Translationally-controlled tumor protein homolog

Overview
NameTranslationally-controlled tumor protein homolog
Smed IDSMED30022078
Length (bp)629
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Translationally-controlled tumor protein homolog (SMED30022078) t-SNE clustered cells

Violin plots show distribution of expression levels for Translationally-controlled tumor protein homolog (SMED30022078) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Translationally-controlled tumor protein homolog (SMED30022078) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Translationally-controlled tumor protein homolog (SMED30022078) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022078

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30022078SMESG000064089.1 Contig1389GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30022078SMESG000023212.1 Contig1389GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30022078SMESG000023212.1 dd_Smed_v4_136_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30022078SMESG000023212.1 dd_Smed_v4_136_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30022078SMESG000023212.1 dd_Smed_v4_136_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022078SMESG000023212.1 dd_Smed_v4_136_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30022078SMESG000023212.1 dd_Smed_v4_136_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30022078SMESG000023212.1 dd_Smed_v4_136_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30022078SMESG000023212.1 dd_Smed_v4_136_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30022078SMESG000023212.1 dd_Smed_v4_136_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30022078SMESG000023212.1 dd_Smed_v4_136_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30022078SMESG000023212.1 dd_Smed_v4_136_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022078SMESG000023212.1 Contig42857newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30022078SMESG000023212.1 Contig42857uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 2 cellSMED30022078SMESG000023212.1 dd_Smed_v6_136_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30022078SMESG000023212.1 dd_Smed_v6_136_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30022078SMESG000023212.1 dd_Smed_v6_136_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Human
Match: TPT1 (tumor protein, translationally-controlled 1 [Source:HGNC Symbol;Acc:HGNC:12022])

HSP 1 Score: 138.272 bits (347), Expect = 1.639e-40
Identity = 88/180 (48.89%), Postives = 114/180 (63.33%), Query Frame = 3
Query:   75 MLIYKXXXXXXXXXXXXYPMKLI-DDIVYEFNGKNITIKNG-IPDEAIGGNKSAEGGDDDYSESCE-TQIDIVYANRLVEMSYSKKEYTTYIKDYMKRILDILKTKNPARVDVFKTNAQKYITEILKNFKEYKFYTGESMNPDAMVILCNYREDQITPYFIVFKDGVVEEKC*AKLPMEC 605
            M+IY+D+IS DE+ SD Y ++ I D +  E  GK ++   G I D  IGGN SAEG + + +ES   T +DIV  + L E S++K+ Y  YIKDYMK I   L+ + P RV  F T A + I  IL NFK Y+F+ GE+MNPD MV L +YRED +TPY I FKDG+  EKC AK    C
Sbjct:    1 MIIYRDLISHDEMFSDIYKIREIADGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPEGEGTESTVITGVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKCDAKERNPC 180          
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Human
Match: TPT1 (tumor protein, translationally-controlled 1 [Source:HGNC Symbol;Acc:HGNC:12022])

HSP 1 Score: 136.346 bits (342), Expect = 3.546e-40
Identity = 85/172 (49.42%), Postives = 111/172 (64.53%), Query Frame = 3
Query:   75 MLIYKXXXXXXXXXXXXYPMKLI-DDIVYEFNGKNITIKNG-IPDEAIGGNKSAEGGDDDYSESCE-TQIDIVYANRLVEMSYSKKEYTTYIKDYMKRILDILKTKNPARVDVFKTNAQKYITEILKNFKEYKFYTGESMNPDAMVILCNYREDQITPYFIVFKDGVVEEKC 581
            M+IY+D+IS DE+ SD Y ++ I D +  E  GK ++   G I D  IGGN SAEG + + +ES   T +DIV  + L E S++K+ Y  YIKDYMK I   L+ + P RV  F T A + I  IL NFK Y+F+ GE+MNPD MV L +YRED +TPY I FKDG+  EKC
Sbjct:    1 MIIYRDLISHDEMFSDIYKIREIADGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPEGEGTESTVITGVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC 172          
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Human
Match: TPT1 (tumor protein, translationally-controlled 1 [Source:HGNC Symbol;Acc:HGNC:12022])

HSP 1 Score: 135.576 bits (340), Expect = 6.056e-40
Identity = 73/151 (48.34%), Postives = 95/151 (62.91%), Query Frame = 3
Query:  135 KLIDDIVYEFNGKNITIKNG-IPDEAIGGNKSAEGGDDDYSESCE-TQIDIVYANRLVEMSYSKKEYTTYIKDYMKRILDILKTKNPARVDVFKTNAQKYITEILKNFKEYKFYTGESMNPDAMVILCNYREDQITPYFIVFKDGVVEEKC 581
            ++ D +  E  GK ++   G I D  IGGN SAEG + + +ES   T +DIV  + L E S++K+ Y  YIKDYMK I   L+ + P RV  F T A + I  IL NFK Y+F+ GE+MNPD MV L +YRED +TPY I FKDG+  EKC
Sbjct:   10 EIADGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPEGEGTESTVITGVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC 160          
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Human
Match: TPT1 (tumor protein, translationally-controlled 1 [Source:HGNC Symbol;Acc:HGNC:12022])

HSP 1 Score: 136.346 bits (342), Expect = 6.421e-40
Identity = 85/172 (49.42%), Postives = 111/172 (64.53%), Query Frame = 3
Query:   75 MLIYKXXXXXXXXXXXXYPMKLI-DDIVYEFNGKNITIKNG-IPDEAIGGNKSAEGGDDDYSESCE-TQIDIVYANRLVEMSYSKKEYTTYIKDYMKRILDILKTKNPARVDVFKTNAQKYITEILKNFKEYKFYTGESMNPDAMVILCNYREDQITPYFIVFKDGVVEEKC 581
            M+IY+D+IS DE+ SD Y ++ I D +  E  GK ++   G I D  IGGN SAEG + + +ES   T +DIV  + L E S++K+ Y  YIKDYMK I   L+ + P RV  F T A + I  IL NFK Y+F+ GE+MNPD MV L +YRED +TPY I FKDG+  EKC
Sbjct:    1 MIIYRDLISHDEMFSDIYKIREIADGLCLEVEGKMVSRTEGNIDDSLIGGNASAEGPEGEGTESTVITGVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC 172          
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Human
Match: TPT1 (tumor protein, translationally-controlled 1 [Source:HGNC Symbol;Acc:HGNC:12022])

HSP 1 Score: 131.339 bits (329), Expect = 1.561e-38
Identity = 68/130 (52.31%), Postives = 85/130 (65.38%), Query Frame = 3
Query:  195 IPDEAIGGNKSAEGGDDDYSESCE-TQIDIVYANRLVEMSYSKKEYTTYIKDYMKRILDILKTKNPARVDVFKTNAQKYITEILKNFKEYKFYTGESMNPDAMVILCNYREDQITPYFIVFKDGVVEEKC 581
            I D  IGGN SAEG + + +ES   T +DIV  + L E S++K+ Y  YIKDYMK I   L+ + P RV  F T A + I  IL NFK Y+F+ GE+MNPD MV L +YRED +TPY I FKDG+  EKC
Sbjct:    9 IDDSLIGGNASAEGPEGEGTESTVITGVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC 138          
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Celegans
Match: tct-1 (Translationally-controlled tumor protein homolog [Source:UniProtKB/Swiss-Prot;Acc:Q93573])

