Hexosyltransferase

Overview
NameHexosyltransferase
Smed IDSMED30022080
Length (bp)1448
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Hexosyltransferase (SMED30022080) t-SNE clustered cells

Violin plots show distribution of expression levels for Hexosyltransferase (SMED30022080) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Hexosyltransferase (SMED30022080) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Hexosyltransferase (SMED30022080) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022080

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30022080SMESG000020856.1 dd_Smed_v4_6652_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Hexosyltransferase vs. Ensembl Human
Match: B3GALT1 (beta-1,3-galactosyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:916])

HSP 1 Score: 145.976 bits (367), Expect = 4.381e-39
Identity = 79/226 (34.96%), Postives = 130/226 (57.52%), Query Frame = 2
Query:  257 GSYTSKFYNHTPFWYINNELNLCDGEI-FLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQVTDETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAE-NFNPLEKFILGRVITNSRPIRR-KSKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLITGFISKL 925
            G+  ++  N   F ++ NE N C+  I FL+  + ++   F  R+ IRETWG      G  +  LF++G+  D  L   V++E + F D+I  DF+D+Y+NLTLK L+ + W+  +CS AK+++KTD D FV++  ++Y L + +  P  ++  G VI N  PIR  +SKW + R +YP+  YPP+ +G+ Y+ S +    +Y  S    L  ++DV +   + KL
Sbjct:   51 GNIRTRPINPHSFEFLINEPNKCEKNIPFLVILISTTHKEFDARQAIRETWGDENNFKGIKIATLFLLGKNADPVLNQMVEQESQIFHDIIVEDFIDSYHNLTLKTLMGMRWVATFCSKAKYVMKTDSDIFVNMDNLIYKLLKPSTKPRRRYFTGYVI-NGGPIRDVRSKWYMPRDLYPDSNYPPFCSGTGYIFSADVAELIYKTSLHTRLLHLEDVYVGLCLRKL 275          
BLAST of Hexosyltransferase vs. Ensembl Human
Match: B3GNT3 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3 [Source:HGNC Symbol;Acc:HGNC:13528])

HSP 1 Score: 128.257 bits (321), Expect = 3.197e-32
Identity = 70/199 (35.18%), Postives = 113/199 (56.78%), Query Frame = 2
Query:  323 CDGEIFLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQVTDETLQMKVKR----EVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAENFNPLEKFILGRVITNSRPIRR-KSKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLI 904
            C   +FLL  ++SS  ++ RR+++R TWG  + V G  +RLLF++G  ++     KV R    E +   D++Q DF D++ NLTLK ++ L W    C++A F+L  DDD F     +V+YL ++ +P     +G++I N  PIR   SK+ V   +  NE YPPY  G  +++S+     L   ++  ++F IDDV +
Sbjct:  103 CAQPVFLLLVIKSSPSNYVRRELLRRTWGRERKVRGLQLRLLFLVGTASNPHEARKVNRLLELEAQTHGDILQWDFHDSFFNLTLKQVLFLQWQETRCANASFVLNGDDDVFAHTDNMVFYL-QDHDPGRHLFVGQLIQNVGPIRAFWSKYYVPEVVTQNERYPPYCGGGGFLLSRFTAAALRRAAHVLDIFPIDDVFL 300          
BLAST of Hexosyltransferase vs. Ensembl Human
Match: B3GNT3 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3 [Source:HGNC Symbol;Acc:HGNC:13528])

HSP 1 Score: 128.257 bits (321), Expect = 3.197e-32
Identity = 70/199 (35.18%), Postives = 113/199 (56.78%), Query Frame = 2
Query:  323 CDGEIFLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQVTDETLQMKVKR----EVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAENFNPLEKFILGRVITNSRPIRR-KSKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLI 904
            C   +FLL  ++SS  ++ RR+++R TWG  + V G  +RLLF++G  ++     KV R    E +   D++Q DF D++ NLTLK ++ L W    C++A F+L  DDD F     +V+YL ++ +P     +G++I N  PIR   SK+ V   +  NE YPPY  G  +++S+     L   ++  ++F IDDV +
Sbjct:  103 CAQPVFLLLVIKSSPSNYVRRELLRRTWGRERKVRGLQLRLLFLVGTASNPHEARKVNRLLELEAQTHGDILQWDFHDSFFNLTLKQVLFLQWQETRCANASFVLNGDDDVFAHTDNMVFYL-QDHDPGRHLFVGQLIQNVGPIRAFWSKYYVPEVVTQNERYPPYCGGGGFLLSRFTAAALRRAAHVLDIFPIDDVFL 300          
BLAST of Hexosyltransferase vs. Ensembl Human
Match: B3GALT5 (beta-1,3-galactosyltransferase 5 [Source:HGNC Symbol;Acc:HGNC:920])

HSP 1 Score: 125.946 bits (315), Expect = 5.591e-32
Identity = 70/205 (34.15%), Postives = 111/205 (54.15%), Query Frame = 2
Query:  338 FLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQVTDETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAENFNPLEKFILGRVITNSRPIRRK-SKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLITGFISKLCNVNLKSL 949
            FL+  V SS      R  IR+TWG  + V G  ++  F++G  +      +V +E +   D+IQ DFLD Y NLTLK ++ + W+H +C  A F++KTD D F+++  +   L +  N   +F  G +  N  PIR+  SKW VS+  YP + YPP+ +G+ YV S +    +Y  S       ++DV +   + +L N+ L+ L
Sbjct:   62 FLVLLVTSSHKQLAERMAIRQTWGKERMVKGKQLKTFFLLGTTSSAAETKEVDQESQRHGDIIQKDFLDVYYNLTLKTMMGIEWVHRFCPQAAFVMKTDSDMFINVDYLTELLLKK-NRTTRFFTGFLKLNEFPIRQPFSKWFVSKSEYPWDRYPPFCSGTGYVFSGDVASQVYNVSKSVPYIKLEDVFVGLCLERL-NIRLEEL 264          
BLAST of Hexosyltransferase vs. Ensembl Human
Match: B3GALT5 (beta-1,3-galactosyltransferase 5 [Source:HGNC Symbol;Acc:HGNC:920])

HSP 1 Score: 125.946 bits (315), Expect = 5.917e-32
Identity = 70/205 (34.15%), Postives = 111/205 (54.15%), Query Frame = 2
Query:  338 FLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQVTDETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAENFNPLEKFILGRVITNSRPIRRK-SKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLITGFISKLCNVNLKSL 949
            FL+  V SS      R  IR+TWG  + V G  ++  F++G  +      +V +E +   D+IQ DFLD Y NLTLK ++ + W+H +C  A F++KTD D F+++  +   L +  N   +F  G +  N  PIR+  SKW VS+  YP + YPP+ +G+ YV S +    +Y  S       ++DV +   + +L N+ L+ L
Sbjct:   58 FLVLLVTSSHKQLAERMAIRQTWGKERMVKGKQLKTFFLLGTTSSAAETKEVDQESQRHGDIIQKDFLDVYYNLTLKTMMGIEWVHRFCPQAAFVMKTDSDMFINVDYLTELLLKK-NRTTRFFTGFLKLNEFPIRQPFSKWFVSKSEYPWDRYPPFCSGTGYVFSGDVASQVYNVSKSVPYIKLEDVFVGLCLERL-NIRLEEL 260          
BLAST of Hexosyltransferase vs. Ensembl Celegans
Match: B0024.15 (Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:Q8MQG4])

HSP 1 Score: 107.842 bits (268), Expect = 1.103e-25
Identity = 75/249 (30.12%), Postives = 125/249 (50.20%), Query Frame = 2
Query:  242 SHKFCGSYTSKFY-------NHTPFWYINNELNLCDGEIFLLNYVQSSSWHFHRRKIIRETWGS---IKTVDGYPVRLLFVIGQVTDETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAENFNPLEKFILGRVITNSRPIR-RKSKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLITGFISKLCNVNLKSLDW 955
            SH      T++FY       NHT + +I      C     L   + S++ +F  R+ IRETW +    + V    VR+ F+I + ++E L   +++E++ F D+I  D  ++Y  L LK    L +  ++C  A F LK DDD  V +  +   L +        I G +  NS P+R +K +W V + +Y  +F+PPYI G  Y+I +NA+  +   +  +  + I+DV  TG I K   + +K ++W
Sbjct:   48 SHLSKDGSTNQFYHAQFKDQNHT-YQFITVPKKQCSNNTKLQITILSTAGNFDIRQAIRETWANPNNSEHVANNDVRISFIISKTSNEFLNFALQKEIEKFDDMIVTDLYESYELLILKVHAILSYKQSHCQLADFQLKIDDDMAVDMDGLYRSLEDKKQASINGISGIIWKNSPPVREKKHRWYVPKTLYSEKFFPPYIDGPIYLIGKNAVPRMLEEAKNYNQWIIEDVFWTGVIGKA--LKIKQINW 293          
BLAST of Hexosyltransferase vs. Ensembl Celegans
Match: B0024.15 (Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:Q8MQG4])

HSP 1 Score: 107.842 bits (268), Expect = 1.103e-25
Identity = 75/249 (30.12%), Postives = 125/249 (50.20%), Query Frame = 2
Query:  242 SHKFCGSYTSKFY-------NHTPFWYINNELNLCDGEIFLLNYVQSSSWHFHRRKIIRETWGS---IKTVDGYPVRLLFVIGQVTDETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAENFNPLEKFILGRVITNSRPIR-RKSKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLITGFISKLCNVNLKSLDW 955
            SH      T++FY       NHT + +I      C     L   + S++ +F  R+ IRETW +    + V    VR+ F+I + ++E L   +++E++ F D+I  D  ++Y  L LK    L +  ++C  A F LK DDD  V +  +   L +        I G +  NS P+R +K +W V + +Y  +F+PPYI G  Y+I +NA+  +   +  +  + I+DV  TG I K   + +K ++W
Sbjct:   48 SHLSKDGSTNQFYHAQFKDQNHT-YQFITVPKKQCSNNTKLQITILSTAGNFDIRQAIRETWANPNNSEHVANNDVRISFIISKTSNEFLNFALQKEIEKFDDMIVTDLYESYELLILKVHAILSYKQSHCQLADFQLKIDDDMAVDMDGLYRSLEDKKQASINGISGIIWKNSPPVREKKHRWYVPKTLYSEKFFPPYIDGPIYLIGKNAVPRMLEEAKNYNQWIIEDVFWTGVIGKA--LKIKQINW 293          
BLAST of Hexosyltransferase vs. Ensembl Celegans
Match: bre-5 (Beta-1,3-galactosyltransferase bre-5 [Source:UniProtKB/Swiss-Prot;Acc:Q95US5])

HSP 1 Score: 83.5741 bits (205), Expect = 1.815e-17
Identity = 56/206 (27.18%), Postives = 102/206 (49.51%), Query Frame = 2
Query:  326 DGEIFLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQVTDETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIH--NYCSHAKFILKTDDDTFVSIFQVVYYLAENFNPLEKFILGRVITNSRPIRRK-SKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLITGFISKLCNV 934
            +G+  ++  ++SS+ +   R+ +R+TWG  + +DG  V  +F++G+V +  +  ++  E + ++D++    +D+Y N TLK   A+ +    N CS   F    DDD  V I  +V +        E+ +    + ++ P R K  K  +S   YP   YPPY++  A  ++   I          ++F  DDV  TG ++K  NV
Sbjct:   74 NGQKIIIIIIKSSAKNGPMRESVRKTWGVFRMIDGVEVMPIFIVGRVENMEIMRRIDVESEKYKDILAISDIDSYRNNTLKLFGAIDYAANPNQCSSPDFTFLVDDDYLVHIPNLVKFAKT--KQKEELVYEGFVFDTSPFRLKIHKHSISLNEYPFSRYPPYVSAGAVFLTSETIARFRNSIRKLKMFPFDDVF-TGILAKTVNV 276          
BLAST of Hexosyltransferase vs. Ensembl Celegans
Match: bre-5 (Beta-1,3-galactosyltransferase bre-5 [Source:UniProtKB/Swiss-Prot;Acc:Q95US5])

HSP 1 Score: 81.6481 bits (200), Expect = 1.890e-17
Identity = 53/187 (28.34%), Postives = 91/187 (48.66%), Query Frame = 2
Query:  383 RKIIRETWGSIKTVDGYPVRLLFVIGQVTDETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIH--NYCSHAKFILKTDDDTFVSIFQVVYYLAENFNPLEKFILGRVITNSRPIRRK-SKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLITGFISKLCNV 934
            R+ +R+TWG  + +DG  V  +F++G+V +  +  ++  E + ++D++    +D+Y N TLK   A+ +    N CS   F    DDD  V I  +V +        E+ +    + ++ P R K  K  +S   YP   YPPY++  A  ++   I          ++F  DDV  TG ++K  NV
Sbjct:    2 RESVRKTWGVFRMIDGVEVMPIFIVGRVENMEIMRRIDVESEKYKDILAISDIDSYRNNTLKLFGAIDYAANPNQCSSPDFTFLVDDDYLVHIPNLVKFAKT--KQKEELVYEGFVFDTSPFRLKIHKHSISLNEYPFSRYPPYVSAGAVFLTSETIARFRNSIRKLKMFPFDDVF-TGILAKTVNV 185          
BLAST of Hexosyltransferase vs. Ensembl Celegans
Match: T15D6.5 (Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:Q9XU74])

