Cytospin-A

Overview
NameCytospin-A
Smed IDSMED30022077
Length (bp)1538
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cytospin-A (SMED30022077) t-SNE clustered cells

Violin plots show distribution of expression levels for Cytospin-A (SMED30022077) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cytospin-A (SMED30022077) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cytospin-A (SMED30022077) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022077

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30022077SMESG000039310.1 dd_Smed_v4_6934_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30022077SMESG000039310.1 dd_Smed_v4_6934_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30022077SMESG000039310.1 dd_Smed_v4_6934_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
oocyteSMED30022077SMESG000039310.1 Contig49822newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30022077SMESG000039310.1 Contig49822uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30022077SMESG000039310.1 Contig49822newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30022077SMESG000039310.1 Contig49822uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30022077SMESG000039310.1 Contig49822newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30022077SMESG000039310.1 Contig49822uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30022077SMESG000039310.1 dd_Smed_v4_6934_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30022077SMESG000039310.1 dd_Smed_v4_6934_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cytospin-A vs. Ensembl Human
Match: SMTN (smoothelin [Source:HGNC Symbol;Acc:HGNC:11126])

HSP 1 Score: 132.109 bits (331), Expect = 4.341e-34
Identity = 56/107 (52.34%), Postives = 80/107 (74.77%), Query Frame = 3
Query: 1068 ATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFTYVQCFYK 1388
            A S K ++L +C+  T  YE   V + N SSSWSDG+AFCAL+H+F PEAFD+ +L+  NR+ NFE+AF+SA+ +AD   LLD +DM+ + +PDWKC++TY+Q FY+
Sbjct:  194 ANSIKQMLLDWCRAKTRGYEH--VDIQNFSSSWSDGMAFCALVHNFFPEAFDYGQLSPQNRRQNFEVAFSSAETHADCPQLLDTEDMVRLREPDWKCVYTYIQEFYR 298          
BLAST of Cytospin-A vs. Ensembl Human
Match: SMTN (smoothelin [Source:HGNC Symbol;Acc:HGNC:11126])

HSP 1 Score: 136.732 bits (343), Expect = 2.003e-33
Identity = 61/113 (53.98%), Postives = 81/113 (71.68%), Query Frame = 3
Query: 1068 ATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIM-EKPDWKCIFTYVQCFYKAFRTH 1403
            A S K ++L +C+  T  YE   V + N SSSWSDG+AFCAL+H+F PEAFD+ +L+  NR+ NFE+AF+SA+   D  PL+++DDMMIM +KPD KC+FTYVQ  Y   R H
Sbjct:  798 ANSIKQMLLDWCRAKTRGYE--HVDIQNFSSSWSDGMAFCALVHNFFPEAFDYGQLSPQNRRQNFEVAFSSAEMLVDCVPLVEVDDMMIMGKKPDPKCVFTYVQSLYNHLRRH 908          
BLAST of Cytospin-A vs. Ensembl Human
Match: SMTN (smoothelin [Source:HGNC Symbol;Acc:HGNC:11126])

HSP 1 Score: 136.732 bits (343), Expect = 2.218e-33
Identity = 61/113 (53.98%), Postives = 81/113 (71.68%), Query Frame = 3
Query: 1068 ATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIM-EKPDWKCIFTYVQCFYKAFRTH 1403
            A S K ++L +C+  T  YE   V + N SSSWSDG+AFCAL+H+F PEAFD+ +L+  NR+ NFE+AF+SA+   D  PL+++DDMMIM +KPD KC+FTYVQ  Y   R H
Sbjct:  883 ANSIKQMLLDWCRAKTRGYE--HVDIQNFSSSWSDGMAFCALVHNFFPEAFDYGQLSPQNRRQNFEVAFSSAEMLVDCVPLVEVDDMMIMGKKPDPKCVFTYVQSLYNHLRRH 993          
BLAST of Cytospin-A vs. Ensembl Human
Match: SMTN (smoothelin [Source:HGNC Symbol;Acc:HGNC:11126])