HSP 1 Score: 96.2857 bits (238), Expect = 6.783e-25
Identity = 77/182 (42.31%), Postives = 104/182 (57.14%), Query Frame = 3
Query:   75 MLIYKXXXXXXXXXXXXYPMKLIDDIVYEFNGKNITIKNGIPDEAIGGNKSAEGG--DDDYSESCETQIDIVYANRLVEMS--YSKKEYTTYIKDYMKRILDILKTKN--PARVDVFKTNAQKYITEILK--NFKEYKFYTGESMNPDA---MVILCNYREDQIT--PYFIVFKDGVVEEKC 581
            MLIYKDI +DDE+SSDS+PMKL+DD+VYEF GK++  K G    A G N SAE G  DD   E  E  IDIV  ++LVEM+       +  YIK +MK ++D ++  N   A VD FK   Q ++  +L    FK   F+ GE     A    V +  YR+   T  P  ++ K+ ++EEKC
Sbjct:    1 MLIYKDIFTDDELSSDSFPMKLVDDLVYEFKGKHVVRKEGEIVLA-GSNPSAEEGAEDDGSDEHVERGIDIVLNHKLVEMNCYEDASMFKAYIKKFMKNVIDHMEKNNRDKADVDAFKKKIQGWVVSLLAKDRFKNLAFFIGERAAEGAENGQVAIIEYRDVDGTEVPTLMLVKEAIIEEKC 181          
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Fly
Match: Tctp (gene:FBgn0037874 transcript:FBtr0347181)

HSP 1 Score: 128.642 bits (322), Expect = 1.890e-37
Identity = 82/173 (47.40%), Postives = 111/173 (64.16%), Query Frame = 3
Query:   75 MLIYKXXXXXXXXXXXXYPMKLIDDIVYEFNGKNITIKNGIPDEAIGGNKSAEGGDDDYSESCETQIDIVYANRLVEMSY--SKKEYTTYIKDYMKRILDILKTKNPARVDVFKTNAQKYITEILKNFKEYKFYTGESMNPDAMVILCNYRE--DQITPYFIVFKDGVVEEKC 581
            M IYKDII+ DE+ +D+Y MKL+DD++YE  GK IT + G   +  G N SAE  D+    + E+ +D+V  +RL E      KK YT Y+KDYMK++L  L+ K+P +VD+FKTN  K + +IL  FKE +F+TGESM+ D MV L  YRE      P  + FK G+ EEKC
Sbjct:    1 MKIYKDIITGDEMFADTYKMKLVDDVIYEVYGKLIT-RQGDDIKLEGANASAEEADEGTDITSESGVDVVLNHRLTECFAFGDKKSYTLYLKDYMKKVLAKLEEKSPDQVDIFKTNMNKAMKDILGRFKELQFFTGESMDCDGMVALVEYREINGDSVPVLMFFKHGLEEEKC 172          
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Fly
Match: Tctp (gene:FBgn0037874 transcript:FBtr0082344)

HSP 1 Score: 128.642 bits (322), Expect = 1.890e-37
Identity = 82/173 (47.40%), Postives = 111/173 (64.16%), Query Frame = 3
Query:   75 MLIYKXXXXXXXXXXXXYPMKLIDDIVYEFNGKNITIKNGIPDEAIGGNKSAEGGDDDYSESCETQIDIVYANRLVEMSY--SKKEYTTYIKDYMKRILDILKTKNPARVDVFKTNAQKYITEILKNFKEYKFYTGESMNPDAMVILCNYRE--DQITPYFIVFKDGVVEEKC 581
            M IYKDII+ DE+ +D+Y MKL+DD++YE  GK IT + G   +  G N SAE  D+    + E+ +D+V  +RL E      KK YT Y+KDYMK++L  L+ K+P +VD+FKTN  K + +IL  FKE +F+TGESM+ D MV L  YRE      P  + FK G+ EEKC
Sbjct:    1 MKIYKDIITGDEMFADTYKMKLVDDVIYEVYGKLIT-RQGDDIKLEGANASAEEADEGTDITSESGVDVVLNHRLTECFAFGDKKSYTLYLKDYMKKVLAKLEEKSPDQVDIFKTNMNKAMKDILGRFKELQFFTGESMDCDGMVALVEYREINGDSVPVLMFFKHGLEEEKC 172          
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Zebrafish
Match: tpt1 (tumor protein, translationally-controlled 1 [Source:NCBI gene;Acc:30723])

HSP 1 Score: 135.961 bits (341), Expect = 3.166e-40
Identity = 84/171 (49.12%), Postives = 110/171 (64.33%), Query Frame = 3
Query:   75 MLIYKXXXXXXXXXXXXYPMKLIDD-IVYEFNGKNITIKNG-IPDEAIGGNKSAEGGDDDYSESCETQIDIVYANRLVEMSYSKKEYTTYIKDYMKRILDILKTKNPARVDVFKTNAQKYITEILKNFKEYKFYTGESMNPDAMVILCNYREDQITPYFIVFKDGVVEEKC 581
            M+IYKDII+ DE+ SD Y +K  ++ ++ E  GK IT   G I D  IGGN SAE  D+    +  + +DIV  ++L E SY KK YT YIKDYMK +   L+   P RVD F  NA   + +IL N K ++F+TGESMNPD M+ L ++RED +TPY I FKDG+  EKC
Sbjct:    1 MIIYKDIITGDEMFSDIYKIKESENGMMLEVEGKMITRAEGDIDDALIGGNASAEVADEGCDSTSVSGVDIVLNHKLQETSYDKKSYTAYIKDYMKAVKAKLQESAPNRVDPFMANAPAEVKKILGNIKNFQFFTGESMNPDGMIGLLDFREDGVTPYMIFFKDGLEIEKC 171          
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Zebrafish
Match: tpt1 (tumor protein, translationally-controlled 1 [Source:NCBI gene;Acc:30723])

HSP 1 Score: 135.576 bits (340), Expect = 3.504e-40
Identity = 71/145 (48.97%), Postives = 91/145 (62.76%), Query Frame = 3
Query:  150 IVYEFNGKNITIKNG-IPDEAIGGNKSAEGGDDDYSESCETQIDIVYANRLVEMSYSKKEYTTYIKDYMKRILDILKTKNPARVDVFKTNAQKYITEILKNFKEYKFYTGESMNPDAMVILCNYREDQITPYFIVFKDGVVEEKC 581
            ++ E  GK IT   G I D  IGGN SAE  D+    +  + +DIV  ++L E SY KK YT YIKDYMK +   L+   P RVD F  NA   + +IL N K ++F+TGESMNPD M+ L ++RED +TPY I FKDG+  EKC
Sbjct:   15 MMLEVEGKMITRAEGDIDDALIGGNASAEVADEGCDSTSVSGVDIVLNHKLQETSYDKKSYTAYIKDYMKAVKAKLQESAPNRVDPFMANAPAEVKKILGNIKNFQFFTGESMNPDGMIGLLDFREDGVTPYMIFFKDGLEIEKC 159          
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Zebrafish
Match: tpt1 (tumor protein, translationally-controlled 1 [Source:NCBI gene;Acc:30723])