HSP 1 Score: 79.337 bits (194), Expect = 8.424e-16
Identity = 64/218 (29.36%), Postives = 99/218 (45.41%), Query Frame = 2
Query:  341 LLNYVQSSSWHFHRRKIIRETW---GSIKTVDGYPVRLLFVIGQVT-DETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAENFNPLEKFILGRVITNSRP--IRRKSK-WQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLITGFISKLCNVNLKSLDWNFGPKF 973
            +L  V S      RRK++R+TW    + K +    +++LF++G V  D  L   VK+E + F D+I  +  DTY+NL  K L  L +  N  S  K I K DDD      ++   L EN      + +   ++      +R ++K W V    Y    YP Y  G  Y+I+  A   +   S F     ++D LI G I++   +   SL   F  +F
Sbjct:  128 ILMIVASRPGSVSRRKVLRKTWMNKANSKIIRNGRMQVLFLVGMVAGDRDLMKAVKKEAESFGDIIVMNLEDTYDNLPFKVLSLLLYGTNKASDFKIIGKIDDDVIFFPDRLTPLLDENVIDSSSYSIYGYLSQDDELVVRNETKPWYVPETAYNCTKYPVYALGPFYLITNKAANLIVENSRFQNFMTVEDALIAGIIAEGLGIQRHSLPMVFRYRF 345          
BLAST of Hexosyltransferase vs. Ensembl Fly
Match: CG11357 (gene:FBgn0035558 transcript:FBtr0073310)

HSP 1 Score: 142.51 bits (358), Expect = 3.176e-37
Identity = 85/267 (31.84%), Postives = 138/267 (51.69%), Query Frame = 2
Query:  323 CDGEIFLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQVT--DETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAENFNPL------EKFILGRVITNSRPIRR-KSKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLITGFISKLCNVNLKSLDWNFGPKFIILKDI------QMNLMENLFFITQYRFDASMFKNLWANVL 1078
            CD ++  L  V S+  +  +R+IIRETW +   +D  P+++ F++G V+   E  Q  + RE     D+IQ +F D Y N+T KH++AL W +  C+HA+ ++K DDD F++  Q+V YLA    P          +L R + +SR  R  +SKW+V+ + YPN FYP Y  G A V +   +  LY  +   + F++DDVLITG +++     +  L       ++  KD+      + +L +  F  T +         +W   L
Sbjct:  130 CDKDVRALILVHSAVRNIEKRRIIRETWANRSYIDQTPLKVYFLVGGVSAKSEKWQQFLGRENHLHGDLIQGNFKDAYRNMTYKHVMALKWFNEKCAHAQLLVKVDDDVFMNTPQLVKYLATPSLPEYSMLRDPNLMLCRSVHHSRVKRSYRSKWRVTYKEYPNRFYPEYCPGMAIVYAPEVVRRLYEAAQKSKYFWVDDVLITGILAEETGSKITPLQ-----HYLEQKDVRKLVGGEADLEDPPFLFTNHAIKPDESMTIWQMAL 391          
BLAST of Hexosyltransferase vs. Ensembl Fly
Match: CG11357 (gene:FBgn0035558 transcript:FBtr0304987)

HSP 1 Score: 142.51 bits (358), Expect = 3.176e-37
Identity = 85/267 (31.84%), Postives = 138/267 (51.69%), Query Frame = 2
Query:  323 CDGEIFLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQVT--DETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAENFNPL------EKFILGRVITNSRPIRR-KSKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLITGFISKLCNVNLKSLDWNFGPKFIILKDI------QMNLMENLFFITQYRFDASMFKNLWANVL 1078
            CD ++  L  V S+  +  +R+IIRETW +   +D  P+++ F++G V+   E  Q  + RE     D+IQ +F D Y N+T KH++AL W +  C+HA+ ++K DDD F++  Q+V YLA    P          +L R + +SR  R  +SKW+V+ + YPN FYP Y  G A V +   +  LY  +   + F++DDVLITG +++     +  L       ++  KD+      + +L +  F  T +         +W   L
Sbjct:  130 CDKDVRALILVHSAVRNIEKRRIIRETWANRSYIDQTPLKVYFLVGGVSAKSEKWQQFLGRENHLHGDLIQGNFKDAYRNMTYKHVMALKWFNEKCAHAQLLVKVDDDVFMNTPQLVKYLATPSLPEYSMLRDPNLMLCRSVHHSRVKRSYRSKWRVTYKEYPNRFYPEYCPGMAIVYAPEVVRRLYEAAQKSKYFWVDDVLITGILAEETGSKITPLQ-----HYLEQKDVRKLVGGEADLEDPPFLFTNHAIKPDESMTIWQMAL 391          
BLAST of Hexosyltransferase vs. Ensembl Fly
Match: CG11357 (gene:FBgn0035558 transcript:FBtr0113143)

HSP 1 Score: 142.51 bits (358), Expect = 3.176e-37
Identity = 85/267 (31.84%), Postives = 138/267 (51.69%), Query Frame = 2
Query:  323 CDGEIFLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQVT--DETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAENFNPL------EKFILGRVITNSRPIRR-KSKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLITGFISKLCNVNLKSLDWNFGPKFIILKDI------QMNLMENLFFITQYRFDASMFKNLWANVL 1078
            CD ++  L  V S+  +  +R+IIRETW +   +D  P+++ F++G V+   E  Q  + RE     D+IQ +F D Y N+T KH++AL W +  C+HA+ ++K DDD F++  Q+V YLA    P          +L R + +SR  R  +SKW+V+ + YPN FYP Y  G A V +   +  LY  +   + F++DDVLITG +++     +  L       ++  KD+      + +L +  F  T +         +W   L
Sbjct:  130 CDKDVRALILVHSAVRNIEKRRIIRETWANRSYIDQTPLKVYFLVGGVSAKSEKWQQFLGRENHLHGDLIQGNFKDAYRNMTYKHVMALKWFNEKCAHAQLLVKVDDDVFMNTPQLVKYLATPSLPEYSMLRDPNLMLCRSVHHSRVKRSYRSKWRVTYKEYPNRFYPEYCPGMAIVYAPEVVRRLYEAAQKSKYFWVDDVLITGILAEETGSKITPLQ-----HYLEQKDVRKLVGGEADLEDPPFLFTNHAIKPDESMTIWQMAL 391          
BLAST of Hexosyltransferase vs. Ensembl Fly
Match: CG11357 (gene:FBgn0035558 transcript:FBtr0113142)

HSP 1 Score: 142.51 bits (358), Expect = 3.176e-37
Identity = 85/267 (31.84%), Postives = 138/267 (51.69%), Query Frame = 2
Query:  323 CDGEIFLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQVT--DETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAENFNPL------EKFILGRVITNSRPIRR-KSKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLITGFISKLCNVNLKSLDWNFGPKFIILKDI------QMNLMENLFFITQYRFDASMFKNLWANVL 1078
            CD ++  L  V S+  +  +R+IIRETW +   +D  P+++ F++G V+   E  Q  + RE     D+IQ +F D Y N+T KH++AL W +  C+HA+ ++K DDD F++  Q+V YLA    P          +L R + +SR  R  +SKW+V+ + YPN FYP Y  G A V +   +  LY  +   + F++DDVLITG +++     +  L       ++  KD+      + +L +  F  T +         +W   L
Sbjct:  130 CDKDVRALILVHSAVRNIEKRRIIRETWANRSYIDQTPLKVYFLVGGVSAKSEKWQQFLGRENHLHGDLIQGNFKDAYRNMTYKHVMALKWFNEKCAHAQLLVKVDDDVFMNTPQLVKYLATPSLPEYSMLRDPNLMLCRSVHHSRVKRSYRSKWRVTYKEYPNRFYPEYCPGMAIVYAPEVVRRLYEAAQKSKYFWVDDVLITGILAEETGSKITPLQ-----HYLEQKDVRKLVGGEADLEDPPFLFTNHAIKPDESMTIWQMAL 391          
BLAST of Hexosyltransferase vs. Ensembl Fly
Match: CG8668 (gene:FBgn0031988 transcript:FBtr0339671)

HSP 1 Score: 118.242 bits (295), Expect = 3.685e-28
Identity = 72/204 (35.29%), Postives = 120/204 (58.82%), Query Frame = 2
Query:  329 GE-IFLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQVTDETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAENFNPLEKFILGRVITNSRPIR-RKSKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLITGFISKLCNV 934
            GE I LL  + S+  H   R  IR+TW    T     V + FV+G+ T+ET+   + +E   + D+I+ +F+D+YNNLTLK +  L W   +C  AK+ILKTDDD F+++ +++ +L ++ +  ++ I GR+    +PIR +KSK+ VS   +    +P +  G AYV++ + ++ LY+ S       ++DV  TG ++K  NV
Sbjct:  337 GEFIKLLVLISSAMSHDAARMSIRQTWMHYGTRRD--VGMAFVLGRGTNETINKALTQENFIYGDLIRGNFIDSYNNLTLKTISTLEWADVHCPKAKYILKTDDDMFINVPKLLTFLDKHKD--KRTIYGRLAKKWKPIRNKKSKYYVSVDQFAAGVFPSFTTGPAYVLTGDIVHELYVRSLKTVYLKLEDVFTTGIVAKSLNV 536          
BLAST of Hexosyltransferase vs. Ensembl Zebrafish
Match: b3galt1a (UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 1a [Source:ZFIN;Acc:ZDB-GENE-120215-203])

HSP 1 Score: 135.961 bits (341), Expect = 1.042e-35
Identity = 76/214 (35.51%), Postives = 121/214 (56.54%), Query Frame = 2
Query:  293 FWYINNELNLCDGEI-FLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQVTDETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVY-YLAENFNPLEKFILGRVITNSRPIRR-KSKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLITGFISKL 925
            F ++ NE   C+    FL+  + ++   F  R+ IRETWG   T     +  LF++G  T+  L   V++E + F D++  DF+D+Y+NLTLK L+ + W+  +C +A++++KTD D FV++  +V+  L  N  P  +F  G VI N  PIR   SKW + R +YP+  YPP+ +G+ YV S +    LY  S    L  ++DV +   + KL
Sbjct:   65 FKFLINEPKKCESTTPFLVLLISTNHKEFDARQAIRETWGDENTFSNVHILTLFLLGYSTEPVLNQMVEQESQIFHDILVEDFVDSYHNLTLKTLMGMRWVSLFCPNAQYVMKTDSDIFVNMDNLVFNLLRPNAKPRRRFFTGHVI-NGGPIRDVHSKWFMPRELYPDSRYPPFCSGTGYVYSGDMAELLYKTSLHTRLLHLEDVYVGLCLRKL 277          
BLAST of Hexosyltransferase vs. Ensembl Zebrafish
Match: zgc:162952 (zgc:162952 [Source:ZFIN;Acc:ZDB-GENE-070424-98])

HSP 1 Score: 131.724 bits (330), Expect = 4.120e-34
Identity = 78/249 (31.33%), Postives = 136/249 (54.62%), Query Frame = 2
Query:  176 VIYIVINSLNATIIQPDLTGN--ISHKFCGSYTSKFYNHTPFWYINNELNLCDGEI-FLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQV--TDETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAENFNPLEKFILGRVITNSRPIRRK-SKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLI 904
            +I +V  + N+ +  P + GN  IS +       K  + + + +I N+  +C+ +  FL+  +  +      R  IR TWG    V G  +  LFV+GQ   +D  LQ  +++E K+  D+IQ DF+D+Y NLT+K ++ ++W+  YC  A + +K D D F+++  +V YL       + +I G VI+++ P R   +KW +S  +YP  +YPPY++G+AYV S +    +   S F +   ++DV +
Sbjct:   18 LITLVFFAFNSLVFDPSVPGNSPISKEL-----YKVISPSTYRFILNQPEVCEKKTPFLILMIPVTLKDAEARTAIRRTWGQDGLVPGVSILHLFVVGQPARSDPVLQEHLQKESKEHGDIIQMDFVDSYQNLTIKTMMIMNWVATYCQSAWYAMKIDADIFLNVHYLVDYLHGQGESRKDYITGSVISDAIPHRDSINKWYISEDLYPKSWYPPYVSGAAYVFSTDLAGKISWASRFVQPIPLEDVYV 261          
BLAST of Hexosyltransferase vs. Ensembl Zebrafish
Match: b3gnt7 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 [Source:ZFIN;Acc:ZDB-GENE-021210-4])

HSP 1 Score: 125.176 bits (313), Expect = 4.615e-31
Identity = 69/199 (34.67%), Postives = 115/199 (57.79%), Query Frame = 2
Query:  323 CDGEIFLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQVT--DETLQMKVKREVKDF--RDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAENFNPLEKFILGRVITNSRPIRRK-SKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLI 904
            C GEI LL  ++S    F RR++IR+TWG  + ++G  ++ LF++G+ +  +E    +   E +D+   D++Q DF+D++ NLTLK +  L W  +YC   ++I K DDD FVS+  +  YL  + N L+   +G V+  ++PIR+K +K+ + + +Y    YPPY  G  +++       LY      EL+ IDDV +
Sbjct:  149 CSGEIDLLIVIKSVITQFDRREVIRKTWGKEQVLNGKRIKTLFLLGKSSNLEERANHQKLLEYEDYIYGDILQWDFMDSFFNLTLKEIHFLKWFSSYCPKTQYIFKGDDDVFVSVPNIFEYLEISGN-LKDLFVGDVLFKAKPIRKKQNKYYIPQALYNKTLYPPYAGGGGFLMDGALARKLYGACETLELYPIDDVFL 346          
BLAST of Hexosyltransferase vs. Ensembl Zebrafish
Match: b3gnt5a (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 5a [Source:NCBI gene;Acc:336526])