HSP 1 Score: 130.954 bits (328), Expect = 1.502e-32
Identity = 56/107 (52.34%), Postives = 80/107 (74.77%), Query Frame = 3
Query: 1068 ATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFTYVQCFYK 1388
            A S K ++L +C+  T  YE   V + N SSSWSDG+AFCAL+H+F PEAFD+ +L+  NR+ NFE+AF+SA+ +AD   LLD +DM+ + +PDWKC++TY+Q FY+
Sbjct:  321 ANSIKQMLLDWCRAKTRGYE--HVDIQNFSSSWSDGMAFCALVHNFFPEAFDYGQLSPQNRRQNFEVAFSSAETHADCPQLLDTEDMVRLREPDWKCVYTYIQEFYR 425          
BLAST of Cytospin-A vs. Ensembl Human
Match: SMTN (smoothelin [Source:HGNC Symbol;Acc:HGNC:11126])

HSP 1 Score: 133.65 bits (335), Expect = 2.170e-32
Identity = 56/107 (52.34%), Postives = 80/107 (74.77%), Query Frame = 3
Query: 1068 ATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFTYVQCFYK 1388
            A S K ++L +C+  T  YE   V + N SSSWSDG+AFCAL+H+F PEAFD+ +L+  NR+ NFE+AF+SA+ +AD   LLD +DM+ + +PDWKC++TY+Q FY+
Sbjct:  798 ANSIKQMLLDWCRAKTRGYE--HVDIQNFSSSWSDGMAFCALVHNFFPEAFDYGQLSPQNRRQNFEVAFSSAETHADCPQLLDTEDMVRLREPDWKCVYTYIQEFYR 902          
BLAST of Cytospin-A vs. Ensembl Celegans
Match: T15B12.1 (pep chromosome:WBcel235:III:5294501:5298361:1 gene:WBGene00020530.1 transcript:T15B12.1a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T15B12.1)

HSP 1 Score: 133.265 bits (334), Expect = 9.265e-36
Identity = 65/123 (52.85%), Postives = 85/123 (69.11%), Query Frame = 3
Query: 1041 TPLRRFNRSATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIM-EKPDWKCIFTYVQCFYKAFRTHP 1406
             P R+ N    S KD +L + +     Y    V V N SSSW+DG+AFCALIH F P +FDFSKL+  NR++NF+LAF  A+    I+PLL++DDM++M ++PDWKC+FTYVQ FYK FR HP
Sbjct:  105 APPRQLN--PNSIKDALLRWIQNRVAGYP--NVNVTNFSSSWADGMAFCALIHRFAPNSFDFSKLDPNNRRYNFDLAFKVAEDNG-IFPLLEVDDMIMMGDRPDWKCVFTYVQSFYKQFRDHP 222          
BLAST of Cytospin-A vs. Ensembl Celegans
Match: T15B12.1 (pep chromosome:WBcel235:III:5294620:5298361:1 gene:WBGene00020530.1 transcript:T15B12.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T15B12.1)

HSP 1 Score: 133.265 bits (334), Expect = 9.265e-36
Identity = 65/123 (52.85%), Postives = 85/123 (69.11%), Query Frame = 3
Query: 1041 TPLRRFNRSATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIM-EKPDWKCIFTYVQCFYKAFRTHP 1406
             P R+ N    S KD +L + +     Y    V V N SSSW+DG+AFCALIH F P +FDFSKL+  NR++NF+LAF  A+    I+PLL++DDM++M ++PDWKC+FTYVQ FYK FR HP
Sbjct:  105 APPRQLN--PNSIKDALLRWIQNRVAGYP--NVNVTNFSSSWADGMAFCALIHRFAPNSFDFSKLDPNNRRYNFDLAFKVAEDNG-IFPLLEVDDMIMMGDRPDWKCVFTYVQSFYKQFRDHP 222          
BLAST of Cytospin-A vs. Ensembl Celegans
Match: T15B12.1 (pep chromosome:WBcel235:III:5288180:5298361:1 gene:WBGene00020530.1 transcript:T15B12.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T15B12.1)