HSP 1 Score: 58.9214 bits (141), Expect = 3.184e-11
Identity = 47/96 (48.96%), Postives = 61/96 (63.54%), Query Frame = 3
Query:   75 MLIYKXXXXXXXXXXXXYPMKLIDD-IVYEFNGKNITIKNG-IPDEAIGGNKSAEGGDDDYSESCETQIDIVYANRLVEMSYSKKEYTTYIKDYMK 356
            M+IYKDII+ DE+ SD Y +K  ++ ++ E  GK IT   G I D  IGGN SAE  D+    +  + +DIV  ++L E SY KK YT YIKDYMK
Sbjct:    1 MIIYKDIITGDEMFSDIYKIKESENGMMLEVEGKMITRAEGDIDDALIGGNASAEVADEGCDSTSVSGVDIVLNHKLQETSYDKKSYTAYIKDYMK 96          
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Zebrafish
Match: tpt1 (tumor protein, translationally-controlled 1 [Source:NCBI gene;Acc:30723])

HSP 1 Score: 58.9214 bits (141), Expect = 3.184e-11
Identity = 47/96 (48.96%), Postives = 61/96 (63.54%), Query Frame = 3
Query:   75 MLIYKXXXXXXXXXXXXYPMKLIDD-IVYEFNGKNITIKNG-IPDEAIGGNKSAEGGDDDYSESCETQIDIVYANRLVEMSYSKKEYTTYIKDYMK 356
            M+IYKDII+ DE+ SD Y +K  ++ ++ E  GK IT   G I D  IGGN SAE  D+    +  + +DIV  ++L E SY KK YT YIKDYMK
Sbjct:    1 MIIYKDIITGDEMFSDIYKIKESENGMMLEVEGKMITRAEGDIDDALIGGNASAEVADEGCDSTSVSGVDIVLNHKLQETSYDKKSYTAYIKDYMK 96          
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Xenopus
Match: tpt1 (tumor protein, translationally-controlled 1 [Source:NCBI gene;Acc:493436])

HSP 1 Score: 124.02 bits (310), Expect = 2.501e-35
Identity = 76/172 (44.19%), Postives = 107/172 (62.21%), Query Frame = 3
Query:   75 MLIYKXXXXXXXXXXXXYPM-KLIDDIVYEFNGKNIT-IKNGIPDEAIGGNKSAEGGDDDYSESCE-TQIDIVYANRLVEMSYSKKEYTTYIKDYMKRILDILKTKNPARVDVFKTNAQKYITEILKNFKEYKFYTGESMNPDAMVILCNYREDQITPYFIVFKDGVVEEKC 581
            M+IYKD +++DE+ SD Y + +  D + +E  GK I  ++  I D  IGGN SAE  ++D   +   + +DIV  ++L E  ++K  Y  YIKDY+K +   L+  +P RV  F    Q  +  IL NFK Y+FYTGE MNPD MV L +YRED +TP+ I FKDG++ EKC
Sbjct:    1 MIIYKDTVTEDEMFSDIYKIAETPDGMCFEVEGKIIQRVEGAIDDALIGGNASAECQEEDIGGATTVSGVDIVINHKLQETGFTKDSYKNYIKDYVKLVKAKLEETDPDRVKPFMKGIQDRVKLILGNFKNYQFYTGERMNPDGMVALLDYREDGVTPFMIFFKDGLISEKC 172          
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Xenopus
Match: tpt1 (tumor protein, translationally-controlled 1 [Source:NCBI gene;Acc:493436])

HSP 1 Score: 63.929 bits (154), Expect = 1.103e-12
Identity = 50/133 (37.59%), Postives = 76/133 (57.14%), Query Frame = 3
Query:   75 MLIYKXXXXXXXXXXXXYPM-KLIDDIVYEFNGKNIT-IKNGIPDEAIGGNKSAEGGDDDYSESCE-TQIDIVYANRLVEMSYSKKEYTTYIKDYMKRILDILKTKNPARVDVFKTNAQKYITEILKNFKEYK 464
            M+IYKD +++DE+ SD Y + +  D + +E  GK I  ++  I D  IGGN SAE  ++D   +   + +DIV  ++L E  ++K  Y  YIKDY+K +   L+  +P RV  F    Q  +  IL NFK Y+
Sbjct:    1 MIIYKDTVTEDEMFSDIYKIAETPDGMCFEVEGKIIQRVEGAIDDALIGGNASAECQEEDIGGATTVSGVDIVINHKLQETGFTKDSYKNYIKDYVKLVKAKLEETDPDRVKPFMKGIQDRVKLILGNFKNYQ 133          
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Mouse
Match: Tpt1 (tumor protein, translationally-controlled 1 [Source:MGI Symbol;Acc:MGI:104890])

HSP 1 Score: 132.494 bits (332), Expect = 8.680e-39
Identity = 82/172 (47.67%), Postives = 110/172 (63.95%), Query Frame = 3
Query:   75 MLIYKXXXXXXXXXXXXYPMKLI-DDIVYEFNGKNITIKNG-IPDEAIGGNKSAEGGDDDYSES-CETQIDIVYANRLVEMSYSKKEYTTYIKDYMKRILDILKTKNPARVDVFKTNAQKYITEILKNFKEYKFYTGESMNPDAMVILCNYREDQITPYFIVFKDGVVEEKC 581
            M+IY+D+IS DE+ SD Y ++ I D +  E  GK ++   G I D  IGGN SAEG + + +ES   T +DIV  + L E S++K+ Y  YIKDYMK +   L+ + P RV  F T A + I  IL NF  Y+F+ GE+MNPD MV L +YRED +TP+ I FKDG+  EKC
Sbjct:    1 MIIYRDLISHDELFSDIYKIREIADGLCLEVEGKMVSRTEGAIDDSLIGGNASAEGPEGEGTESTVVTGVDIVMNHHLQETSFTKEAYKKYIKDYMKSLKGKLEEQKPERVKPFMTGAAEQIKHILANFNNYQFFIGENMNPDGMVALLDYREDGVTPFMIFFKDGLEMEKC 172          
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Mouse
Match: Tpt1 (tumor protein, translationally-controlled 1 [Source:MGI Symbol;Acc:MGI:104890])