HSP 1 Score: 123.25 bits (308), Expect = 1.344e-30
Identity = 73/215 (33.95%), Postives = 122/215 (56.74%), Query Frame = 2
Query:  293 FWYINNELNLC-DGEIFLLNYVQSSSWHFHRRKIIRETWGS---IKTVDGYPVRLLFVIGQVTD----ETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAE-NFNPLEKFILGRVITNSRPIR-RKSKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSY-FHELFFIDDVLI 904
            F Y+ +  ++C + ++ LL +V+SS  +F RR+ IR TWG+   I    G  V+++F +G   D    +T+Q ++++E     D+IQ DFLDT++NLT+K L+   W H  C+HA F++  DDD F+ +  +V+YL E     +    +G V   + P+R R SK+ +   +Y    YP Y AG+ YV+S +    +Y  +   +   +IDDV +
Sbjct:   73 FPYLLDRRDVCKNKDVLLLLFVKSSPGNFKRRQAIRSTWGNESYISQELGVVVKVVFAMGVRPDRSGHKTMQRELRKEHMAHHDLIQQDFLDTFHNLTVKLLLQFRWTHENCAHAHFLMSADDDVFIHVPNLVHYLQELKSQNVRNLWVGHVHRGAPPVRKRDSKYYMPFDMYQWSSYPDYTAGAGYVVSGDVAAKIYQATQSLNASMYIDDVFM 287          
BLAST of Hexosyltransferase vs. Ensembl Zebrafish
Match: b3gnt5a (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 5a [Source:NCBI gene;Acc:336526])

HSP 1 Score: 123.25 bits (308), Expect = 1.344e-30
Identity = 73/215 (33.95%), Postives = 122/215 (56.74%), Query Frame = 2
Query:  293 FWYINNELNLC-DGEIFLLNYVQSSSWHFHRRKIIRETWGS---IKTVDGYPVRLLFVIGQVTD----ETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAE-NFNPLEKFILGRVITNSRPIR-RKSKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSY-FHELFFIDDVLI 904
            F Y+ +  ++C + ++ LL +V+SS  +F RR+ IR TWG+   I    G  V+++F +G   D    +T+Q ++++E     D+IQ DFLDT++NLT+K L+   W H  C+HA F++  DDD F+ +  +V+YL E     +    +G V   + P+R R SK+ +   +Y    YP Y AG+ YV+S +    +Y  +   +   +IDDV +
Sbjct:   73 FPYLLDRRDVCKNKDVLLLLFVKSSPGNFKRRQAIRSTWGNESYISQELGVVVKVVFAMGVRPDRSGHKTMQRELRKEHMAHHDLIQQDFLDTFHNLTVKLLLQFRWTHENCAHAHFLMSADDDVFIHVPNLVHYLQELKSQNVRNLWVGHVHRGAPPVRKRDSKYYMPFDMYQWSSYPDYTAGAGYVVSGDVAAKIYQATQSLNASMYIDDVFM 287          
BLAST of Hexosyltransferase vs. Ensembl Xenopus
Match: tcp11l1 (t-complex 11, testis-specific-like 1 [Source:Xenbase;Acc:XB-GENE-5887205])

HSP 1 Score: 143.28 bits (360), Expect = 3.675e-38
Identity = 85/246 (34.55%), Postives = 138/246 (56.10%), Query Frame = 2
Query:  203 NATIIQPDLT-GNISHKFCGSYTSKFYNHTPFWYINNELNLC--DGEIFLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQVTDETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAE-NFNPLEKFILGRVITNSRPIRR-KSKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLITGFISKL 925
            + TI+Q ++T GNI         ++  N   F ++ NE   C  DG  FL+  + ++   F  R+ IRETWG+     G  +  LF++G+ +D  L   V++E + F D++  DF+D+Y+NLTLK L+ + W+  +CS AK+I+KTD D FV++  ++Y L +    P  ++  G VI N  PIR  +SKW + R +YP   YPP+ +G+ Y+ S +    +Y  S    L  ++DV +   + KL
Sbjct:   38 DVTIVQKNVTFGNIR--------TRPINPHSFEFVINEPEKCGKDGP-FLVILISTTHKEFDARQAIRETWGNESNFKGIKIVTLFLLGKNSDPVLNQMVEQESQIFHDIVVEDFIDSYHNLTLKTLMGMRWVATFCSKAKYIMKTDSDIFVNMDNLIYKLLKPTTKPRRRYFTGYVI-NGGPIRDVRSKWYMPRDLYPESNYPPFCSGTGYIFSADVAELIYKTSLHTRLLHLEDVYVGLCLRKL 273          
BLAST of Hexosyltransferase vs. Ensembl Xenopus
Match: B3GNT4 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 [Source:NCBI gene;Acc:100491670])

HSP 1 Score: 140.969 bits (354), Expect = 4.705e-37
Identity = 80/207 (38.65%), Postives = 119/207 (57.49%), Query Frame = 2
Query:  323 CDGEIFLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQVTDETLQMKVKR-----EVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAENFNPLEKFILGRVITNSRPIRR-KSKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLITGFISKL 925
            C+ + FLL  ++S   +  RR  IR TWG  + +    ++LLF++G+ TD TL  K  R     E  +F+D+IQ DF+D + NLTLK +  L W++  CSHAKF+LK DDD F++ F +V +L +  NP +   +G VITN+ PIR  K K+ +   +Y    YP Y  G  YV+S+     L   +   +LF IDDV +   + K+
Sbjct:   98 CEKDTFLLLAIKSLPINIERRIAIRNTWGKQQDIQSKKIKLLFLLGK-TDSTLPAKSLRQLLSYESIEFKDLIQWDFVDNFFNLTLKEIHLLRWLNKECSHAKFVLKGDDDVFINTFNIVEFL-DGLNPDKDLFVGDVITNAVPIRNTKVKYFIPHSMYSAPHYPLYAGGGGYVMSRKTTKGLLSSAETTDLFPIDDVFVGMCLEKI 302          
BLAST of Hexosyltransferase vs. Ensembl Xenopus
Match: pja2 (praja ring finger 2, E3 ubiquitin protein ligase [Source:Xenbase;Acc:XB-GENE-966471])

HSP 1 Score: 128.257 bits (321), Expect = 2.472e-32
Identity = 83/231 (35.93%), Postives = 121/231 (52.38%), Query Frame = 2
Query:  299 YINNELNLCDG-EIFLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQVTDETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAENFN---PLEKFILGRVITNSRPIRR-KSKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLITGFISKLCNVNLKSLDWNFGPKFI 976
            Y+  E  LC G ++FLL  V SS  +  RR  IR TWG++       V  +F +G+ T E  Q ++  E +  +D+++A FLDTY N TLK + ++ WI  +C +A+FILK D + FV++  +V YL+         E   +GRVI    P R  KS   V    YP+ FYP Y +G+A VISQ+    +Y+ S         DV +     K   V + S  ++ GPK I
Sbjct:   73 YVIREEGLCSGRDVFLLMVVSSSPENKTRRDTIRRTWGNMTNYKDLVVVRMFALGRPTSEETQAELLVESQVHKDMVEASFLDTYENRTLKVITSMEWIVTFCPNARFILKVDQEAFVNVESLVDYLSYLLTLERRSEDVYIGRVIHQGVPDREPKSLHFVPTSSYPDAFYPDYCSGTALVISQDVARKVYLVSKDETTLLPPDVFLGMCARKAGVVPVHSSRFS-GPKHI 302          
BLAST of Hexosyltransferase vs. Ensembl Xenopus
Match: b3gnt5 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 5 [Source:NCBI gene;Acc:394849])

HSP 1 Score: 128.257 bits (321), Expect = 3.134e-32
Identity = 78/219 (35.62%), Postives = 123/219 (56.16%), Query Frame = 2
Query:  296 WYINNELNLCDGEIFLLNYVQSSSWHFHRRKIIRETWGS---IKTVDGYPVRLLFVIGQVTDETLQMKVKREV----KDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAENFNPLEKFILGRVITNSRPIRRK-SKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSY-FHELFFIDDVLITGFISKL 925
            + INN     + ++ LL +V++S  +  RR  IR+TWG+   I++     ++++F +G   D     + ++++    K F D+IQ DF DT++NLTLK L+   W+++YC  AKFI+  DDD FV    +V YL       + F +GRV   S PIR K SK+ V   +YP   YP Y AG+AYV+S++    +Y  S   +   +IDDV +    +K+
Sbjct:   74 YLINNRDKCQNEDVLLLLFVKTSPENRRRRNAIRKTWGNEDYIRSQYAANIKVVFALGIEADPVKSHQTQKDLVIENKRFNDLIQQDFKDTFHNLTLKLLLQFGWVNSYCPSAKFIMSADDDIFVHTPNLVSYLKSLPIETQDFWIGRVHRGSPPIRSKTSKYYVPYEMYPWSSYPDYTAGAAYVVSKDVAAKVYEASQTLNTSLYIDDVFMGICANKM 292          
BLAST of Hexosyltransferase vs. Ensembl Xenopus
Match: b3gnt7 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 [Source:NCBI gene;Acc:407949])

HSP 1 Score: 127.102 bits (318), Expect = 1.071e-31
Identity = 75/206 (36.41%), Postives = 117/206 (56.80%), Query Frame = 2
Query:  302 INNELNLCDGEIFLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQV--TDETLQMKVKREVKD--FRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAENFNPLEKFILGRVITNSRPIRRK-SKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLI 904
            INN+   C  +I LL  V+S      RR++IR+TWG  + +DG  V+ LF++G     +E    +   E ++  + D++Q DFLD++ NLTLK +  L W+  YC + K+I K DDD FVS   ++ +L    NP     +G V+  +RPIRRK +K+ +   +Y   FYPPY  G  ++++ + +  L   S   EL+ IDDV +
Sbjct:  126 INNQ-EKCSEDIELLIVVKSIITQHDRRQVIRKTWGKDREIDGKKVKTLFLLGTAMKAEERANYQKLLEFENIIYGDILQWDFLDSFFNLTLKEVHFLKWMDIYCKNVKYIFKGDDDVFVSPNNILEFLDGKNNP--NLFVGDVLQKARPIRRKDNKYYIPTALYNKTFYPPYAGGGGFLMAGSLVRKLRKASETLELYPIDDVFL 328          
BLAST of Hexosyltransferase vs. Ensembl Mouse
Match: B3galt1 (UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 1 [Source:MGI Symbol;Acc:MGI:1349403])

HSP 1 Score: 145.976 bits (367), Expect = 3.007e-39
Identity = 79/226 (34.96%), Postives = 130/226 (57.52%), Query Frame = 2
Query:  257 GSYTSKFYNHTPFWYINNELNLCDGEI-FLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQVTDETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAE-NFNPLEKFILGRVITNSRPIRR-KSKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLITGFISKL 925
            G+  ++  N   F ++ NE N C+  I FL+  + ++   F  R+ IRETWG      G  +  LF++G+  D  L   V++E + F D+I  DF+D+Y+NLTLK L+ + W+  +CS AK+++KTD D FV++  ++Y L + +  P  ++  G VI N  PIR  +SKW + R +YP+  YPP+ +G+ Y+ S +    +Y  S    L  ++DV +   + KL
Sbjct:   51 GNIRTRPINPHSFEFLINEPNKCEKNIPFLVILISTTHKEFDARQAIRETWGDENNFKGIKIATLFLLGKNADPVLNQMVEQESQIFHDIIVEDFIDSYHNLTLKTLMGMRWVATFCSKAKYVMKTDSDIFVNMDNLIYKLLKPSTKPRRRYFTGYVI-NGGPIRDVRSKWYMPRDLYPDSNYPPFCSGTGYIFSADVAELIYKTSLHTRLLHLEDVYVGLCLRKL 275          
BLAST of Hexosyltransferase vs. Ensembl Mouse
Match: B3galt1 (UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 1 [Source:MGI Symbol;Acc:MGI:1349403])

HSP 1 Score: 145.976 bits (367), Expect = 3.007e-39
Identity = 79/226 (34.96%), Postives = 130/226 (57.52%), Query Frame = 2
Query:  257 GSYTSKFYNHTPFWYINNELNLCDGEI-FLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQVTDETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAE-NFNPLEKFILGRVITNSRPIRR-KSKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLITGFISKL 925
            G+  ++  N   F ++ NE N C+  I FL+  + ++   F  R+ IRETWG      G  +  LF++G+  D  L   V++E + F D+I  DF+D+Y+NLTLK L+ + W+  +CS AK+++KTD D FV++  ++Y L + +  P  ++  G VI N  PIR  +SKW + R +YP+  YPP+ +G+ Y+ S +    +Y  S    L  ++DV +   + KL
Sbjct:   51 GNIRTRPINPHSFEFLINEPNKCEKNIPFLVILISTTHKEFDARQAIRETWGDENNFKGIKIATLFLLGKNADPVLNQMVEQESQIFHDIIVEDFIDSYHNLTLKTLMGMRWVATFCSKAKYVMKTDSDIFVNMDNLIYKLLKPSTKPRRRYFTGYVI-NGGPIRDVRSKWYMPRDLYPDSNYPPFCSGTGYIFSADVAELIYKTSLHTRLLHLEDVYVGLCLRKL 275          
BLAST of Hexosyltransferase vs. Ensembl Mouse
Match: B3gnt4 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 [Source:MGI Symbol;Acc:MGI:2680208])