HSP 1 Score: 132.88 bits (333), Expect = 8.553e-34
Identity = 65/123 (52.85%), Postives = 85/123 (69.11%), Query Frame = 3
Query: 1041 TPLRRFNRSATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIM-EKPDWKCIFTYVQCFYKAFRTHP 1406
             P R+ N    S KD +L + +     Y    V V N SSSW+DG+AFCALIH F P +FDFSKL+  NR++NF+LAF  A+    I+PLL++DDM++M ++PDWKC+FTYVQ FYK FR HP
Sbjct:  315 APPRQLN--PNSIKDALLRWIQNRVAGYP--NVNVTNFSSSWADGMAFCALIHRFAPNSFDFSKLDPNNRRYNFDLAFKVAEDNG-IFPLLEVDDMIMMGDRPDWKCVFTYVQSFYKQFRDHP 432          
BLAST of Cytospin-A vs. Ensembl Celegans
Match: atn-1 (AcTiniN [Source:UniProtKB/TrEMBL;Acc:Q9XVU8])

HSP 1 Score: 98.5969 bits (244), Expect = 1.731e-21
Identity = 51/115 (44.35%), Postives = 67/115 (58.26%), Query Frame = 3
Query: 1056 FNRSATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFTYVQCFYKAFRT 1400
             N    SA+D +L++C+  T  Y    V V N  +SW DGLAFCALIH   P+  D+S+L+K +   N  LAF  A+K+ DI  +LD +D  +   PD K   TYV CFY AFR 
Sbjct:   74 INVEELSARDGLLLWCQRKTAPYN--NVNVQNFHNSWKDGLAFCALIHRHRPDLLDYSQLHKGDPIHNLNLAFDIAEKHLDIPKMLDAED--VSRHPDEKSTMTYVSCFYHAFRN 184          
BLAST of Cytospin-A vs. Ensembl Celegans
Match: atn-1 (AcTiniN [Source:UniProtKB/TrEMBL;Acc:Q9XVU8])

HSP 1 Score: 98.5969 bits (244), Expect = 2.067e-21
Identity = 51/115 (44.35%), Postives = 67/115 (58.26%), Query Frame = 3
Query: 1056 FNRSATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFTYVQCFYKAFRT 1400
             N    SA+D +L++C+  T  Y    V V N  +SW DGLAFCALIH   P+  D+S+L+K +   N  LAF  A+K+ DI  +LD +D  +   PD K   TYV CFY AFR 
Sbjct:  145 INVEELSARDGLLLWCQRKTAPYN--NVNVQNFHNSWKDGLAFCALIHRHRPDLLDYSQLHKGDPIHNLNLAFDIAEKHLDIPKMLDAED--VSRHPDEKSTMTYVSCFYHAFRN 255          
BLAST of Cytospin-A vs. Ensembl Fly
Match: CG34417 (gene:FBgn0085446 transcript:FBtr0308093)

HSP 1 Score: 147.132 bits (370), Expect = 6.446e-41
Identity = 66/114 (57.89%), Postives = 84/114 (73.68%), Query Frame = 3
Query: 1056 FNRSATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFTYVQCFYKAFR 1397
             N  A + KD +L +CK  T+EYE   V ++N SSSWSDGLAFCALIHHF P+AFD++ L K  R+ NFELAF+ AD+ A I PLLD++DM+ M +PDWKC+F YVQ  Y+ FR
Sbjct:   97 LNARAATVKDQLLQWCKHKTQEYE--NVQINNFSSSWSDGLAFCALIHHFLPDAFDYTTLTKQTRRHNFELAFSVADEKAGIAPLLDVEDMVEMSRPDWKCVFVYVQSIYRRFR 208          
BLAST of Cytospin-A vs. Ensembl Fly
Match: CG34417 (gene:FBgn0085446 transcript:FBtr0336671)