HSP 1 Score: 127.872 bits (320), Expect = 2.185e-37
Identity = 65/133 (48.87%), Postives = 85/133 (63.91%), Query Frame = 3
Query:  186 KNGIPDEAIGGNKSAEGGDDDYSESCE-TQIDIVYANRLVEMSYSKKEYTTYIKDYMKRILDILKTKNPARVDVFKTNAQKYITEILKNFKEYKFYTGESMNPDAMVILCNYREDQITPYFIVFKDGVVEEKC 581
            +  I D  IGGN SAEG + + +ES   T +DIV  + L E S++K+ Y  YIKDYMK +   L+ + P RV  F T A + I  IL NF  Y+F+ GE+MNPD MV L +YRED +TP+ I FKDG+  EKC
Sbjct:    6 EGAIDDSLIGGNASAEGPEGEGTESTVVTGVDIVMNHHLQETSFTKEAYKKYIKDYMKSLKGKLEEQKPERVKPFMTGAAEQIKHILANFNNYQFFIGENMNPDGMVALLDYREDGVTPFMIFFKDGLEMEKC 138          
BLAST of Translationally-controlled tumor protein homolog vs. UniProt/SwissProt
Match: sp|P91800|TCTP_SCHJA (Translationally-controlled tumor protein homolog OS=Schistosoma japonicum OX=6182 GN=TCTP PE=2 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 4.712e-46
Identity = 79/168 (47.02%), Postives = 116/168 (69.05%), Query Frame = 3
Query:   75 MLIYKXXXXXXXXXXXXYPMKLIDDIVYEFNGKNITIKNGIPDEAIGGNKSAEGGDDDYSESCETQIDIVYANRLVEMSYSKKEYTTYIKDYMKRILDILKTKNPARVDVFKTNAQKYITEILKNFKEYKFYTGESMNPDAMVILCNYREDQITPYFIVFKDGVVEEK 578
            M ++KD IS DE+ SDS+  +LI+D+VYE +   IT+ NG+  + I  N S E G ++ S+S E  ID+V+A+RLV  S+ KK Y  Y+K Y+K I + L+ +NP RV +F++   +Y+  + KNF +Y+ Y GESMNPD MV L N+RE+ +TPYF+  KDG++EEK
Sbjct:    1 MRVFKDAISGDEMFSDSHSPQLINDVVYEVDANFITVSNGLDSKLIAANPSGEEGQEEVSDSTERVIDLVHASRLVSTSFDKKSYRAYLKGYLKAIKERLQKENPERVSIFESRINEYMVNVFKNFDDYEHYIGESMNPDGMVALMNFRENGVTPYFVFLKDGLIEEK 168          
BLAST of Translationally-controlled tumor protein homolog vs. UniProt/SwissProt
Match: sp|Q95VY2|TCTP_BRABE (Translationally-controlled tumor protein homolog OS=Branchiostoma belcheri OX=7741 PE=2 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 1.959e-43
Identity = 83/168 (49.40%), Postives = 109/168 (64.88%), Query Frame = 3
Query:   75 MLIYKXXXXXXXXXXXXYPMKLIDDIVYEFNGKNITIKNGIPDEAIGGNKSAEGGDDDYSESCETQIDIVYANRLVEMSYSKKEYTTYIKDYMKRILDILKTKNPARVDVFKTNAQKYITEILKNFKEYKFYTGESMNPDAMVILCNYREDQITPYFIVFKDGVVEEK 578
            M+IYKDI+S DE+ SD+Y MK++DD  YE  GK  T K GI + AIGGN SAE   +   ES  T  +IV A RL E  ++K +Y  YIKDY K++L+ L    P RVD FK  +   +  ++ NFK ++F+TGE M+ D MV L +YRED  TPY + FKDG+ EEK
Sbjct:    1 MIIYKDIVSGDEMFSDAYKMKVLDDYFYELEGKITTEKGGIDESAIGGNASAEDAVEGLEESGTTGCNIVIAQRLQETQFTKAQYKVYIKDYSKKVLEYLTKNKPERVDGFKAASAAGMKRVMGNFKNWQFFTGEKMDQDGMVALMDYREDGKTPYMLFFKDGLEEEK 168          
BLAST of Translationally-controlled tumor protein homolog vs. UniProt/SwissProt
Match: sp|Q10344|TCTP_SCHPO (Translationally-controlled tumor protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=p23fy PE=1 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 4.630e-43
Identity = 91/168 (54.17%), Postives = 118/168 (70.24%), Query Frame = 3
Query:   75 MLIYKXXXXXXXXXXXXYPMKLIDDIVYEFNGKNITIKNGIPDEAIGGNKSAEGGDDDYSESCETQIDIVYANRLVEMSYSKKEYTTYIKDYMKRILDILKTKNPARVDVFKTNAQKYITEILKNFKEYKFYTGESMNPDAMVILCNYREDQITPYFIVFKDGVVEEK 578
            ML+YKD+IS DE+ SD+Y +K +DDIVYE + + +T+K G  D  IG N SAE  +++  E  ET  ++VY+ RL   S+ KK Y +YIK YMK I   L+  NP RV VF+ NA  ++ +IL NFK+Y FY GESM+PDAMV+L NYRED ITPY I FKDG+V EK
Sbjct:    1 MLLYKDVISGDELVSDAYDLKEVDDIVYEADCQMVTVKQG-GDVDIGANPSAEDAEENAEEGTETVNNLVYSFRLSPTSFDKKSYMSYIKGYMKAIKARLQESNPERVPVFEKNAIGFVKKILANFKDYDFYIGESMDPDAMVVLMNYREDGITPYMIFFKDGLVSEK 167          
BLAST of Translationally-controlled tumor protein homolog vs. UniProt/SwissProt
Match: sp|P35691|TCTP_YEAST (Translationally-controlled tumor protein homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TMA19 PE=1 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 1.784e-42
Identity = 78/168 (46.43%), Postives = 115/168 (68.45%), Query Frame = 3
Query:   75 MLIYKXXXXXXXXXXXXYPMKLIDDIVYEFNGKNITIKNGIPDEAIGGNKSAEGGDDDYSESCETQIDIVYANRLVEMSYSKKEYTTYIKDYMKRILDILKTKNPARVDVFKTNAQKYITEILKNFKEYKFYTGESMNPDAMVILCNYREDQITPYFIVFKDGVVEEK 578
            M+IYKDI S+DE+ SD+Y  KL+DD++YE +   + +     D  IG N SAEGGDDD  E  E   ++V++ RL + ++ KK + TYIK YMK +   L+  NP  V  F+  AQ Y+ +++ +FK+++F+TGESM+PDAMV++ NYRED  TP+  ++K G+VEEK
Sbjct:    1 MIIYKDIFSNDELLSDAYDAKLVDDVIYEADCAMVNVGGDNID--IGANPSAEGGDDDVEEGAEMVNNVVHSFRLQQTAFDKKSFLTYIKGYMKAVKAKLQETNPEEVPKFEKGAQTYVKKVIGSFKDWEFFTGESMDPDAMVVMLNYREDGTTPFVAIWKHGIVEEK 166          
BLAST of Translationally-controlled tumor protein homolog vs. UniProt/SwissProt
Match: sp|Q6BP09|TCTP_DEBHA (Translationally-controlled tumor protein homolog OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=DEHA2E17468g PE=3 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 1.632e-41
Identity = 77/168 (45.83%), Postives = 113/168 (67.26%), Query Frame = 3
Query:   75 MLIYKXXXXXXXXXXXXYPMKLIDDIVYEFNGKNITIKNGIPDEAIGGNKSAEGGDDDYSESCETQIDIVYANRLVEMSYSKKEYTTYIKDYMKRILDILKTKNPARVDVFKTNAQKYITEILKNFKEYKFYTGESMNPDAMVILCNYREDQITPYFIVFKDGVVEEK 578
            M+I+ D+IS DE+ SD+Y +KL+DD+VYE +   + + NG  D  IG N SAE G +D  +  ET  ++VY+ RL + S+ KK + TY+K YMKR+   L  KNP  ++ F+  A+ Y  +++ +F ++ FYTGESM+PD MV+L NYRED  TPY  ++K GV E+K
Sbjct:    1 MIIFTDVISGDELLSDAYDVKLVDDVVYEADCAMVNVNNG--DVDIGANPSAEEGGEDLEDGTETVNNVVYSFRLQQTSFDKKSFMTYMKGYMKRVKAHLAEKNPEAIEAFENGAKTYFKKVVSSFGDWDFYTGESMDPDGMVVLLNYREDGTTPYVAIWKHGVSEDK 166          
BLAST of Translationally-controlled tumor protein homolog vs. TrEMBL
Match: A0A1I8J4X7 (TCTP domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 1.910e-52
Identity = 92/174 (52.87%), Postives = 127/174 (72.99%), Query Frame = 3
Query:   75 MLIYKXXXXXXXXXXXXYPMKLIDDIVYEFNGKNITIKNGIPDEAIGGNKSAEGGDDDYSESCETQIDIVYANRLVEMSYSKKEYTTYIKDYMKRILDILKTKNPARVDVFKTNAQKYITE-ILKNFKEYKFYTGESMNPDAMVILCNYREDQITPYFIVFKDGVVEEKC*AKL 593
            MLI+KD+IS DE++SDSYP K +DDI  E  GK IT+ N I D  IGGN SAE   +   +  E++I++VY+++LVE  + KK Y  Y+K Y+KRI   L+  NP RV+ FKT AQK++ E +L NF  ++F+TGE M+PDAMV+L +YRED +TPYF++FKDG++EEKC  +L
Sbjct:    1 MLIFKDLISGDELASDSYPYKYVDDIAIEIEGKMITVSNAIDDRMIGGNASAEEAGEGTDDGTESKINVVYSHQLVETQFDKKSYLAYLKGYLKRIEKKLEENNPDRVEAFKTGAQKFVKERVLANFSNWQFFTGEKMDPDAMVVLMDYREDGMTPYFVLFKDGLIEEKCHTRL 174          
BLAST of Translationally-controlled tumor protein homolog vs. TrEMBL
Match: A0A267GJW3 (TCTP domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig024683g3 PE=3 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 3.430e-52
Identity = 91/170 (53.53%), Postives = 125/170 (73.53%), Query Frame = 3
Query:   75 MLIYKXXXXXXXXXXXXYPMKLIDDIVYEFNGKNITIKNGIPDEAIGGNKSAEGGDDDYSESCETQIDIVYANRLVEMSYSKKEYTTYIKDYMKRILDILKTKNPARVDVFKTNAQKYITE-ILKNFKEYKFYTGESMNPDAMVILCNYREDQITPYFIVFKDGVVEEKC 581
            MLI+KD+IS DE++SDSYP K +DDI  E  GK IT+ N I D  IGGN SAE   +   +  E++I++VY+++LVE  + KK Y  Y+K Y+KRI   L+  NP RV+ FKT AQK++ E +L NF  ++F+TGE M+PDAMV+L +YRED +TPYF++FKDG++EEKC
Sbjct:    1 MLIFKDLISGDELASDSYPYKYVDDIAIEIEGKMITVSNAIDDRMIGGNASAEEAGEGTDDGTESKINVVYSHQLVETQFDKKSYLAYLKGYLKRIEKKLEENNPDRVEAFKTGAQKFVKERVLANFSNWQFFTGEKMDPDAMVVLMDYREDGMTPYFVLFKDGLIEEKC 170          
BLAST of Translationally-controlled tumor protein homolog vs. TrEMBL
Match: A0A267GN29 (TCTP domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig024683g2 PE=3 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 5.916e-52
Identity = 90/170 (52.94%), Postives = 125/170 (73.53%), Query Frame = 3
Query:   75 MLIYKXXXXXXXXXXXXYPMKLIDDIVYEFNGKNITIKNGIPDEAIGGNKSAEGGDDDYSESCETQIDIVYANRLVEMSYSKKEYTTYIKDYMKRILDILKTKNPARVDVFKTNAQKYITE-ILKNFKEYKFYTGESMNPDAMVILCNYREDQITPYFIVFKDGVVEEKC 581
            MLI+KD+IS DE++SDSYP K +DDI  E  GK IT+ N I D  IGGN SAE   +   +  E++I++VY+++LVE  + KK Y  Y+K Y+KRI   L+  NP R++ FKT AQK++ E +L NF  ++F+TGE M+PDAMV+L +YRED +TPYF++FKDG++EEKC
Sbjct:    1 MLIFKDLISGDELASDSYPYKYVDDIAIEIEGKMITVSNAIDDRMIGGNASAEEAGEGTDDGTESKINVVYSHQLVETQFDKKSYLAYLKGYLKRIEKKLEENNPDRIEAFKTGAQKFVKERVLANFSNWQFFTGEKMDPDAMVVLMDYREDGMTPYFVLFKDGLIEEKC 170          
BLAST of Translationally-controlled tumor protein homolog vs. TrEMBL
Match: A0A267EZB4 (TCTP domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig024683g1 PE=3 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 1.295e-51
Identity = 91/170 (53.53%), Postives = 125/170 (73.53%), Query Frame = 3
Query:   75 MLIYKXXXXXXXXXXXXYPMKLIDDIVYEFNGKNITIKNGIPDEAIGGNKSAEGGDDDYSESCETQIDIVYANRLVEMSYSKKEYTTYIKDYMKRILDILKTKNPARVDVFKTNAQKYITE-ILKNFKEYKFYTGESMNPDAMVILCNYREDQITPYFIVFKDGVVEEKC 581
            MLI+KD+IS DE++SDSYP K +DDI  E  GK IT+ N I D  IGGN SAE   +   +  E++I++VY+++LVE  + KK Y  Y+K Y+KRI   L+  NP RV+ FKT AQK++ E +L NF  ++F+TGE M+PDAMV+L +YRED +TPYF++FKDG++EEKC
Sbjct:    1 MLIFKDLISGDELASDSYPYKYVDDIAIEIEGKMITVSNAIDDRMIGGNASAEEAGEGTDDGTESKINVVYSHQLVETQFDKKSYLAYLKGYLKRIEKKLEENNPDRVEAFKTGAQKFVKERVLANFSNWQFFTGEKMDPDAMVVLMDYREDGMTPYFVLFKDGLIEEKC 170          
BLAST of Translationally-controlled tumor protein homolog vs. TrEMBL
Match: A0A0D2X0X0 (Translationally-controlled tumor protein OS=Capsaspora owczarzaki (strain ATCC 30864) OX=595528 GN=CAOG_001218 PE=3 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 1.770e-50
Identity = 92/171 (53.80%), Postives = 123/171 (71.93%), Query Frame = 3
Query:   75 MLIYKXXXXXXXXXXXXYPMKLIDDIVYEFNGKNITIKNGIPDEAIGGNKSAEG--GDDDYSESCETQIDIVYANRLVEMSYSKKEYTTYIKDYMKRILDILKTKNPARVDVFKTNAQKYITEILKNFKEYKFYTGESMNPDAMVILCNYREDQITPYFIVFKDGVVEEKC 581
            MLI+KD+IS DE++SDS+P KL+DD+ YE +GK I++K GI D  IGGN SAEG   DD  ++  ++ I++VY+++LVE S+ KK YT YIK YMK I   L+   P RVDVF     + + +IL NF  Y+F+TG SMN D +V+L NYRED +TPYFI+FKDGV+ EK 
Sbjct:    1 MLIFKDVISGDEVASDSFPHKLVDDLYYEVDGKTISVKEGIDDSLIGGNASAEGEDADDGAADGVKSVINVVYSHQLVETSFDKKSYTAYIKGYMKAIKAHLEKNQPERVDVFTKGMPEIVKKILGNFDNYQFFTGASMNVDGLVVLLNYREDGVTPYFIIFKDGVIPEKV 171          
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Cavefish
Match: tpt1 (tumor protein, translationally-controlled 1 [Source:NCBI gene;Acc:30723])