HSP 1 Score: 127.102 bits (318), Expect = 3.782e-32
Identity = 77/218 (35.32%), Postives = 114/218 (52.29%), Query Frame = 2
Query:  278 YNHTPFWYINNELNLCDGEIFLLNYVQSSSWHFHRRKIIRETWGSIKT-VDGYPVRLLFVIGQVTDETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAENFNPLEKFILGRVITNSRPIRR-KSKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLITGFISKL 925
            Y H   + I  E + C  + FLL  ++S   H  +R  IR TWG   +   G  ++L+F++G          +  E   F D++Q DF + + NLTLK L    WI   C+ A FILK DDD F+ +  V+ +L E ++P + F++G VI  +RP R  K K+ +   +Y    YPPY  G  YV+SQ  +  L++     ELF IDDV +   + KL
Sbjct:   73 YRHCRNFSILLEPSECARDTFLLLVIKSQPAHIEQRSAIRSTWGRAGSWARGRQLKLVFLLGVAGPVPPAQLLVYESWQFDDILQWDFAEDFFNLTLKELHVQRWIAAACTQAHFILKGDDDVFIHVPNVLEFL-EGWDPAQDFLVGDVIRLARPNRNTKVKYFIPFSMYRARHYPPYAGGGGYVMSQATVRHLHMAMEEAELFPIDDVFVGMCLRKL 289          
BLAST of Hexosyltransferase vs. Ensembl Mouse
Match: Gm34653 (predicted gene, 34653 [Source:MGI Symbol;Acc:MGI:5593812])

HSP 1 Score: 123.635 bits (309), Expect = 9.236e-31
Identity = 71/190 (37.37%), Postives = 107/190 (56.32%), Query Frame = 2
Query:  296 WYINNELNLCDGE-IFLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQVTDETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAENFNPLEKFILGRVITNSRPIRRKSKWQ-VSRRIYPNEFYPPYIAGSAYVISQNAIYPLYI 859
            +YI N+  +C+G+ IFLL+ + SS  +  RR +IR+ WGS+ TV GYP+  LF +G     T Q ++  E +   D+I+  FLD+  N TLK +    W   +C  A FILK  D+ F+++  +V YL      LE   LGRVI    P R     + VS   YP ++YP Y +G A+++SQ+    +Y+
Sbjct:   70 YYILNQPEVCNGKTIFLLSLIFSSPGNGTRRDLIRKAWGSVTTVQGYPILTLFALGMPALVTTQEEIDAESQKNNDIIEGIFLDSSENQTLKIISMTQWAVAFCPSALFILKA-DEMFINLPGLVDYLLNLKGHLEGIYLGRVIHQDIPNRDPHSQEFVSLSEYPEKYYPDYCSGEAFILSQDVARMVYV 258          
BLAST of Hexosyltransferase vs. Ensembl Mouse
Match: B3gnt3 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3 [Source:MGI Symbol;Acc:MGI:2152535])

HSP 1 Score: 123.635 bits (309), Expect = 9.791e-31
Identity = 71/217 (32.72%), Postives = 116/217 (53.46%), Query Frame = 2
Query:  275 FYNHTPFWYINNELNL--CDGEIFLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQVTDETLQMKVKR----EVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAENFNPLEKFILGRVITNSRPIRRK-SKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLI 904
            FY H   + +  E  +  C   +FLL  ++SS  ++ RR+++R TW   + V G P+R LF++G   D     K  R    E + + D++Q DF D++ NLTLK ++ L W   YC++A F+L  DDD F     +V YL ++ +P +   +G +I N  PIR   SK+ +   +   + YPPY  G  +++S+  +  L   +    +F IDDV +
Sbjct:   85 FYRHCRDFPVLREPRVTKCAEPVFLLLAIKSSPANYGRRQMLRTTWARERRVRGAPLRRLFLVGSDRDPQQARKYNRLLELEAQKYGDILQWDFHDSFFNLTLKQVLFLEWQLTYCTNASFVLNGDDDVFAHTDNMVTYL-QDHDPDQHLFVGHLIQNVGPIRVPWSKYFIPALVMAEDRYPPYCGGGGFLLSRFTVAALRRAARVLPMFPIDDVFL 300          
BLAST of Hexosyltransferase vs. UniProt/SwissProt
Match: sp|Q9MYM7|B3GT1_PONPY (Beta-1,3-galactosyltransferase 1 OS=Pongo pygmaeus OX=9600 GN=B3GALT1 PE=3 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 2.104e-38
Identity = 79/226 (34.96%), Postives = 130/226 (57.52%), Query Frame = 2
Query:  257 GSYTSKFYNHTPFWYINNELNLCDGEI-FLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQVTDETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAE-NFNPLEKFILGRVITNSRPIRR-KSKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLITGFISKL 925
            G+  ++  N   F ++ NE N C+  I FL+  + ++   F  R+ IRETWG      G  +  LF++G+  D  L   V++E + F D+I  DF+D+Y+NLTLK L+ + W+  +CS AK+++KTD D FV++  ++Y L + +  P  ++  G VI N  PIR  +SKW + R +YP+  YPP+ +G+ Y+ S +    +Y  S    L  ++DV +   + KL
Sbjct:   51 GNIRTRPINPHSFEFLINEPNKCEKNIPFLVILISTTHKEFDARQAIRETWGDENNFKGIKIATLFLLGKNADPVLNQMVEQESQIFHDIIVEDFIDSYHNLTLKTLMGMRWVATFCSKAKYVMKTDSDIFVNMDNLIYKLLKPSTKPRRRYFTGYVI-NGGPIRDVRSKWYMPRDLYPDSNYPPFCSGTGYIFSADVAELIYKTSLHTRLLHLEDVYVGLCLRKL 275          
BLAST of Hexosyltransferase vs. UniProt/SwissProt
Match: sp|Q7JK26|B3GT1_PANTR (Beta-1,3-galactosyltransferase 1 OS=Pan troglodytes OX=9598 GN=B3GALT1 PE=3 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 2.104e-38
Identity = 79/226 (34.96%), Postives = 130/226 (57.52%), Query Frame = 2
Query:  257 GSYTSKFYNHTPFWYINNELNLCDGEI-FLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQVTDETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAE-NFNPLEKFILGRVITNSRPIRR-KSKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLITGFISKL 925
            G+  ++  N   F ++ NE N C+  I FL+  + ++   F  R+ IRETWG      G  +  LF++G+  D  L   V++E + F D+I  DF+D+Y+NLTLK L+ + W+  +CS AK+++KTD D FV++  ++Y L + +  P  ++  G VI N  PIR  +SKW + R +YP+  YPP+ +G+ Y+ S +    +Y  S    L  ++DV +   + KL
Sbjct:   51 GNIRTRPINPHSFEFLINEPNKCEKNIPFLVILISTTHKEFDARQAIRETWGDENNFKGIKIATLFLLGKNADPVLNQMVEQESQIFHDIIVEDFIDSYHNLTLKTLMGMRWVATFCSKAKYVMKTDSDIFVNMDNLIYKLLKPSTKPRRRYFTGYVI-NGGPIRDVRSKWYMPRDLYPDSNYPPFCSGTGYIFSADVAELIYKTSLHTRLLHLEDVYVGLCLRKL 275          
BLAST of Hexosyltransferase vs. UniProt/SwissProt
Match: sp|Q7JK25|B3GT1_PANPA (Beta-1,3-galactosyltransferase 1 OS=Pan paniscus OX=9597 GN=B3GALT1 PE=3 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 2.104e-38
Identity = 79/226 (34.96%), Postives = 130/226 (57.52%), Query Frame = 2
Query:  257 GSYTSKFYNHTPFWYINNELNLCDGEI-FLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQVTDETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAE-NFNPLEKFILGRVITNSRPIRR-KSKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLITGFISKL 925
            G+  ++  N   F ++ NE N C+  I FL+  + ++   F  R+ IRETWG      G  +  LF++G+  D  L   V++E + F D+I  DF+D+Y+NLTLK L+ + W+  +CS AK+++KTD D FV++  ++Y L + +  P  ++  G VI N  PIR  +SKW + R +YP+  YPP+ +G+ Y+ S +    +Y  S    L  ++DV +   + KL
Sbjct:   51 GNIRTRPINPHSFEFLINEPNKCEKNIPFLVILISTTHKEFDARQAIRETWGDENNFKGIKIATLFLLGKNADPVLNQMVEQESQIFHDIIVEDFIDSYHNLTLKTLMGMRWVATFCSKAKYVMKTDSDIFVNMDNLIYKLLKPSTKPRRRYFTGYVI-NGGPIRDVRSKWYMPRDLYPDSNYPPFCSGTGYIFSADVAELIYKTSLHTRLLHLEDVYVGLCLRKL 275          
BLAST of Hexosyltransferase vs. UniProt/SwissProt
Match: sp|O54904|B3GT1_MOUSE (Beta-1,3-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B3galt1 PE=1 SV=2)