HSP 1 Score: 152.525 bits (384), Expect = 5.953e-39
Identity = 66/114 (57.89%), Postives = 84/114 (73.68%), Query Frame = 3
Query: 1056 FNRSATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFTYVQCFYKAFR 1397
             N  A + KD +L +CK  T+EYE   V ++N SSSWSDGLAFCALIHHF P+AFD++ L K  R+ NFELAF+ AD+ A I PLLD++DM+ M +PDWKC+F YVQ  Y+ FR
Sbjct:  883 LNARAATVKDQLLQWCKHKTQEYE--NVQINNFSSSWSDGLAFCALIHHFLPDAFDYTTLTKQTRRHNFELAFSVADEKAGIAPLLDVEDMVEMSRPDWKCVFVYVQSIYRRFR 994          
BLAST of Cytospin-A vs. Ensembl Fly
Match: CG34417 (gene:FBgn0085446 transcript:FBtr0336670)

HSP 1 Score: 144.821 bits (364), Expect = 2.299e-36
Identity = 69/123 (56.10%), Postives = 88/123 (71.54%), Query Frame = 3
Query: 1044 PLRRF-----NRSATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFTYVQCFYKAFR 1397
            PL +F     N  A + KD +L +CK  T+EYE   V ++N SSSWSDGLAFCALIHHF P+AFD++ L K  R+ NFELAF+ AD+ A I PLLD++DM+ M +PDWKC+F YVQ  Y+ FR
Sbjct: 1586 PLFKFTDPALNARAATVKDQLLQWCKHKTQEYE--NVQINNFSSSWSDGLAFCALIHHFLPDAFDYTTLTKQTRRHNFELAFSVADEKAGIAPLLDVEDMVEMSRPDWKCVFVYVQSIYRRFR 1706          
BLAST of Cytospin-A vs. Ensembl Fly
Match: CG34417 (gene:FBgn0085446 transcript:FBtr0336669)

HSP 1 Score: 144.436 bits (363), Expect = 3.267e-36
Identity = 69/123 (56.10%), Postives = 88/123 (71.54%), Query Frame = 3
Query: 1044 PLRRF-----NRSATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFTYVQCFYKAFR 1397
            PL +F     N  A + KD +L +CK  T+EYE   V ++N SSSWSDGLAFCALIHHF P+AFD++ L K  R+ NFELAF+ AD+ A I PLLD++DM+ M +PDWKC+F YVQ  Y+ FR
Sbjct: 1703 PLFKFTDPALNARAATVKDQLLQWCKHKTQEYE--NVQINNFSSSWSDGLAFCALIHHFLPDAFDYTTLTKQTRRHNFELAFSVADEKAGIAPLLDVEDMVEMSRPDWKCVFVYVQSIYRRFR 1823          
BLAST of Cytospin-A vs. Ensembl Fly
Match: CG34417 (gene:FBgn0085446 transcript:FBtr0336673)

HSP 1 Score: 143.665 bits (361), Expect = 6.970e-36
Identity = 69/123 (56.10%), Postives = 88/123 (71.54%), Query Frame = 3
Query: 1044 PLRRF-----NRSATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFTYVQCFYKAFR 1397
            PL +F     N  A + KD +L +CK  T+EYE   V ++N SSSWSDGLAFCALIHHF P+AFD++ L K  R+ NFELAF+ AD+ A I PLLD++DM+ M +PDWKC+F YVQ  Y+ FR
Sbjct: 5005 PLFKFTDPALNARAATVKDQLLQWCKHKTQEYE--NVQINNFSSSWSDGLAFCALIHHFLPDAFDYTTLTKQTRRHNFELAFSVADEKAGIAPLLDVEDMVEMSRPDWKCVFVYVQSIYRRFR 5125          
BLAST of Cytospin-A vs. Ensembl Zebrafish
Match: smtna (smoothelin a [Source:ZFIN;Acc:ZDB-GENE-091204-245])

HSP 1 Score: 134.42 bits (337), Expect = 2.496e-36
Identity = 57/105 (54.29%), Postives = 78/105 (74.29%), Query Frame = 3
Query: 1080 KDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFTYVQCFYKAF 1394
            K ++L +C++ TE YE  GV + N SSSW+DGLAFCAL+H F PE F++  LN  +RK NFE AF +A++ AD  PLLD+DD+M M +PDWKC++TY+Q FY+  
Sbjct:   82 KQMLLDWCRVKTEPYE--GVNIQNFSSSWADGLAFCALVHRFFPEGFEYCTLNPYDRKSNFEKAFKTAERLADCPPLLDVDDLMRMREPDWKCVYTYIQEFYRCL 184          
BLAST of Cytospin-A vs. Ensembl Zebrafish
Match: smtnb (smoothelin b [Source:ZFIN;Acc:ZDB-GENE-070912-2])