HSP 1 Score: 130.954 bits (328), Expect = 6.359e-38
Identity = 81/171 (47.37%), Postives = 110/171 (64.33%), Query Frame = 3
Query:   75 MLIYKXXXXXXXXXXXXYPMKLIDD-IVYEFNGKNITIKNG-IPDEAIGGNKSAEGGDDDYSESCETQIDIVYANRLVEMSYSKKEYTTYIKDYMKRILDILKTKNPARVDVFKTNAQKYITEILKNFKEYKFYTGESMNPDAMVILCNYREDQITPYFIVFKDGVVEEKC 581
            M+IYKDII+ DE+ SD Y +K  ++ ++ E  GK I+   G I D  IGGN SAE  D+    +  + +DIV  ++L E SY KK YT YIKDYMK +   L+  +P RVD F  NA   + +IL N K ++F+TGESMNPD  + L ++RED +TPY + FKDG+  EKC
Sbjct:    1 MIIYKDIITGDEMFSDIYKIKESENGMMIEVEGKMISRAEGDIDDALIGGNASAEVQDEGCDSTTVSGVDIVLNHKLTETSYDKKSYTAYIKDYMKAVKAKLQETSPDRVDPFMANAPAEVKKILGNIKNFQFFTGESMNPDGTIGLLDFREDGVTPYMLFFKDGLEIEKC 171          
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Cavefish
Match: tpt1 (tumor protein, translationally-controlled 1 [Source:NCBI gene;Acc:30723])