HSP 1 Score: 145.976 bits (367), Expect = 2.104e-38
Identity = 79/226 (34.96%), Postives = 130/226 (57.52%), Query Frame = 2
Query:  257 GSYTSKFYNHTPFWYINNELNLCDGEI-FLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQVTDETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAE-NFNPLEKFILGRVITNSRPIRR-KSKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLITGFISKL 925
            G+  ++  N   F ++ NE N C+  I FL+  + ++   F  R+ IRETWG      G  +  LF++G+  D  L   V++E + F D+I  DF+D+Y+NLTLK L+ + W+  +CS AK+++KTD D FV++  ++Y L + +  P  ++  G VI N  PIR  +SKW + R +YP+  YPP+ +G+ Y+ S +    +Y  S    L  ++DV +   + KL
Sbjct:   51 GNIRTRPINPHSFEFLINEPNKCEKNIPFLVILISTTHKEFDARQAIRETWGDENNFKGIKIATLFLLGKNADPVLNQMVEQESQIFHDIIVEDFIDSYHNLTLKTLMGMRWVATFCSKAKYVMKTDSDIFVNMDNLIYKLLKPSTKPRRRYFTGYVI-NGGPIRDVRSKWYMPRDLYPDSNYPPFCSGTGYIFSADVAELIYKTSLHTRLLHLEDVYVGLCLRKL 275          
BLAST of Hexosyltransferase vs. UniProt/SwissProt
Match: sp|Q9Y5Z6|B3GT1_HUMAN (Beta-1,3-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=B3GALT1 PE=1 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 2.104e-38
Identity = 79/226 (34.96%), Postives = 130/226 (57.52%), Query Frame = 2
Query:  257 GSYTSKFYNHTPFWYINNELNLCDGEI-FLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQVTDETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAE-NFNPLEKFILGRVITNSRPIRR-KSKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLITGFISKL 925
            G+  ++  N   F ++ NE N C+  I FL+  + ++   F  R+ IRETWG      G  +  LF++G+  D  L   V++E + F D+I  DF+D+Y+NLTLK L+ + W+  +CS AK+++KTD D FV++  ++Y L + +  P  ++  G VI N  PIR  +SKW + R +YP+  YPP+ +G+ Y+ S +    +Y  S    L  ++DV +   + KL
Sbjct:   51 GNIRTRPINPHSFEFLINEPNKCEKNIPFLVILISTTHKEFDARQAIRETWGDENNFKGIKIATLFLLGKNADPVLNQMVEQESQIFHDIIVEDFIDSYHNLTLKTLMGMRWVATFCSKAKYVMKTDSDIFVNMDNLIYKLLKPSTKPRRRYFTGYVI-NGGPIRDVRSKWYMPRDLYPDSNYPPFCSGTGYIFSADVAELIYKTSLHTRLLHLEDVYVGLCLRKL 275          
BLAST of Hexosyltransferase vs. TrEMBL
Match: T1K8T3 (Hexosyltransferase OS=Tetranychus urticae OX=32264 PE=3 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 7.878e-43
Identity = 104/310 (33.55%), Postives = 162/310 (52.26%), Query Frame = 2
Query:  191 INSLNATIIQPDLTGNISHKFCGSYTSKFYNHTPFWYINNELNLCDGEIFLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQVTDETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYL----AENFNPLEKFILGRVITNSRPIRR-KSKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLITGFISKLCNVNLKSLDWNFGPKFII--------LKDIQMNLMENLFFITQYRFDASMFKNLWANVLK 1081
            I+ ++  I   D    I+++ C        +H      N   N    +IFLL ++ S+  +F +RK IR+TW S + V    +R +F++G V D  LQ  +  E K   D++Q +FLDTY NLT KH++ L WI  YC +AKFILKTDDD FV + Q+V +L    A +  P  + +   VI N  P R  KSKW+V+   YP ++YP Y  G + ++S + ++ LY+ S     F++DDV +TG +++  N++   +    GPK  I        L++ +   +  LF       D S   +LW   +K
Sbjct:   42 IDDMSQLIDLKDFKFTINNRICHGQPFSLEDHGSA-DANEGYNDDGDDIFLLIFIHSAPRNFAKRKTIRDTWASTRNVSCSQIRHVFLLGMVDDYELQRSIDSENKATGDIVQGNFLDTYRNLTYKHVMGLKWITYYCRNAKFILKTDDDIFVDVIQLVSHLKGLTANSVMP-RRLLNCFVIRNPYPARSDKSKWKVTYEEYPGKYYPTYCFGWSVILSPDVVFDLYLQSRSTPYFWVDDVYVTGLLAQKANIDQTDI----GPKLAISDQEIERWLENKETLTLPPLFVRPAAIKDLSTIYDLWNKTIK 345          
BLAST of Hexosyltransferase vs. TrEMBL
Match: A0A443STB7 (Hexosyltransferase OS=Leptotrombidium deliense OX=299467 GN=B4U80_10613 PE=3 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 7.279e-42
Identity = 82/224 (36.61%), Postives = 143/224 (63.84%), Query Frame = 2
Query:  323 CDGEIFLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQVTDETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYL----AENFNPLEKFILGRVITNSRPIRR-KSKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLITGFISKLCNVNLKSLDWNFGPKFII 979
             + ++FL+ ++ S+  +F++R+ IR TWG+    +   +R++F +G V D ++Q  +++E  D++D++Q +FLD+Y NL+ KH++ L W+  +C +AKF+ KTDDD FV IFQ++++L    +E F PL  F+   VITN  P R  +SKW V+   YP ++YP Y +G   ++S + ++ LYI S     F++DDVL++G +++   + +K +D    PK  I
Sbjct:   90 SNNDLFLVIFIHSAPNNFNKRQSIRRTWGNESNFNDDKIRVVFTLGAVGDTSVQRLIEKENNDYKDIVQGNFLDSYRNLSYKHVMGLKWVTYFCQNAKFVFKTDDDIFVDIFQLIFFLKGWHSEMF-PLRNFMSCYVITNPYPKRSVRSKWHVTYEEYPGKYYPEYCSGWGILMSPDVVFNLYIHSRDINYFWVDDVLVSGLLAQ--RIGVKHID--LTPKLAI 308          
BLAST of Hexosyltransferase vs. TrEMBL
Match: C3Y7X5 (Hexosyltransferase (Fragment) OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_207854 PE=3 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 1.117e-41
Identity = 85/223 (38.12%), Postives = 132/223 (59.19%), Query Frame = 2
Query:  266 TSKFYNHTPFWYINNELNLCDGE-IFLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQVTDETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAE-NFNPLEKFILGRVITNSRPIRR-KSKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLITGFISKL 925
             S   N  P+ +  N  + C  + +FLL  V +S  +F +R+ IR+TWG+   V+G  ++ +F +G V + T+Q  ++RE    RD+IQ DFLD+Y NLTLK ++   W   YCS A +++KTDDD FV++ ++V +L + + N   +F+ G V  ++ PIR   SKW V++  YP + YP Y  G AYVIS++    L+  S   E  FI+DV +   + KL
Sbjct:    5 ASTILNPHPYTFTLNIPDKCKNDNVFLLIVVTTSPANFDQRQAIRDTWGNESNVNGVIIKRVFAVGMVDNSTVQEDLEREHGVHRDIIQEDFLDSYRNLTLKAVMVWKWAFQYCSQASYVMKTDDDAFVNVHKLVNHLGQLSANASRRFVTGHVYVDTEPIRDPASKWFVTKEEYPRDTYPSYPCGCAYVISKDLTKLLFETSLVTEYLFIEDVYLGICLEKL 227          
BLAST of Hexosyltransferase vs. TrEMBL
Match: V4AQ54 (Hexosyltransferase (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_95799 PE=3 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 5.860e-41
Identity = 75/200 (37.50%), Postives = 121/200 (60.50%), Query Frame = 2
Query:  317 NLCDGEIFLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQVTDETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAENFNPLEKFILGRVITNSRPIRRKSKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLITGFI 916
            ++C+  +F+L +V SS  +   R  IR TWG  K       R +F++G   ++ +Q+ +  E + ++D++Q DF D+Y NLT KH++ L W    C + ++ILKTDDDT V++F ++ YL++  NPL+ F+  RV   SRP R  +KW+V+   YP  FYP Y AG AY+++ +        S + + ++IDDV ITG +
Sbjct:   23 DMCEQNLFVLAFVHSSPNNVKERNEIRSTWGGDKRAH---CRTVFLLGDPQNDQIQLAITEEARKYKDIVQGDFKDSYRNLTYKHIMGLSWTTRNCPNVRYILKTDDDTMVNVFNMMEYLSKA-NPLKNFLYCRVFPKSRPFRSINKWRVNFTEYPFSFYPSYCAGFAYLMTPDVAVQFLKVSKYVKFYWIDDVFITGIL 218          
BLAST of Hexosyltransferase vs. TrEMBL
Match: A0A1S3JNE9 (Hexosyltransferase OS=Lingula unguis OX=7574 GN=LOC106174758 PE=3 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 9.854e-41
Identity = 91/264 (34.47%), Postives = 147/264 (55.68%), Query Frame = 2
Query:  293 FWYINNELNLC--DG---EIFLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQVTDETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAENFNPLEKFILGRVITNSRPIRRK-SKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLITGFISKLCNVNLKSLDWNFGPKFIILKDIQMNLMENLFFITQYRFDASMFKNLW 1066
            F Y+ NE  +C  DG   E+FL+  V SS   + +R+ IR+TWG+         +++F++G+  +   + +V++E +   D+IQ DF+DTY NL++K    L W   YC+HAK++LKTD+D FV I  ++  L ++     KFI+G VI  + P R+  SKW VS+  Y +  YP YI+G+AYVISQ+ +  LY  +    +F+++DV ITG  +   +    S   + G ++    +   N      FIT +R      + +W
Sbjct:   55 FPYLINEEYVCQKDGKKEEVFLMVVVLSSVHRYRQRQAIRQTWGTAVNQLELKTKVVFMLGRTNESFHEYQVRKESEQHHDIIQEDFIDTYRNLSIKTTAVLKWYTTYCNHAKYLLKTDEDMFVHIPNLIKSLKDSGPKFHKFIMGSVIKGAMPYRQNFSKWYVSKEEYSDSVYPTYISGTAYVISQDLVSDLYQATLVTPMFWLEDVYITGICAAKVDA---SHVHHLGFQYFRRNEPPCNFAN---FITGHRIGQQEMRRIW 312          
BLAST of Hexosyltransferase vs. Ensembl Cavefish
Match: b3gnt5b (lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase B [Source:NCBI gene;Acc:103033521])

HSP 1 Score: 144.05 bits (362), Expect = 3.427e-38
Identity = 83/221 (37.56%), Postives = 133/221 (60.18%), Query Frame = 2
Query:  272 KFYNHTPFWYINNELNLCDGEIFLLNYVQSSSWHFHRRKIIRETWGS---IKTVDGYPVRLLFVIG----QVTDETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAE-NFNPLEKFILGRVITNSRPIRRK-SKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSY-FHELFFIDDVLI 904
            +F +H   + IN+E    + ++ LL +V+SS  +F RR+ IR TWG+   I+   G  VR++F +G        + LQ  + +E + + D+IQ DFLDT++NLT+K L+ L W H YCS+A+F++  DDD FV +  +++YL E   + ++ F +G+V   + PIRRK SK+ VS  +YP   YP Y  G+ YV+S++    +Y  S   +   +IDDV +
Sbjct:   69 RFSDHQ--YLINHEQKCTNRDVLLLLFVKSSPENFERRQAIRSTWGNEAYIERTLGVSVRVVFALGLHPSPSQRKKLQEMLHQEDEKYNDLIQQDFLDTFHNLTIKLLLQLGWTHAYCSNAQFLMSADDDIFVHMPNLIHYLQEVRRSGVKDFWVGKVHRGAPPIRRKDSKYYVSEEMYPWSMYPDYTPGAGYVVSKDVAARVYEASLTLNASLYIDDVFM 287          
BLAST of Hexosyltransferase vs. Ensembl Cavefish
Match: B3GALT1 (beta-1,3-galactosyltransferase 1 [Source:NCBI gene;Acc:103046404])

HSP 1 Score: 141.739 bits (356), Expect = 7.925e-38
Identity = 77/214 (35.98%), Postives = 123/214 (57.48%), Query Frame = 2
Query:  293 FWYINNELNLCDGEI-FLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQVTDETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAE-NFNPLEKFILGRVITNSRPIR-RKSKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLITGFISKL 925
            F +I NE   C+  + FL+  + ++   F  R+ IRETWG   T     +  LF++G+ TD  L   V++E + F D++  DF+D+Y+NLTLK L+ + W+  +C+ AK+++KTD D FV++  +VY L +    P  ++  G VI N  PIR  +SKW + R +YP   YPP+ +G+ YV S +    +Y  S    L  ++DV +   + KL
Sbjct:   67 FDFIINEPKKCETNVPFLVILISTTHKEFDARQAIRETWGDESTFSDLRIITLFLLGRSTDSVLNQMVEQESQIFHDIVVEDFVDSYHNLTLKTLMGMRWVATFCNQAKYVMKTDSDIFVNMDNLVYKLLKPATKPRRRYFTGYVI-NGSPIRDMRSKWYMPRDLYPESKYPPFCSGTGYVFSADVAELIYKTSLHTRLLHLEDVYVGVCLRKL 279          
BLAST of Hexosyltransferase vs. Ensembl Cavefish
Match: b3galt1a (beta-1,3-galactosyltransferase 1-like [Source:NCBI gene;Acc:103046152])

HSP 1 Score: 137.502 bits (345), Expect = 2.672e-36
Identity = 81/238 (34.03%), Postives = 132/238 (55.46%), Query Frame = 2
Query:  221 PDLTGNISHKFCGSYTSKFYNHTPFWYINNELNLCDGEI-FLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQVTDETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVY-YLAENFNPLEKFILGRVITNSRPIR-RKSKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLITGFISKL 925
            P L  N++  F    T     H+ F ++ NE + C+G+  FLL  + ++   F  R+ IRETWG         +  LF++G  ++  L   V++E + F D+I  DF D+Y+NLTLK ++ + W+ ++C +A +++KTD D FV++  +V   L  N  P ++F  G VI N  PIR  +SKW +SR +YP   YPP+ +G+ YV S +    ++  S    L  ++DV +   + KL
Sbjct:   45 PRLLKNVT--FSNIRTRTLNPHS-FRFLINEPSKCEGDPPFLLILISTNHKEFDARQAIRETWGEENMYSDIRIVTLFLLGHNSEPVLNQMVEQESQIFHDIIVEDFEDSYHNLTLKTMMGMRWVSSFCPNAHYVMKTDSDIFVNMDNLVLNLLRPNAKPRQRFFTGHVI-NGGPIRDTRSKWYMSREMYPESKYPPFCSGTGYVFSGDMAELIFKTSLHTRLIHLEDVYVGLCLRKL 278          
BLAST of Hexosyltransferase vs. Ensembl Cavefish
Match: b3gnt7 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 [Source:NCBI gene;Acc:103046609])

HSP 1 Score: 130.183 bits (326), Expect = 6.162e-33
Identity = 71/216 (32.87%), Postives = 123/216 (56.94%), Query Frame = 2
Query:  275 FYNHTPFWYIN-NELNLCDGEIFLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQVTDETLQMKVKR--EVKDF--RDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAENFNPLEKFILGRVITNSRPIRRK-SKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLI 904
             Y H  ++ +  N    C G++ LL  ++S      RR++IR+TWG  + ++G  ++ LF++G  + E+ +   ++  E +D+   D++Q DF+D++ NLTLK    L W   YC + ++I K DDD FVS+  ++ YL E+ + ++    G V+  +RPIRRK +K+ +   +Y   +YPPY  G  +++       LY+ S   EL+ IDDV +
Sbjct:  125 LYRHCRYFPMRINHPEKCSGDVHLLMVIKSIISQHDRREVIRQTWGKEQVINGKRIKTLFLLGTSSVESERANHQKLLEYEDYIYGDILQWDFMDSFFNLTLKETHFLKWFSTYCGNVRYIFKGDDDVFVSVQNIMEYL-EDSSDVKNLFAGDVLFKARPIRRKENKYYIPHALYNKTYYPPYAGGGGFLMDGPLARKLYLASETLELYPIDDVFL 339          
BLAST of Hexosyltransferase vs. Ensembl Cavefish
Match: b3gnt5a (lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase A-like [Source:NCBI gene;Acc:103022371])

HSP 1 Score: 129.413 bits (324), Expect = 6.999e-33
Identity = 76/215 (35.35%), Postives = 125/215 (58.14%), Query Frame = 2
Query:  293 FWYINNELNLC-DGEIFLLNYVQSSSWHFHRRKIIRETWGS---IKTVDGYPVRLLFVIG----QVTDETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAE-NFNPLEKFILGRVITNSRPIRRK-SKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSY-FHELFFIDDVLI 904
            F Y+ N  + C D ++ LL +V++S  +F RR+ IR TWG+   I++  G  V+++F++G    Q   + LQ K+  E +D  D++Q  F DT++NLT+K L+   W H YC+HA+F++  DDD F+ +  +V YL + +   ++   +G V   S P+RRK SK+ V  ++Y    YP Y AG+ YV+S +    +Y  +   +    IDDV +
Sbjct:   73 FPYLFNPKSTCADSDVLLLLFVKTSPENFRRRQAIRSTWGNQTYIRSELGVAVKVMFIMGVHPEQHKRDALQRKLHAEDQDHGDLVQQAFSDTFHNLTVKLLLQFRWAHAYCAHARFLMSADDDIFIHMPNLVRYLQDLSKQNVQDLWVGHVHRGSPPVRRKESKYYVPFQMYQWASYPDYTAGAGYVVSGDVAAKIYQATLSLNASLHIDDVFM 287          
BLAST of Hexosyltransferase vs. Ensembl Sea Lamprey
Match: B3GALT4 (beta-1,3-galactosyltransferase 4 [Source:HGNC Symbol;Acc:HGNC:919])