HSP 1 Score: 133.65 bits (335), Expect = 1.456e-34
Identity = 57/109 (52.29%), Postives = 80/109 (73.39%), Query Frame = 3
Query: 1068 ATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFTYVQCFYKAF 1394
            A S K ++L +C+  T  YE   V + N SSSWSDG+AFCAL+H+F PEAFD+S L+  NR+ NFE AF++A++ AD   LLD++DM+ M +PDWKC++TY+Q FY+  
Sbjct:  217 ANSIKQMLLDWCRSKTRSYE--NVDIQNFSSSWSDGMAFCALVHNFFPEAFDYSSLSPTNRRQNFETAFSTAERLADCPQLLDVEDMVRMREPDWKCVYTYLQEFYRGL 323          
BLAST of Cytospin-A vs. Ensembl Zebrafish
Match: smtnb (smoothelin b [Source:ZFIN;Acc:ZDB-GENE-070912-2])

HSP 1 Score: 132.494 bits (332), Expect = 2.742e-34
Identity = 57/109 (52.29%), Postives = 80/109 (73.39%), Query Frame = 3
Query: 1068 ATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFTYVQCFYKAF 1394
            A S K ++L +C+  T  YE   V + N SSSWSDG+AFCAL+H+F PEAFD+S L+  NR+ NFE AF++A++ AD   LLD++DM+ M +PDWKC++TY+Q FY+  
Sbjct:  208 ANSIKQMLLDWCRSKTRSYE--NVDIQNFSSSWSDGMAFCALVHNFFPEAFDYSSLSPTNRRQNFETAFSTAERLADCPQLLDVEDMVRMREPDWKCVYTYLQEFYRGL 314          
BLAST of Cytospin-A vs. Ensembl Zebrafish
Match: smtnb (smoothelin b [Source:ZFIN;Acc:ZDB-GENE-070912-2])

HSP 1 Score: 132.109 bits (331), Expect = 7.301e-34
Identity = 57/109 (52.29%), Postives = 80/109 (73.39%), Query Frame = 3
Query: 1068 ATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFTYVQCFYKAF 1394
            A S K ++L +C+  T  YE   V + N SSSWSDG+AFCAL+H+F PEAFD+S L+  NR+ NFE AF++A++ AD   LLD++DM+ M +PDWKC++TY+Q FY+  
Sbjct:  238 ANSIKQMLLDWCRSKTRSYE--NVDIQNFSSSWSDGMAFCALVHNFFPEAFDYSSLSPTNRRQNFETAFSTAERLADCPQLLDVEDMVRMREPDWKCVYTYLQEFYRGL 344          
BLAST of Cytospin-A vs. Ensembl Zebrafish
Match: smtnb (smoothelin b [Source:ZFIN;Acc:ZDB-GENE-070912-2])

HSP 1 Score: 124.02 bits (310), Expect = 2.014e-30
Identity = 55/106 (51.89%), Postives = 76/106 (71.70%), Query Frame = 3
Query: 1068 ATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFT-YVQCF 1382
            A S K ++L +C+  T  YE   V + N SSSWSDG+AFCAL+H+F PEAFD+S L+  NR+ NFE AF++A++ AD   LLD++DM+ M +PDWKC++T Y  C 
Sbjct:  289 ANSIKQMLLDWCRSKTRSYE--NVDIQNFSSSWSDGMAFCALVHNFFPEAFDYSSLSPTNRRQNFETAFSTAERLADCPQLLDVEDMVRMREPDWKCVYTAYANCM 392          
BLAST of Cytospin-A vs. Ensembl Xenopus
Match: smtn (ES1 protein homolog, mitochondrial-like [Source:Xenbase;Acc:XB-GENE-5871768])