HSP 1 Score: 130.954 bits (328), Expect = 8.166e-38
Identity = 68/145 (46.90%), Postives = 91/145 (62.76%), Query Frame = 3
Query:  150 IVYEFNGKNITIKNG-IPDEAIGGNKSAEGGDDDYSESCETQIDIVYANRLVEMSYSKKEYTTYIKDYMKRILDILKTKNPARVDVFKTNAQKYITEILKNFKEYKFYTGESMNPDAMVILCNYREDQITPYFIVFKDGVVEEKC 581
            ++ E  GK I+   G I D  IGGN SAE  D+    +  + +DIV  ++L E SY KK YT YIKDYMK +   L+  +P RVD F  NA   + +IL N K ++F+TGESMNPD  + L ++RED +TPY + FKDG+  EKC
Sbjct:   62 MMIEVEGKMISRAEGDIDDALIGGNASAEVQDEGCDSTTVSGVDIVLNHKLTETSYDKKSYTAYIKDYMKAVKAKLQETSPDRVDPFMANAPAEVKKILGNIKNFQFFTGESMNPDGTIGLLDFREDGVTPYMLFFKDGLEIEKC 206          
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009867.1 (pep scaffold:Pmarinus_7.0:GL478379:189408:194610:-1 gene:ENSPMAG00000008896.1 transcript:ENSPMAT00000009867.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 141.739 bits (356), Expect = 3.828e-43
Identity = 84/172 (48.84%), Postives = 116/172 (67.44%), Query Frame = 3
Query:   75 MLIYKXXXXXXXXXXXXYPMK-LIDDIVYEFNGKNIT-IKNGIPDEAIGGNKSAEGGDDDYSESCE-TQIDIVYANRLVEMSYSKKEYTTYIKDYMKRILDILKTKNPARVDVFKTNAQKYITEILKNFKEYKFYTGESMNPDAMVILCNYREDQITPYFIVFKDGVVEEKC 581
            M+IYKDI++ DE+ SD Y +K   D   +E  G  ++ ++  I D   GGN SAEGG+ D SES   + +DIV  ++L E S+SK++Y  YIK YMK I + L  K+P +V+ F T A K + ++LK FK+++F+TGESMNPD MV L N+RED ITPY + FKDG+  EKC
Sbjct:    1 MIIYKDILTGDEMFSDIYKIKETADGACFEVEGTMVSRVEGDIDDAVFGGNASAEGGEFDSSESSTVSGVDIVLNHKLQETSFSKEKYIAYIKAYMKTIKENLMEKHPEKVEPFMTAAAKKVKDVLKQFKDFQFFTGESMNPDGMVALLNFREDGITPYMLFFKDGLEIEKC 172          
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Yeast
Match: TMA19 (Protein that associates with ribosomes; homolog of translationally controlled tumor protein; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm and relocates to the mitochondrial outer surface upon oxidative stress [Source:SGD;Acc:S000001539])