HSP 1 Score: 122.094 bits (305), Expect = 4.312e-31
Identity = 75/213 (35.21%), Postives = 104/213 (48.83%), Query Frame = 2
Query:  293 FWYINNELNLCDGEIFLLNYVQSSSWHFHRRKIIRETWGSIKTVD----------GYPVRLLFVIGQVTDETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAENFNPLEK-------------------FILGRVITNSRPIR-RKSKWQVSRRIYPNEFYPPYIAGSAYVISQNA 841
            F     EL     E FLL  V S+  H  RR+ IRETWG ++ V              VR++FV+G    +  +  V+ E  + RD++QA+FLDTY NLTLK +  L W  + C   +F+LK DDD FV+   +V +L +   P                        LGRV +  RP R   SK  VS   +P + Y PY +G+AYV+S +A
Sbjct:   61 FLSSPGELCRPGAEPFLLICVASAPEHRSRREAIRETWGGVRKVAVASPGGGGGRALDVRVVFVLGVTRSDRTRASVQNESVERRDIVQAEFLDTYRNLTLKTMATLQWFVSRCPGVRFLLKADDDVFVNPHSLVEHLHDAHGPASPADEDYGKGGGVGGGEGGHDLYLGRVHSRVRPNRDPASKAFVSDERFPGDHYAPYCSGTAYVLSGSA 273          
BLAST of Hexosyltransferase vs. Ensembl Sea Lamprey
Match: b3galt2 (UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2078])

HSP 1 Score: 118.627 bits (296), Expect = 8.369e-31
Identity = 71/211 (33.65%), Postives = 109/211 (51.66%), Query Frame = 2
Query:  293 FWYINNELNLCDGEI-FLLNYVQSSSWHFHRRKIIRETWGSIK-TVDGYPVRLLFVIGQVTDET-LQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAENFN---PLEKFILGRVITNSRPIRR-KSKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLI 904
            F Y+ NE + C     FL+  V S S  F  R+ IRETW S    + G   R LF++G  +  +  Q +++ E +   D+IQ +F D Y+NLTLK ++ LHW+  +C HA +++KTD D FV++  +V  + E      P   +  G V+    P R   SKW +   +YP   YP + +G+ YV+S      LY  S       ++DV +
Sbjct:    1 FRYLLNEPDTCRPRAPFLVVLVASESTEFEAREAIRETWASESVALRGVSFRRLFLLGTASPASDAQRRIEEESRRHGDLIQQNFTDAYDNLTLKTMMGLHWVSVHCPHASYVMKTDSDMFVNLEVLVKAVLEQQRRRVPPRDYFTGYVMRGFLPNRNPASKWYMPEDMYPGATYPTFCSGTGYVMSATLASRLYRASLAIRRLRLEDVYV 211          
BLAST of Hexosyltransferase vs. Ensembl Sea Lamprey
Match: B3GNT3 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3 [Source:HGNC Symbol;Acc:HGNC:13528])

HSP 1 Score: 115.931 bits (289), Expect = 9.370e-29
Identity = 72/212 (33.96%), Postives = 112/212 (52.83%), Query Frame = 2
Query:  293 FWYINNELNLCDG----EIFLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQVTDETLQMK-----VKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAENFNPLEKFILGRVITNSRPIRR-KSKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDV 898
            F  I ++ N C G    +  LL  ++S S  + +R  IR+TWG    V G  VRL+F+IG V+D   +       ++ E     D++Q  FLDT+ NLT+K +  LHW++  C HA FI   DDD F+ I  +V  L     P   F +G +I ++ P+R   SK+ V  +++P+  YP Y+ G    ++ +     +  S+  E+F IDDV
Sbjct:   94 FPIIIDQPNKCAGVKPEQPLLLLVIKSLSESYSKRHAIRQTWGQEVAVGGLQVRLIFLIG-VSDNEARRPFYNHFLQEEAAKNGDILQWGFLDTFLNLTVKQVNFLHWLNQSCPHAAFIYNGDDDMFLHIANLVELLLG--YPQGDFYVGHIIDDTPPVRYVPSKYYVPTQLWPHSTYPAYVGGGGLAMAGSTALKFFNASHSLEIFPIDDV 302          
BLAST of Hexosyltransferase vs. Ensembl Sea Lamprey
Match: b3galt2 (UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2078])

HSP 1 Score: 113.235 bits (282), Expect = 1.038e-28
Identity = 73/266 (27.44%), Postives = 128/266 (48.12%), Query Frame = 2
Query:  338 FLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQVTDETLQMKVK----REVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSI-FQVVYYLAENFN--PLEKFILGRVITNSRPIRR-KSKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLITGFISKLCNVNLKSLDWNFGPKFIILK-DIQMNLMENLFFITQYRFDASMFKNLWANVLKIEL*QTNLF 1108
            FL+  + S       R+ IR+TWG+   V G  ++ LF++G    E   ++V+     E +   D++Q +F+DTY NLTLK ++ LHW+  +CS A +++KTD D FV++ F V   L    +   L  +  G ++    P R  +SKW +   +YP E YP + +G+ YV+S      +Y  S       ++DV +      LC   L+        +F+     +  +  +    +T ++F  +  +  W ++ +  L   N F
Sbjct:   10 FLVLLISSVPAQLDARQAIRDTWGNESLVPGIVIKRLFLLGAAPAEAGSLRVQSLLEEESRRHGDLLQQNFVDTYYNLTLKTMMGLHWVSEHCSDAAYVMKTDSDMFVNVEFLVSTVLKPELHQPSLPDYFTGYLMRGYSPNRNPESKWYMPVEVYPGERYPTFCSGTGYVLSGTLAARVYRVSLTIRRLHLEDVYV-----GLCLAKLRVTPTAPPSEFLFNHWRVSYSACKYSHLVTSHQFSPAELRRYWGHLQQHRLSCRNAF 270          
BLAST of Hexosyltransferase vs. Ensembl Sea Lamprey
Match: B3GNT3 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3 [Source:HGNC Symbol;Acc:HGNC:13528])

HSP 1 Score: 112.464 bits (280), Expect = 6.813e-28
Identity = 63/207 (30.43%), Postives = 109/207 (52.66%), Query Frame = 2
Query:  335 IFLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQVTDETLQMKV------KREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAENFNPLEK---FILGRVITNSRPIRR-KSKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLITGFISKL 925
            + LL  ++S + +  RR +IR TWG   +V G PVR +F++G  + E  + +V      + E ++  D++Q +FLDT+ NLTLK L+ L W+H  C+ A+++   DDD FV+   ++  +A              G VI+N  PIR   SK+ V  +++  + YPPY+ G   +++      +   +    +  IDDV +   ++ L
Sbjct:   51 VTLLLAIKSDARNLERRDVIRRTWGREGSVRGRPVRRVFLVGVPSGEAPERRVHLNALLQEESREHGDIVQWNFLDTFFNLTLKQLLFLDWLHERCAGARYVFDGDDDVFVNTPNLLERIAAEERAGRGDGHLYEGYVISNVGPIRAPSSKYFVPVQVHAGDSYPPYVGGGGILMAGRTALDIRRVAGQLAMLPIDDVFLGQCLAAL 257          
BLAST of Hexosyltransferase vs. Ensembl Nematostella
Match: EDO33326 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSI5])

HSP 1 Score: 118.627 bits (296), Expect = 5.963e-31
Identity = 72/215 (33.49%), Postives = 113/215 (52.56%), Query Frame = 2
Query:  314 LNLCDGEIFLLNYVQSSSWHFHRRKIIRETWGSIKTV---DGYPVRLLFVIGQVTDETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAENFNPLEKFILGRVITNSRPIRRK-SKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLITGFISKLCNVNLKS 946
            + LC G +FLL  V S    F  R+ IR +WG+ +       +  + +F +GQ +D+     ++ E   ++D++  DFLDTY NLTLK ++ L W   +C  A++ILKTD D FV++  ++  L     PL    LGR+   + P R K SK+ VS+  +    YPPY AG  YV   + +  L   S+   +F ++D    G + K+  V  +S
Sbjct:    1 MPLCTGNVFLLAAVHSCHESFSMREAIRLSWGNQENAINKGKWTWKTVFFLGQSSDDEKNQLLRLEAARYKDIVIGDFLDTYRNLTLKTILILRWAKKHCPQAQYILKTDHDCFVNVLPLMRLLRIR-KPL---YLGRIHWKNTPTRNKTSKFYVSKAEFSEPVYPPYAAGGGYVFKGSLLPSLLQASHEAAVFPMEDAYF-GSLMKVIGVKAQS 210          
BLAST of Hexosyltransferase vs. Ensembl Nematostella
Match: EDO34915 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMZ5])

HSP 1 Score: 101.679 bits (252), Expect = 7.735e-25
Identity = 64/201 (31.84%), Postives = 97/201 (48.26%), Query Frame = 2
Query:  338 FLLNYVQSSSWHFHRRKIIRETWGS--------IKTVDGYPVRLLFVIGQVTDETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAENFNPLEKFILGRVITNSRPIRRK----SKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLI 904
            +L+  V S       R+ IRETWGS        I   DG    + F +G+  D +L  K  RE +   D++  +F DTYNNL +K  ++  W        KF+LKTDDD +V +    ++L    +P ++F  G +  + R IR +     KW +S+  +   FYPPY  G  +VIS + +  L   +     F +DD  I
Sbjct:    1 YLVVVVNSDPRKLENRQTIRETWGSSHLQREYTISNRDGVKWGVFFAMGKTGDTSLDSKTTREAQIHNDILIGNFRDTYNNLIIKTFMSHRW--TVTLKCKFVLKTDDDVYVRLNVFTHWLRLQGSP-DRFYGGDIFKDYRVIRDRCSKWRKWAISKAYFSENFYPPYCGGPFHVISSDIVPYLLSYTSLRRPFHVDDAYI 198          
BLAST of Hexosyltransferase vs. Ensembl Nematostella
Match: EDO34693 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNK7])

HSP 1 Score: 98.9821 bits (245), Expect = 2.588e-24
Identity = 52/165 (31.52%), Postives = 97/165 (58.79%), Query Frame = 2
Query:  440 RLLFVIGQVTDETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAE--NFNPLEKFILGRVITNSRPIRRKS-KWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLITGFISKL 925
            R +F++G+  +      +  E + + D++  +FLDTY +L+LK L+ + W + +C+ AK+ILKTDDD +++I  ++ +L+E       +   +G+V  N   +R KS ++ VSR ++  +FY PY++G  Y+ S + +  LY  S    +F ++D L+  F+  L
Sbjct:    9 RTIFIVGRSNNSRTNNLLGHESRVYGDILLGNFLDTYKHLSLKMLLGITWPYEHCN-AKYILKTDDDCYMNIVSLILWLSEYHTQQGTDPLYIGKVQKNMAVVRTKSHRYYVSRSVHRGDFYAPYVSGGGYLFSGHLLSRLYKVSRHSRVFPVEDALLGRFMRIL 172          
BLAST of Hexosyltransferase vs. Ensembl Nematostella
Match: EDO33345 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSI4])

HSP 1 Score: 100.138 bits (248), Expect = 2.788e-24
Identity = 63/212 (29.72%), Postives = 108/212 (50.94%), Query Frame = 2
Query:  323 CDGEIFLLNYVQSSSWHFHRRKIIRETWGSIKTV--------DGYPVRLLFVIGQVTDETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAE--NFNPLEKFILGRVITNSRPIRRKSKWQ-VSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLITGFISKL 925
            C    FLL  V S   +F RR+ IR +WG  + V         G   + +F+IG+  ++T+Q  +  E K   D++  DF D+Y+NL  K ++ + W H +C+ A +ILKTDDD +++   ++ +L      N  +    GR++ + R IR K     +S   YP+  +P YIAG  Y+ S   +  L   S   ++F ++D      ++++
Sbjct:    2 CRRTPFLLIEVHSRPSNFKRREAIRFSWGQPENVINQAGNFPQGRSWKTVFMIGRSQNKTIQSALDFESKKSSDIVFGDFEDSYSNLYKKMVLGIRWAHTFCT-ADYILKTDDDCYINAHALITWLDSYHMVNASQPLYTGRLVEDRRVIRDKEDRNYLSMEEYPDAEFPAYIAGGGYLFSGFLLLRLISGSKRVKMFPVEDACFGTIMNEI 212          
BLAST of Hexosyltransferase vs. Ensembl Nematostella
Match: EDO35379 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLN2])

HSP 1 Score: 98.5969 bits (244), Expect = 8.478e-24
Identity = 59/188 (31.38%), Postives = 98/188 (52.13%), Query Frame = 2
Query:  362 SSWHFHRRKIIRETWGSIK--------TVDGYPVRLLFVIGQVTDETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAENFNPLEKFILGRVITNSRPIRR-KSKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDV 898
            SS H  RR  IR TWG+ +         VD    +L+F++G+  D+ L  K+  E K + D++  DF D Y NL +K  +   WI    + +KF++K DDD ++ + ++ + LA+     E+F  G V+TN++  R   +K  +S+  +  + YPPY  G  YV + N +      +Y  + F I+D 
Sbjct:   12 SSVHLDRRNAIRRTWGNGRRSTNDTGSKVDSLSFKLVFLLGKSYDKVLDEKIATEAKLYNDIVVGDFHDNYTNLIIKVYMGFKWIQENMN-SKFVIKADDDLYLYLPRLTHRLAK----AERFFGGYVMTNAQVYRDVNNKHGISKPFFGEDVYPPYCGGPFYVFTSNLLPDFIRLTYHFKPFHIEDA 194          
BLAST of Hexosyltransferase vs. Ensembl Medaka
Match: b3galt1a (beta-1,3-galactosyltransferase 1-like [Source:NCBI gene;Acc:101163306])