HSP 1 Score: 137.117 bits (344), Expect = 3.695e-35
Identity = 59/107 (55.14%), Postives = 82/107 (76.64%), Query Frame = 3
Query: 1068 ATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFTYVQCFYK 1388
            A S K ++L +CK  T  YE   V + N SSSWSDG+AFCAL+H+F PEAFD+++LN  NR+ NF+LAF++A+K+AD   LLD +DM+ M +PDWKC++TY+Q FY+
Sbjct:  284 ANSIKQMLLDWCKAKTRGYEH--VNIQNFSSSWSDGMAFCALVHNFFPEAFDYNQLNPQNRRKNFDLAFSAAEKHADCPQLLDAEDMVRMREPDWKCVYTYIQEFYR 388          
BLAST of Cytospin-A vs. Ensembl Xenopus
Match: smtn (ES1 protein homolog, mitochondrial-like [Source:Xenbase;Acc:XB-GENE-5871768])

HSP 1 Score: 137.117 bits (344), Expect = 1.286e-34
Identity = 59/107 (55.14%), Postives = 82/107 (76.64%), Query Frame = 3
Query: 1068 ATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFTYVQCFYK 1388
            A S K ++L +CK  T  YE   V + N SSSWSDG+AFCAL+H+F PEAFD+++LN  NR+ NF+LAF++A+K+AD   LLD +DM+ M +PDWKC++TY+Q FY+
Sbjct:  347 ANSIKQMLLDWCKAKTRGYE--HVNIQNFSSSWSDGMAFCALVHNFFPEAFDYNQLNPQNRRKNFDLAFSAAEKHADCPQLLDAEDMVRMREPDWKCVYTYIQEFYR 451          
BLAST of Cytospin-A vs. Ensembl Xenopus
Match: smtn (ES1 protein homolog, mitochondrial-like [Source:Xenbase;Acc:XB-GENE-5871768])

HSP 1 Score: 138.272 bits (347), Expect = 5.889e-34
Identity = 59/107 (55.14%), Postives = 82/107 (76.64%), Query Frame = 3
Query: 1068 ATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFTYVQCFYK 1388
            A S K ++L +CK  T  YE   V + N SSSWSDG+AFCAL+H+F PEAFD+++LN  NR+ NF+LAF++A+K+AD   LLD +DM+ M +PDWKC++TY+Q FY+
Sbjct:  932 ANSIKQMLLDWCKAKTRGYE--HVNIQNFSSSWSDGMAFCALVHNFFPEAFDYNQLNPQNRRKNFDLAFSAAEKHADCPQLLDAEDMVRMREPDWKCVYTYIQEFYR 1036          
BLAST of Cytospin-A vs. Ensembl Xenopus
Match: smtn (ES1 protein homolog, mitochondrial-like [Source:Xenbase;Acc:XB-GENE-5871768])

HSP 1 Score: 135.576 bits (340), Expect = 4.037e-33
Identity = 61/113 (53.98%), Postives = 81/113 (71.68%), Query Frame = 3
Query: 1068 ATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIMEK-PDWKCIFTYVQCFYKAFRTH 1403
            A S K ++L +CK  T  YE   V + N SSSWSDG+AFCAL+H+F PEAFD+++LN  NR+ NF+LAF++A+   D  PL++++DMMIM K PD KC+FTYVQ  Y   R H
Sbjct:  883 ANSIKQMLLDWCKAKTRGYE--HVNIQNFSSSWSDGMAFCALVHNFFPEAFDYNQLNPQNRRKNFDLAFSAAEMLVDCVPLVEVEDMMIMGKRPDSKCVFTYVQSLYNHLRRH 993          
BLAST of Cytospin-A vs. Ensembl Xenopus
Match: smtn (ES1 protein homolog, mitochondrial-like [Source:Xenbase;Acc:XB-GENE-5871768])