HSP 1 Score: 144.05 bits (362), Expect = 2.569e-44
Identity = 78/168 (46.43%), Postives = 115/168 (68.45%), Query Frame = 3
Query:   75 MLIYKXXXXXXXXXXXXYPMKLIDDIVYEFNGKNITIKNGIPDEAIGGNKSAEGGDDDYSESCETQIDIVYANRLVEMSYSKKEYTTYIKDYMKRILDILKTKNPARVDVFKTNAQKYITEILKNFKEYKFYTGESMNPDAMVILCNYREDQITPYFIVFKDGVVEEK 578
            M+IYKDI S+DE+ SD+Y  KL+DD++YE +   + +     D  IG N SAEGGDDD  E  E   ++V++ RL + ++ KK + TYIK YMK +   L+  NP  V  F+  AQ Y+ +++ +FK+++F+TGESM+PDAMV++ NYRED  TP+  ++K G+VEEK
Sbjct:    1 MIIYKDIFSNDELLSDAYDAKLVDDVIYEADCAMVNVGGDNID--IGANPSAEGGDDDVEEGAEMVNNVVHSFRLQQTAFDKKSFLTYIKGYMKAVKAKLQETNPEEVPKFEKGAQTYVKKVIGSFKDWEFFTGESMDPDAMVVMLNYREDGTTPFVAIWKHGIVEEK 166          
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Nematostella
Match: EDO32702 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUA9])

HSP 1 Score: 73.1738 bits (178), Expect = 1.444e-16
Identity = 52/144 (36.11%), Postives = 72/144 (50.00%), Query Frame = 3
Query:  186 KNGIPDEAIGGNKSAEGGDDDYSESCETQIDIVYANRLVEMSYSK-KEYTTYIKDYMKRILDILKTKNPARVDV--FKTNAQKYITEILKNFKEYKFYTGES-MNPDAMVI---------LCNYREDQITPYFIVFKDGVVEEK 578
            K GI +  IGGNKSAE   DD  + C T  ++V ANRLVE+ Y   KE     K Y+K++ + +K +     +V  F+  A  YI  I KNFKEY+F+  +  +   A  I         L    +D  +P   VFK  V + K
Sbjct:    1 KQGIDENLIGGNKSAEDACDDVEDGCTTGCNVVMANRLVEIPYKTFKELLAEFKPYIKKVKEHMKEEGCPDEEVKGFEKAAMDYILSIKKNFKEYQFFQPDCDLGGGAHCIVFMWYPEKDLRGVDQDGFSPVLTVFKHAVKQVK 144          
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Medaka
Match: tpt1 (tumor protein, translationally-controlled 1 [Source:NCBI gene;Acc:100304446])

HSP 1 Score: 132.109 bits (331), Expect = 9.711e-39
Identity = 81/169 (47.93%), Postives = 102/169 (60.36%), Query Frame = 3
Query:   75 MLIYKXXXXXXXXXXXXYPMKLIDDIVYEFNGKNITIKNGIPDEAIGGNKSAEGGDDDYSESCETQIDIVYANRLVEMSYSKKEYTTYIKDYMKRILDILKTKNPARVDVFKTNAQKYITEILKNFKEYKFYTGESMNPDAMVILCNYREDQITPYFIVFKDGVVEEKC 581
            M+IYK +IS DE+ SD Y +K  + I YE  GK +T   G  D  IG N SAE   +    S  + +DIV  + L E  + KK Y TYIKDYMK I   L+  NP RV+ F   AQ  +  ++ N K Y+FYTGESMNP+  V L +YRED ITPY + FKDG+  EKC
Sbjct:    1 MIIYKCVISGDEMFSDIYKIKETE-IFYEVEGKTVTRTEGFDDALIGANASAEEATETNESSTVSGVDIVLNHNLQETGFDKKGYLTYIKDYMKSIKAKLQESNPDRVEKFMAEAQVAVKGVVGNIKNYQFYTGESMNPEGTVGLLDYREDGITPYMLFFKDGLEIEKC 168          
BLAST of Translationally-controlled tumor protein homolog vs. Planmine SMEST
Match: SMESG000023212.1 (SMESG000023212.1)

HSP 1 Score: 312.383 bits (799), Expect = 7.150e-110
Identity = 168/169 (99.41%), Postives = 169/169 (100.00%), Query Frame = 3
Query:   75 MLIYKXXXXXXXXXXXXYPMKLIDDIVYEFNGKNITIKNGIPDEAIGGNKSAEGGDDDYSESCETQIDIVYANRLVEMSYSKKEYTTYIKDYMKRILDILKTKNPARVDVFKTNAQKYITEILKNFKEYKFYTGESMNPDAMVILCNYREDQITPYFIVFKDGVVEEKC 581
            MLIYKDIISDDEISSDSYPMKLIDDIVYEFNGKNITIKNGIPDEAIGGNKSAEGGDDDYSESCETQIDIVYANRLVEMSYSKKEYTTYIKDYMKRILDILKTKNPARV+VFKTNAQKYITEILKNFKEYKFYTGESMNPDAMVILCNYREDQITPYFIVFKDGVVEEKC
Sbjct:    1 MLIYKDIISDDEISSDSYPMKLIDDIVYEFNGKNITIKNGIPDEAIGGNKSAEGGDDDYSESCETQIDIVYANRLVEMSYSKKEYTTYIKDYMKRILDILKTKNPARVNVFKTNAQKYITEILKNFKEYKFYTGESMNPDAMVILCNYREDQITPYFIVFKDGVVEEKC 169          
BLAST of Translationally-controlled tumor protein homolog vs. Planmine SMEST
Match: SMESG000013566.1 (SMESG000013566.1)