HSP 1 Score: 143.28 bits (360), Expect = 1.842e-38
Identity = 79/214 (36.92%), Postives = 122/214 (57.01%), Query Frame = 2
Query:  293 FWYINNELNLCDGEI-FLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQVTDETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVY-YLAENFNPLEKFILGRVITNSRPIRR-KSKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLITGFISKL 925
            F Y+ NE   C+ E  FL+  + ++   F  R+ IRETWG   T     V  LF++G+  D  L   V++E + F DV+  DF+D+Y+NLTLK L+ + W+  YC+ A+++LKTD D FV++  ++Y  L     P  ++  G VI N  PIR  +SKW + R +YP+  YPP+ +G+ YV S +    +Y  S    L  ++DV +   + KL
Sbjct:   65 FGYLINEDKKCETEAPFLVILISTTHKEFDARQAIRETWGDESTFPEVRVVALFLLGRSMDAVLNQMVEQESQIFHDVVVEDFIDSYHNLTLKTLMGMRWVATYCTKAQYVLKTDSDIFVNMENLIYNLLKPTTKPRRRYFTGYVI-NGGPIRDIRSKWYMPRDLYPDSKYPPFCSGTGYVFSADVAELIYKISLHTRLLHLEDVYVGVCLRKL 277          
BLAST of Hexosyltransferase vs. Ensembl Medaka
Match: b3gnt7 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 [Source:ZFIN;Acc:ZDB-GENE-021210-4])

HSP 1 Score: 136.346 bits (342), Expect = 3.021e-35
Identity = 76/209 (36.36%), Postives = 118/209 (56.46%), Query Frame = 2
Query:  293 FWYINNELNLCDGEIFLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQVTDETL----QMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAENFNPLEKFILGRVITNSRPIRRK-SKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLI 904
            F  + N    C GEIFLL  ++S +    RR++IR+TWG  + +DG  V+ LF++G+ ++E      Q  V+ E K + D++Q DFLD++ NLTLK    L W H YC + +++ K DDD FVS+  +  YL    N    F+ G V+  ++PIR+K +K+ +   +Y   +YPPY  G  +++       L   +   ELF IDDV +
Sbjct:  106 FPMVFNHPEKCSGEIFLLIVIKSVATQHDRREVIRKTWGKEQVLDGKRVKTLFLLGKPSNEAERENHQKLVEYEDKIYGDILQWDFLDSFFNLTLKETHFLKWFHTYCPNVRYVFKGDDDVFVSVENIFEYLESIKNEKNMFV-GDVLVKAKPIRKKENKYYIPEALYNETYYPPYAGGGGFLMDGPLARRLDRAANTLELFPIDDVFL 313          
BLAST of Hexosyltransferase vs. Ensembl Medaka
Match: B3GALT1 (beta-1,3-galactosyltransferase 1 [Source:NCBI gene;Acc:101156539])

HSP 1 Score: 130.954 bits (328), Expect = 6.242e-34
Identity = 71/222 (31.98%), Postives = 125/222 (56.31%), Query Frame = 2
Query:  269 SKFYNHTPFWYINNELNLCDG-EIFLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQVTDETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAE-NFNPLEKFILGRVITNSRPIR-RKSKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLITGFISKL 925
            ++  N   F ++ NE   C+    FL+  + ++   F  R+ IRETWG   T     +  +F++G  +D+ L   V++E + F D++  +F+D+Y+NLTLK ++ + W+  +C  A++++KTD D FV++  ++Y L +    P  ++  G VI N  PIR  +SKW + R +YP+  YPP+ +G+ YV S +    +Y  S    L  ++DV +   + KL
Sbjct:   57 TRSLNPHAFEFVINEPKKCESITPFLVILISTNHKEFDARQAIRETWGDESTFTQIHILTIFLLGWNSDDVLNQMVEQESQIFHDIVVENFIDSYHNLTLKTMMGMRWVATFCPKAQYVMKTDSDIFVNMDNLIYKLLKPTTKPRRRYFTGYVI-NGGPIRDMRSKWYMPRDVYPDSKYPPFCSGTGYVFSADIAELIYKTSLHTRLLHLEDVYVGLCLRKL 277          
BLAST of Hexosyltransferase vs. Ensembl Medaka
Match: b3gnt7l (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7-like [Source:NCBI gene;Acc:101170895])

HSP 1 Score: 127.102 bits (318), Expect = 5.976e-32
Identity = 73/216 (33.80%), Postives = 122/216 (56.48%), Query Frame = 2
Query:  302 INNELNLCDGEIFLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQVTD----ETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFV---SIFQVVYYLAENFNPLEKFILGRVITNSRPIR-RKSKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLITGFISKL 925
            IN+     DGE+ LL  ++S      RR+ +R TWG  +T DG  +R LF++G  T     + LQ  ++ E + ++D++Q DF+DT+ NLTLK +  L W   +C   +F+ K DDD FV   ++ Q++ +  E     + F+ G  I+ + PIR R+SK+ + + +Y ++ YPPY+ G  +++S      L + S   EL+ IDDV +   + +L
Sbjct:  119 INHPEKCADGEVHLLMVIKSVIEQHDRREAVRRTWGREQTRDGRKIRTLFLLGTPTTGKDTKNLQKLLEYEDRIYKDILQWDFMDTFFNLTLKEVNFLKWFDIFCPTVQFVFKGDDDVFVNTPNLLQLIRFRVEEHKEAQLFV-GDTISKAIPIRNRQSKYYIPKELY-DQPYPPYVGGGGFLMSSRLARRLLVVSEKLELYPIDDVFLGMCLQRL 332          
BLAST of Hexosyltransferase vs. Ensembl Medaka
Match: b3gnt5b (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 5 [Source:NCBI gene;Acc:101164751])

HSP 1 Score: 121.324 bits (303), Expect = 6.651e-30
Identity = 91/269 (33.83%), Postives = 142/269 (52.79%), Query Frame = 2
Query:  155 KEYTFLFVIYIVINSLNATIIQPDLTGNISHKFCGSYTSKFYNHTPFWYINNELNLC-DGEIFLLNYVQSSSWHFHRRKIIRETWGS---IKTVDGYPVRLLFVIGQV-TDETLQMKVKREVKDFR-----------DVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYL-AENFNPLEKFILGRVITNSRPIRRK-SKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICS-YFHELFFIDDVLI 904
            K Y+F ++I    NS   T I   LT  I HK   S++        F Y+ +  + C + ++ LL +V+SS  +  RR  IR TWG+   I+   G  VR+LF +G   T E   +  ++    F+           D+IQ DF+D++ NLTLK ++  HW+H++C+HA+F +  DDD FV +  +V YL  ++   +  F +GRV   + P+R K SK+ V+   YP   YP Y AG+AYV+S +    +Y  +   +    IDDV +
Sbjct:   42 KSYSFRYLI----NSF--TYINKSLT--IPHKQARSFSD-------FHYLLDHPDKCANQDVLLLLFVKSSPKNIERRNAIRSTWGNESYIQNTLGVTVRVLFALGAPPTRENEPLWSRQSGVGFQEQLVEEDLLHGDLIQKDFVDSFYNLTLKLILQFHWVHSHCAHARFFMTADDDIFVHMPNLVKYLQGKSARGVTDFWVGRVHRGAPPVRSKYSKYYVAFETYPWLSYPDYTAGAAYVVSGDVAAKIYQATLALNASIHIDDVFM 295          
BLAST of Hexosyltransferase vs. Planmine SMEST
Match: SMESG000020856.1 (SMESG000020856.1)

HSP 1 Score: 650.973 bits (1678), Expect = 0.000e+0
Identity = 314/316 (99.37%), Postives = 316/316 (100.00%), Query Frame = 2
Query:  143 MMFSKEYTFLFVIYIVINSLNATIIQPDLTGNISHKFCGSYTSKFYNHTPFWYINNELNLCDGEIFLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQVTDETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAENFNPLEKFILGRVITNSRPIRRKSKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLITGFISKLCNVNLKSLDWNFGPKFIILKDIQMNLMENLFFITQYRFDASMFKNLWANVLKIEL 1090
            MMFSKEYTFLFVIYIVINSLNATIIQPDLTGNISHKFCGSYTSKFYNHTPFWYINNELNLCDGEIFLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQVTDETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAENFNP+EKFILGRVITNSRPIRRKSKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLITGFISKLCNVNL+SLDWNFGPKFIILKDIQMNLMENLFFITQYRFDASMFKNLWANVLKIEL
Sbjct:    1 MMFSKEYTFLFVIYIVINSLNATIIQPDLTGNISHKFCGSYTSKFYNHTPFWYINNELNLCDGEIFLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQVTDETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAENFNPMEKFILGRVITNSRPIRRKSKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLITGFISKLCNVNLRSLDWNFGPKFIILKDIQMNLMENLFFITQYRFDASMFKNLWANVLKIEL 316          
BLAST of Hexosyltransferase vs. Planmine SMEST
Match: SMESG000020765.1 (SMESG000020765.1)

HSP 1 Score: 310.842 bits (795), Expect = 4.898e-103
Identity = 151/311 (48.55%), Postives = 210/311 (67.52%), Query Frame = 2
Query:  161 YTFLFVIYIVINSLNATIIQPDLTGNISHKFCGSYTSKFYNHTPFWYINNELNLCDGEIFLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQVTDETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAENFNPLEKFILGRVITNSRPIRRKS-KWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLITGFISKLCNVNLKSLDWNFGPKFIILKDIQMNLMENLFFITQYRFDASMFKNLWANVLKIEL 1090
            + +++ I  V    +  II P++  +    FC      ++NHTPF YI  E +LC G+++LL YVQSSS HF RR +IRETWGS++ V   PV+L FVIG   +  +Q K+++E KDF D+IQ DF+D+Y NLTLKH+VALHWI NYCSHA+F+ KTDDDTF+SIF +V YL E+ NP +K ILG++  N  PIR    KW ++  +YPN+ YPP++ G AYVIS  AI PL+ICSY+ +  FIDDV ITG +S+L  + L+S D  FG  +I  + I +  M+NLFF++Q  +    ++ LW  +L+IE 
Sbjct:    2 FKYIYFILTVCIHESKHIINPEVNSDSIRLFCTGENLTYFNHTPFSYIIKESDLCFGDVYLLTYVQSSSIHFKRRMMIRETWGSLRYVSNDPVKLAFVIGYSENFKIQKKIEKESKDFGDIIQGDFIDSYKNLTLKHIVALHWIVNYCSHAQFVSKTDDDTFISIFNLVSYLKEHLNPADKLILGKISYNETPIREPGFKWTINSEMYPNDKYPPFLKGFAYVISNAAIKPLFICSYYEKFLFIDDVFITGLVSRLAGIELQSFDKVFGHFWISNEPIPIESMDNLFFVSQTEYYPDQWRILWRTILEIEF 312          
BLAST of Hexosyltransferase vs. Planmine SMEST
Match: SMESG000023690.1 (SMESG000023690.1)

HSP 1 Score: 290.812 bits (743), Expect = 4.002e-95
Identity = 147/305 (48.20%), Postives = 199/305 (65.25%), Query Frame = 2
Query:  170 LFVIYIVINSLNATIIQPDLTGNISHKFCGSYTSKFYNHTPFWYINNELNLCDGEIFLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQVTDETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAENFNPLEKFILGRVITNSRPIRRKS-KWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLITGFISKLCNVNLKSLDWNFGPKFIILKDIQMNLMENLFFITQYRFDASMFKNLWANVLK 1081
            LF+I I I++     I PD+      K+C      FYNHTPF YI NE  LC   +FLL YVQSSS +F RR++IR+TWGS+K ++    RLLF+IG+ + +T Q K+  E K FRD++QADFLDTY NLTLKH+VALHWIHN+C  A+FI KTDDDTF++IF + Y+   N NP EKFILG++ +N  PIR+K  KW V   +Y  E YPPY  G AY+ISQ A+ PL +CSY+ +  FIDDV ITG + +   V+  +   NFG  F+  ++I  N M+ ++ + +     + ++ LW   LK
Sbjct:    6 LFLICIGISN-QENFINPDVNDEDVSKYCSGENFTFYNHTPFSYIINETTLCSENVFLLTYVQSSSINFERRQLIRDTWGSLKQINSETTRLLFIIGRPSSQTDQDKIMNESKKFRDLVQADFLDTYKNLTLKHMVALHWIHNFCPQAEFISKTDDDTFINIFSLTYFSRINLNPKEKFILGQISSNEHPIRKKGFKWTVGEDMYSPEKYPPYTKGFAYMISQAAVRPLLVCSYYEKYLFIDDVFITGIVLQRTYVHHMNFQLNFGYIFLDKENITANTMDYIYIVGRNIVLPTQWEKLWDLSLK 309          
BLAST of Hexosyltransferase vs. Planmine SMEST
Match: SMESG000023044.1 (SMESG000023044.1)

