGTRRKKRNENNFKFMLKRTFCEAMESSFVPKFCGSAFSLFIIYLLSTH
LNELISEEALDFVGYYDNMALPTHLRNRFINTQIVQSAQQLNDYELGSYE
LFIHQRQSEIQDILNSWVDWTTQLEQYQCELLRLYKTDDSGKLIADILNK
PDKVPIPTHCKMTTEERQKEIEKLIEFKMSVCPVSMIIPRLFTEYNETEV
SLQIVKSSRHWLRWTRRWMDTVIHCLFGYISAIILWNTVGATIWFYVKRF
SVIRQKRIYETDVQSIPLSTTESEMKSSALQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001881EGF-like_Ca-bd_dom
IPR026823cEGF
IPR000152EGF-type_Asp/Asn_hydroxyl_site
IPR018097EGF_Ca-bd_CS
IPR001368TNFR/NGFR_Cys_rich_reg
IPR000742EGF-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1765..1785
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 783..830
e-value: 1.9E-7
score: 32.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 393..420
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 586..617
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 574..644
NoneNo IPR availableCDDcd00054EGF_CAcoord: 821..858
e-value: 5.5363E-7
score: 45.7054
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 789..833
NoneNo IPR availableTMHMMTMhelixcoord: 2225..2247
NoneNo IPR availableTMHMMTMhelixcoord: 1595..1617
NoneNo IPR availableTMHMMTMhelixcoord: 1638..1667
NoneNo IPR availableTMHMMTMhelixcoord: 112..134
IPR001881EGF-like calcium-binding domainSMARTSM00179egfca_6coord: 821..863
e-value: 0.0014
score: 24.7
IPR026823Complement Clr-like EGF domainPFAMPF12662cEGFcoord: 803..824
e-value: 6.0E-7
score: 29.3
IPR000152EGF-type aspartate/asparagine hydroxylation sitePROSITEPS00010ASX_HYDROXYLcoord: 839..850
IPR018097EGF-like calcium-binding, conserved sitePROSITEPS01187EGF_CAcoord: 821..848
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 821..856
score: 9.848
IPR001368TNFR/NGFR cysteine-rich regionPROSITEPS50050TNFR_NGFR_2coord: 886..930
score: 10.579