HSP 1 Score: 210.69 bits (535), Expect = 3.708e-69
Identity = 99/153 (64.71%), Postives = 121/153 (79.08%), Query Frame = 3
Query:  126 YPMKLIDDIVYEFNGKNITIKNGIPDEAIGGNKSAEG-GDDDYSESCETQIDIVYANRLVEMSYSKKEYTTYIKDYMKRILDILKTKNPARVDVFKTNAQKYITEILKNFKEYKFYTGESMNPDAMVILCNYREDQITPYFIVFKDGVVEEKC 581
            +PM ++DD+VYEFNG+NITIKNGI D   GGN S E  GDDD ++S ET IDIVY+NRLVEMS+ KK YT+YIK YMK IL+ L   N  R ++FK+    Y+T+I+KNF EY+FY GESMNPD M+I CNYREDQITPYF++FKDG+ EEKC
Sbjct:   56 FPMTIVDDVVYEFNGRNITIKNGISDALFGGNASEEAAGDDDVADSDETAIDIVYSNRLVEMSFDKKGYTSYIKGYMKSILERLNATNKERAEIFKSKVGAYVTKIIKNFDEYRFYCGESMNPDGMIIPCNYREDQITPYFVLFKDGLEEEKC 208          
The following BLAST results are available for this feature:
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TPT11.639e-4048.89tumor protein, translationally-controlled 1 [Sourc... [more]
TPT13.546e-4049.42tumor protein, translationally-controlled 1 [Sourc... [more]
TPT16.056e-4048.34tumor protein, translationally-controlled 1 [Sourc... [more]
TPT16.421e-4049.42tumor protein, translationally-controlled 1 [Sourc... [more]
TPT11.561e-3852.31tumor protein, translationally-controlled 1 [Sourc... [more]
back to top
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tct-16.783e-2542.31Translationally-controlled tumor protein homolog ... [more]
back to top
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Tctp1.890e-3747.40gene:FBgn0037874 transcript:FBtr0347181[more]
Tctp1.890e-3747.40gene:FBgn0037874 transcript:FBtr0082344[more]
back to top
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tpt13.166e-4049.12tumor protein, translationally-controlled 1 [Sourc... [more]
tpt13.504e-4048.97tumor protein, translationally-controlled 1 [Sourc... [more]
tpt13.184e-1148.96tumor protein, translationally-controlled 1 [Sourc... [more]
tpt13.184e-1148.96tumor protein, translationally-controlled 1 [Sourc... [more]
back to top
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tpt12.501e-3544.19tumor protein, translationally-controlled 1 [Sourc... [more]
tpt11.103e-1237.59tumor protein, translationally-controlled 1 [Sourc... [more]
back to top
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Tpt18.680e-3947.67tumor protein, translationally-controlled 1 [Sourc... [more]
Tpt12.185e-3748.87tumor protein, translationally-controlled 1 [Sourc... [more]
back to top
BLAST of Translationally-controlled tumor protein homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P91800|TCTP_SCHJA4.712e-4647.02Translationally-controlled tumor protein homolog O... [more]
sp|Q95VY2|TCTP_BRABE1.959e-4349.40Translationally-controlled tumor protein homolog O... [more]
sp|Q10344|TCTP_SCHPO4.630e-4354.17Translationally-controlled tumor protein homolog O... [more]
sp|P35691|TCTP_YEAST1.784e-4246.43Translationally-controlled tumor protein homolog O... [more]
sp|Q6BP09|TCTP_DEBHA1.632e-4145.83Translationally-controlled tumor protein homolog O... [more]
back to top
BLAST of Translationally-controlled tumor protein homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8J4X71.910e-5252.87TCTP domain-containing protein OS=Macrostomum lign... [more]
A0A267GJW33.430e-5253.53TCTP domain-containing protein OS=Macrostomum lign... [more]
A0A267GN295.916e-5252.94TCTP domain-containing protein OS=Macrostomum lign... [more]
A0A267EZB41.295e-5153.53TCTP domain-containing protein OS=Macrostomum lign... [more]
A0A0D2X0X01.770e-5053.80Translationally-controlled tumor protein OS=Capsas... [more]
back to top
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tpt16.359e-3847.37tumor protein, translationally-controlled 1 [Sourc... [more]
tpt18.166e-3846.90tumor protein, translationally-controlled 1 [Sourc... [more]
back to top
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000009867.13.828e-4348.84pep scaffold:Pmarinus_7.0:GL478379:189408:194610:-... [more]
back to top
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
TMA192.569e-4446.43Protein that associates with ribosomes; homolog of... [more]
back to top
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO327021.444e-1636.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Translationally-controlled tumor protein homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tpt19.711e-3947.93tumor protein, translationally-controlled 1 [Sourc... [more]
back to top
BLAST of Translationally-controlled tumor protein homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000023212.17.150e-11099.41SMESG000023212.1[more]
SMESG000013566.13.708e-6964.71SMESG000013566.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022078 ID=SMED30022078|Name=Translationally-controlled tumor protein homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=629bp
GTCAAATATCTTAAATTTGTTTGTTTAAATACTTGTTTACACTAAACACT
TTTATTTTGAAAGTTTATTCCACGATGTTAATTTACAAAGACATAATTTC
GGATGATGAAATAAGCAGTGATTCATATCCAATGAAACTGATTGATGATA
TTGTGTACGAATTTAATGGAAAGAATATTACCATTAAAAATGGCATACCC
GATGAAGCAATCGGTGGAAATAAATCTGCTGAAGGTGGAGATGATGATTA
TTCTGAATCATGTGAAACTCAAATAGACATAGTCTATGCTAATCGACTAG
TAGAAATGAGTTATTCGAAAAAAGAGTACACTACTTATATTAAGGATTAC
ATGAAAAGAATACTCGATATTCTTAAAACTAAGAATCCTGCTCGAGTTGA
TGTATTTAAAACGAATGCTCAAAAATATATTACGGAAATTCTTAAAAATT
TTAAAGAATACAAATTCTACACGGGTGAATCAATGAATCCTGATGCCATG
GTAATTTTATGCAATTATCGGGAGGATCAAATTACTCCTTATTTCATCGT
CTTTAAAGATGGTGTTGTGGAAGAAAAATGCTAGGCCAAATTGCCAATGG
AATGTTATATTAATAAAGAATTGATTGAC
back to top

protein sequence of SMED30022078-orf-1

>SMED30022078-orf-1 ID=SMED30022078-orf-1|Name=SMED30022078-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=170bp
MLIYKDIISDDEISSDSYPMKLIDDIVYEFNGKNITIKNGIPDEAIGGNK
SAEGGDDDYSESCETQIDIVYANRLVEMSYSKKEYTTYIKDYMKRILDIL
KTKNPARVDVFKTNAQKYITEILKNFKEYKFYTGESMNPDAMVILCNYRE
DQITPYFIVFKDGVVEEKC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000028Category 2 cell
PLANA:0000035Category 3 cell
PLANA:0000039gamma neoblast
PLANA:0000070intestinal phagocyte
PLANA:0000429neoblast
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR034737TCTP
IPR018105Translational_control_tumour_p
IPR011323Mss4/transl-control_tumour
IPR018103Translation_control_tumour_CS
IPR011057Mss4-like_sf
Vocabulary: biological process
TermDefinition
GO:0002181cytoplasmic translation
GO:0030154cell differentiation
GO:0050790regulation of catalytic activity
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
GO:0005515protein binding
GO:0008017microtubule binding
GO:1990624guanyl nucleotide exchange factor inhibitor activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005829cytosol
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR018105Translationally controlled tumour proteinPRINTSPR01653TCTPROTEINcoord: 47..58
score: 61.31
coord: 1..21
score: 54.93
coord: 59..78
score: 31.61
IPR018105Translationally controlled tumour proteinPFAMPF00838TCTPcoord: 1..164
e-value: 2.2E-61
score: 207.0
IPR018105Translationally controlled tumour proteinPANTHERPTHR11991TRANSLATIONALLY CONTROLLED TUMOR PROTEIN-RELATEDcoord: 1..169
IPR011323Mss4/translationally controlled tumour-associated TCTPGENE3DG3DSA:2.170.150.10coord: 1..169
e-value: 4.8E-67
score: 227.3
NoneNo IPR availablePANTHERPTHR11991:SF0TRANSLATIONALLY-CONTROLLED TUMOR PROTEINcoord: 1..169
IPR018103Translationally controlled tumour protein, conserved sitePROSITEPS01002TCTP_1coord: 46..56
IPR018103Translationally controlled tumour protein, conserved sitePROSITEPS01003TCTP_2coord: 126..148
IPR034737Translationally controlled tumour protein (TCTP) domainPROSITEPS51797TCTP_3coord: 1..169
score: 62.333
IPR011057Mss4-like superfamilySUPERFAMILYSSF51316Mss4-likecoord: 1..169