HSP 1 Score: 135.576 bits (340), Expect = 4.068e-33
Identity = 61/113 (53.98%), Postives = 81/113 (71.68%), Query Frame = 3
Query: 1068 ATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIMEK-PDWKCIFTYVQCFYKAFRTH 1403
            A S K ++L +CK  T  YE   V + N SSSWSDG+AFCAL+H+F PEAFD+++LN  NR+ NF+LAF++A+   D  PL++++DMMIM K PD KC+FTYVQ  Y   R H
Sbjct:  842 ANSIKQMLLDWCKAKTRGYE--HVNIQNFSSSWSDGMAFCALVHNFFPEAFDYNQLNPQNRRKNFDLAFSAAEMLVDCVPLVEVEDMMIMGKRPDSKCVFTYVQSLYNHLRRH 952          
BLAST of Cytospin-A vs. Ensembl Mouse
Match: Smtn (smoothelin [Source:MGI Symbol;Acc:MGI:1354727])

HSP 1 Score: 135.191 bits (339), Expect = 4.433e-33
Identity = 60/113 (53.10%), Postives = 81/113 (71.68%), Query Frame = 3
Query: 1068 ATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIM-EKPDWKCIFTYVQCFYKAFRTH 1403
            A S K ++L +C+  T  YE   V + N SSSWSDG+AFCAL+H+F PEAFD+ +L+  NR+ NFE+AF+SA+   D  PL++++DMMIM +KPD KC+FTYVQ  Y   R H
Sbjct:  804 ANSIKQMLLDWCRAKTRGYE--HVDIQNFSSSWSDGMAFCALVHNFFPEAFDYGQLSPQNRRQNFEMAFSSAEMLVDCVPLVEVEDMMIMGKKPDPKCVFTYVQSLYNHLRRH 914          
BLAST of Cytospin-A vs. Ensembl Mouse
Match: Smtn (smoothelin [Source:MGI Symbol;Acc:MGI:1354727])

HSP 1 Score: 131.339 bits (329), Expect = 6.264e-33
Identity = 56/107 (52.34%), Postives = 80/107 (74.77%), Query Frame = 3
Query: 1068 ATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFTYVQCFYK 1388
            A S K ++L +C+  T  YE   V + N SSSWSDG+AFCAL+H+F PEAFD+ +L+  NR+ NFE+AF+SA+ +AD   LLD +DM+ + +PDWKC++TY+Q FY+
Sbjct:  319 ANSIKQMLLDWCRAKTRGYE--HVDIQNFSSSWSDGMAFCALVHNFFPEAFDYGQLSPQNRRQNFEMAFSSAETHADCPQLLDTEDMVRLREPDWKCVYTYIQEFYR 423          
BLAST of Cytospin-A vs. Ensembl Mouse
Match: Smtn (smoothelin [Source:MGI Symbol;Acc:MGI:1354727])

HSP 1 Score: 133.65 bits (335), Expect = 1.511e-32
Identity = 56/107 (52.34%), Postives = 80/107 (74.77%), Query Frame = 3
Query: 1068 ATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFTYVQCFYK 1388
            A S K ++L +C+  T  YE   V + N SSSWSDG+AFCAL+H+F PEAFD+ +L+  NR+ NFE+AF+SA+ +AD   LLD +DM+ + +PDWKC++TY+Q FY+
Sbjct:  804 ANSIKQMLLDWCRAKTRGYE--HVDIQNFSSSWSDGMAFCALVHNFFPEAFDYGQLSPQNRRQNFEMAFSSAETHADCPQLLDTEDMVRLREPDWKCVYTYIQEFYR 908          
BLAST of Cytospin-A vs. Ensembl Mouse
Match: Smtn (smoothelin [Source:MGI Symbol;Acc:MGI:1354727])

HSP 1 Score: 133.65 bits (335), Expect = 1.511e-32
Identity = 56/107 (52.34%), Postives = 80/107 (74.77%), Query Frame = 3
Query: 1068 ATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFTYVQCFYK 1388
            A S K ++L +C+  T  YE   V + N SSSWSDG+AFCAL+H+F PEAFD+ +L+  NR+ NFE+AF+SA+ +AD   LLD +DM+ + +PDWKC++TY+Q FY+
Sbjct:  804 ANSIKQMLLDWCRAKTRGYE--HVDIQNFSSSWSDGMAFCALVHNFFPEAFDYGQLSPQNRRQNFEMAFSSAETHADCPQLLDTEDMVRLREPDWKCVYTYIQEFYR 908          
BLAST of Cytospin-A vs. Ensembl Mouse
Match: Smtn (smoothelin [Source:MGI Symbol;Acc:MGI:1354727])