HSP 1 Score: 141.354 bits (355), Expect = 5.168e-38
Identity = 80/221 (36.20%), Postives = 131/221 (59.28%), Query Frame = 2
Query:  308 NELNLC-DGEIFLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVRLLFVIGQVTDETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAENFNPLEKFILGRVITNSRPIRRKSKWQVSRRIYPNEFYPPYIAGSAYVISQ-NAIYPLYICSYFHELFFIDDVLITGFISKLCNVNLKSLDWNFG 964
            NE +LC D E  +L  V SS  +  +R+ IR T+GS+K V+   +R+++ +G   + TLQ  ++ E   +RD+IQA+F+D+Y+NLTLKH+   +W+  +C +A +++K DDDT V IF + Y+    F+    F   +VI  + P+ R  KW VS   +P ++YPPY  G AY+++    +     CS   + F+IDDVL+ G + +  N+  +    N+G
Sbjct:   40 NENSLCKDSEPDILIAVHSSPNNSEKRQNIRNTFGSLKRVNKKSLRVIYFVGITLNSTLQSLLESESFHYRDIIQANFIDSYHNLTLKHVSLHNWVERFCRNATYLIKIDDDTMVDIFHLEYFF-RTFDMKSDFYC-KVI--NAPVLRSGKWSVSLDDFPEKYYPPYCEGFAYILTNLQKLRKFVDCSLNMKFFWIDDVLLLGTVRQKLNMTAQYFPENYG 256          
BLAST of Hexosyltransferase vs. Planmine SMEST
Match: SMESG000054572.1 (SMESG000054572.1)

HSP 1 Score: 136.346 bits (342), Expect = 5.650e-37
Identity = 68/239 (28.45%), Postives = 132/239 (55.23%), Query Frame = 2
Query:  389 IIRETWGSIKTVDGYPVRLLFVIGQVTDETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWIHNYCSHAKFILKTDDDTFVSIFQVVYYLAENFNPLEKFILGRVITNSRPIRRKS----KWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFIDDVLITGFISKLCNVNLKSLDWNFGPKFIILKDIQMNLMENLFFITQY-RFDASMFKNLWANVLKIEL 1090
            +IRET+GSI+ +  Y VRL F +G+      Q+K+++E +   D+IQ DF+++Y N+T KH+  + W+   C+HA+++LK+DDD F+ I+ +V  + +    ++K  L     N++P R +     KW V++  Y +  YP Y  G  YV+    I  +++CS  ++ F+IDDV + G +  +  +  K      G  +++       +++ +F++  Y       ++ +W +V++  +
Sbjct:    1 MIRETFGSIRRIHDYTVRLAFFVGRSFSAQEQVKLEKENEINNDIIQRDFVESYRNMTRKHITVMEWVTRNCNHAEYLLKSDDDVFIDIYHIVREIVD--GNVDKGFLCSSTKNAKPQRSQKGHLRKWYVTKEEYKDNKYPTYCEGYGYVVPVKFIPNVFVCSMLNDFFWIDDVHVGGVLPDMLGIPRKDFSVGGGFFYMLPSHASHKILDGIFYVAYYSEIVQYQWRKMWKSVIEYSM 237          
The following BLAST results are available for this feature:
BLAST of Hexosyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
B3GALT14.381e-3934.96beta-1,3-galactosyltransferase 1 [Source:HGNC Symb... [more]
B3GNT33.197e-3235.18UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
B3GNT33.197e-3235.18UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
B3GALT55.591e-3234.15beta-1,3-galactosyltransferase 5 [Source:HGNC Symb... [more]
B3GALT55.917e-3234.15beta-1,3-galactosyltransferase 5 [Source:HGNC Symb... [more]
back to top
BLAST of Hexosyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
B0024.151.103e-2530.12Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:Q... [more]
B0024.151.103e-2530.12Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:Q... [more]
bre-51.815e-1727.18Beta-1,3-galactosyltransferase bre-5 [Source:UniP... [more]
bre-51.890e-1728.34Beta-1,3-galactosyltransferase bre-5 [Source:UniP... [more]
T15D6.58.424e-1629.36Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:Q... [more]
back to top
BLAST of Hexosyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG113573.176e-3731.84gene:FBgn0035558 transcript:FBtr0073310[more]
CG113573.176e-3731.84gene:FBgn0035558 transcript:FBtr0304987[more]
CG113573.176e-3731.84gene:FBgn0035558 transcript:FBtr0113143[more]
CG113573.176e-3731.84gene:FBgn0035558 transcript:FBtr0113142[more]
CG86683.685e-2835.29gene:FBgn0031988 transcript:FBtr0339671[more]
back to top
BLAST of Hexosyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
b3galt1a1.042e-3535.51UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase,... [more]
zgc:1629524.120e-3431.33zgc:162952 [Source:ZFIN;Acc:ZDB-GENE-070424-98][more]
b3gnt74.615e-3134.67UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
b3gnt5a1.344e-3033.95UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
b3gnt5a1.344e-3033.95UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
back to top
BLAST of Hexosyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tcp11l13.675e-3834.55t-complex 11, testis-specific-like 1 [Source:Xenba... [more]
B3GNT44.705e-3738.65UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
pja22.472e-3235.93praja ring finger 2, E3 ubiquitin protein ligase [... [more]
b3gnt53.134e-3235.62UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
b3gnt71.071e-3136.41UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
back to top
BLAST of Hexosyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
B3galt13.007e-3934.96UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase,... [more]
B3galt13.007e-3934.96UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase,... [more]
B3gnt43.782e-3235.32UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
Gm346539.236e-3137.37predicted gene, 34653 [Source:MGI Symbol;Acc:MGI:5... [more]
B3gnt39.791e-3132.72UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
back to top
BLAST of Hexosyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9MYM7|B3GT1_PONPY2.104e-3834.96Beta-1,3-galactosyltransferase 1 OS=Pongo pygmaeus... [more]
sp|Q7JK26|B3GT1_PANTR2.104e-3834.96Beta-1,3-galactosyltransferase 1 OS=Pan troglodyte... [more]
sp|Q7JK25|B3GT1_PANPA2.104e-3834.96Beta-1,3-galactosyltransferase 1 OS=Pan paniscus O... [more]
sp|O54904|B3GT1_MOUSE2.104e-3834.96Beta-1,3-galactosyltransferase 1 OS=Mus musculus O... [more]
sp|Q9Y5Z6|B3GT1_HUMAN2.104e-3834.96Beta-1,3-galactosyltransferase 1 OS=Homo sapiens O... [more]
back to top
BLAST of Hexosyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1K8T37.878e-4333.55Hexosyltransferase OS=Tetranychus urticae OX=32264... [more]
A0A443STB77.279e-4236.61Hexosyltransferase OS=Leptotrombidium deliense OX=... [more]
C3Y7X51.117e-4138.12Hexosyltransferase (Fragment) OS=Branchiostoma flo... [more]
V4AQ545.860e-4137.50Hexosyltransferase (Fragment) OS=Lottia gigantea O... [more]
A0A1S3JNE99.854e-4134.47Hexosyltransferase OS=Lingula unguis OX=7574 GN=LO... [more]
back to top
BLAST of Hexosyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
b3gnt5b3.427e-3837.56lactosylceramide 1,3-N-acetyl-beta-D-glucosaminylt... [more]
B3GALT17.925e-3835.98beta-1,3-galactosyltransferase 1 [Source:NCBI gene... [more]
b3galt1a2.672e-3634.03beta-1,3-galactosyltransferase 1-like [Source:NCBI... [more]
b3gnt76.162e-3332.87UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
b3gnt5a6.999e-3335.35lactosylceramide 1,3-N-acetyl-beta-D-glucosaminylt... [more]
back to top
BLAST of Hexosyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
B3GALT44.312e-3135.21beta-1,3-galactosyltransferase 4 [Source:HGNC Symb... [more]
b3galt28.369e-3133.65UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase,... [more]
B3GNT39.370e-2933.96UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
b3galt21.038e-2827.44UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase,... [more]
B3GNT36.813e-2830.43UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
back to top
BLAST of Hexosyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Hexosyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO333265.963e-3133.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO349157.735e-2531.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO346932.588e-2431.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO333452.788e-2429.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO353798.478e-2431.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Hexosyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
b3galt1a1.842e-3836.92beta-1,3-galactosyltransferase 1-like [Source:NCBI... [more]
b3gnt73.021e-3536.36UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
B3GALT16.242e-3431.98beta-1,3-galactosyltransferase 1 [Source:NCBI gene... [more]
b3gnt7l5.976e-3233.80UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
b3gnt5b6.651e-3033.83UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
back to top
BLAST of Hexosyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020856.10.000e+099.37SMESG000020856.1[more]
SMESG000020765.14.898e-10348.55SMESG000020765.1[more]
SMESG000023690.14.002e-9548.20SMESG000023690.1[more]
SMESG000023044.15.168e-3836.20SMESG000023044.1[more]
SMESG000054572.15.650e-3728.45SMESG000054572.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022080 ID=SMED30022080|Name=Hexosyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=1448bp
TGTATTTGGAAAAGAAAGCCCACATTTAATTCACAGGTTGAAATAAAGAT
TAATTTAGTGAATTTATGTGAAATAATTTCATTTTCAAAAATTTAATAAG
TGATTTTGTGATAAAATGAACCTTTAGTCCACACTTTTTAGTATGATGTT
TTCAAAAGAATATACATTTTTATTTGTGATTTATATCGTGATCAATTCTT
TGAATGCCACAATAATCCAGCCCGACCTAACAGGAAATATTTCTCATAAA
TTCTGTGGATCTTATACTTCAAAGTTTTATAATCACACTCCATTTTGGTA
TATAAATAACGAATTAAACCTTTGTGATGGTGAGATATTCTTGTTGAATT
ATGTTCAAAGTTCCTCGTGGCATTTCCATAGAAGGAAGATTATTCGTGAA
ACCTGGGGCTCAATAAAAACGGTTGACGGATATCCAGTGCGATTACTATT
CGTGATTGGACAAGTAACTGATGAGACATTACAAATGAAAGTAAAACGAG
AAGTCAAAGATTTTCGAGACGTCATTCAAGCAGATTTCCTTGATACCTAT
AATAACTTAACTCTGAAACATCTCGTTGCTCTTCATTGGATTCATAATTA
TTGTTCTCATGCCAAATTCATTTTGAAAACTGATGATGACACCTTTGTCA
GCATTTTTCAAGTGGTCTACTATTTGGCGGAAAACTTTAATCCACTGGAA
AAATTCATTCTTGGAAGAGTAATTACTAACTCTCGACCAATCCGGAGAAA
AAGTAAGTGGCAGGTTTCTAGGAGGATTTATCCCAATGAATTCTATCCTC
CATATATAGCTGGATCGGCTTATGTAATCTCCCAAAATGCCATTTATCCA
CTTTACATATGCTCCTATTTTCACGAGCTTTTTTTTATTGACGATGTTTT
GATTACGGGGTTTATCAGCAAATTATGCAATGTTAACCTGAAAAGCCTGG
ACTGGAATTTCGGACCGAAATTTATAATATTGAAGGATATACAAATGAAT
TTGATGGAAAACTTGTTCTTTATTACTCAATACCGATTTGATGCGAGTAT
GTTTAAGAATTTGTGGGCAAATGTCCTCAAAATTGAATTGTAACAAACAA
ATTTGTTTTAAAGTTTGTATTTATTTACAAATTTTGTAGGACGATTGAGA
AACGGAAATTTTGTAACAATTTCTCAGTGATATCTTGTTTTTCATTTTAA
ATCTTTTTAACTCTTTTTTGTCACAAAAACTTTTACTCTCTCTCTCTCTT
TTACAGATTCGGCCAGATTACTTATAACAATTAATAAATAAAAGTTTTCA
AAATGAATTTGATACGTGTCACACTCAATAGCTATTCTACTGGTTAACCA
AGTCCTTGAAAAAAAGAATTAAAATGGATTTATTAAAATTCTATAATTGT
TTTATAATTTTTTATTGATTTTGAATAAATTGATTCATCACTTGTGAC
back to top

protein sequence of SMED30022080-orf-1

>SMED30022080-orf-1 ID=SMED30022080-orf-1|Name=SMED30022080-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=317bp
MMFSKEYTFLFVIYIVINSLNATIIQPDLTGNISHKFCGSYTSKFYNHTP
FWYINNELNLCDGEIFLLNYVQSSSWHFHRRKIIRETWGSIKTVDGYPVR
LLFVIGQVTDETLQMKVKREVKDFRDVIQADFLDTYNNLTLKHLVALHWI
HNYCSHAKFILKTDDDTFVSIFQVVYYLAENFNPLEKFILGRVITNSRPI
RRKSKWQVSRRIYPNEFYPPYIAGSAYVISQNAIYPLYICSYFHELFFID
DVLITGFISKLCNVNLKSLDWNFGPKFIILKDIQMNLMENLFFITQYRFD
ASMFKNLWANVLKIEL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
Vocabulary: INTERPRO
TermDefinition
IPR002659Glyco_trans_31
Vocabulary: biological process
TermDefinition
GO:0006486protein glycosylation
Vocabulary: molecular function
TermDefinition
GO:0008378galactosyltransferase activity
GO:0016740transferase activity
GO:0016757transferase activity, transferring glycosyl groups
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0000139Golgi membrane
GO:0005794Golgi apparatus
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002659Glycosyl transferase, family 31PFAMPF01762Galactosyl_Tcoord: 80..267
e-value: 1.5E-46
score: 158.7
IPR002659Glycosyl transferase, family 31PANTHERPTHR11214BETA-1,3-N-ACETYLGLUCOSAMINYLTRANSFERASEcoord: 51..279
NoneNo IPR availableGENE3DG3DSA:3.90.550.50coord: 66..303
e-value: 5.8E-8
score: 34.0
NoneNo IPR availablePANTHERPTHR11214:SF148HEXOSYLTRANSFERASEcoord: 51..279
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..22
score: 0.545
NoneNo IPR availableTMHMMTMhelixcoord: 7..26