HSP 1 Score: 125.561 bits (314), Expect = 6.690e-30
Identity = 61/136 (44.85%), Postives = 83/136 (61.03%), Query Frame = 3
Query: 1068 ATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYA-----------------------DIYPLLDIDDMMIM-EKPDWKCIFTYVQCFYKAFRTH 1403
            A S K ++L +C+  T  YE   V + N SSSWSDG+AFCAL+H+F PEAFD+ +L+  NR+ NFE+AF+SA+ +A                       D  PL++++DMMIM +KPD KC+FTYVQ  Y   R H
Sbjct:  804 ANSIKQMLLDWCRAKTRGYE--HVDIQNFSSSWSDGMAFCALVHNFFPEAFDYGQLSPQNRRQNFEMAFSSAETHADCPQLLDTEDMVRLREPDWKMLVDCVPLVEVEDMMIMGKKPDPKCVFTYVQSLYNHLRRH 937          
BLAST of Cytospin-A vs. UniProt/SwissProt
Match: sp|P53814|SMTN_HUMAN (Smoothelin OS=Homo sapiens OX=9606 GN=SMTN PE=1 SV=7)

HSP 1 Score: 136.732 bits (343), Expect = 9.617e-33
Identity = 61/113 (53.98%), Postives = 81/113 (71.68%), Query Frame = 3
Query: 1068 ATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIM-EKPDWKCIFTYVQCFYKAFRTH 1403
            A S K ++L +C+  T  YE   V + N SSSWSDG+AFCAL+H+F PEAFD+ +L+  NR+ NFE+AF+SA+   D  PL+++DDMMIM +KPD KC+FTYVQ  Y   R H
Sbjct:  798 ANSIKQMLLDWCRAKTRGYE--HVDIQNFSSSWSDGMAFCALVHNFFPEAFDYGQLSPQNRRQNFEVAFSSAEMLVDCVPLVEVDDMMIMGKKPDPKCVFTYVQSLYNHLRRH 908          
BLAST of Cytospin-A vs. UniProt/SwissProt
Match: sp|Q921U8|SMTN_MOUSE (Smoothelin OS=Mus musculus OX=10090 GN=Smtn PE=1 SV=2)

HSP 1 Score: 135.191 bits (339), Expect = 3.101e-32
Identity = 60/113 (53.10%), Postives = 81/113 (71.68%), Query Frame = 3
Query: 1068 ATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIM-EKPDWKCIFTYVQCFYKAFRTH 1403
            A S K ++L +C+  T  YE   V + N SSSWSDG+AFCAL+H+F PEAFD+ +L+  NR+ NFE+AF+SA+   D  PL++++DMMIM +KPD KC+FTYVQ  Y   R H
Sbjct:  804 ANSIKQMLLDWCRAKTRGYE--HVDIQNFSSSWSDGMAFCALVHNFFPEAFDYGQLSPQNRRQNFEMAFSSAEMLVDCVPLVEVEDMMIMGKKPDPKCVFTYVQSLYNHLRRH 914          
BLAST of Cytospin-A vs. UniProt/SwissProt
Match: sp|A8MU46|SMTL1_HUMAN (Smoothelin-like protein 1 OS=Homo sapiens OX=9606 GN=SMTNL1 PE=1 SV=2)

HSP 1 Score: 120.553 bits (301), Expect = 4.798e-28
Identity = 56/122 (45.90%), Postives = 85/122 (69.67%), Query Frame = 3
Query: 1041 TPLRRFNRSATSA----KDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFTYVQCFYKAF 1394
            T L R  ++A +A    K+++L +C+  T++YE   V + N SSSWS G+AFCALIH F P+AFD+++L+   R+ NF LAF++A+K AD   LLD+DDM+ +  PD KC++TY+Q  Y++ 
Sbjct:  364 TALFRNTKAAGAAIGGVKNMLLEWCRAMTKKYE--HVDIQNFSSSWSSGMAFCALIHKFFPDAFDYAELDPAKRRHNFTLAFSTAEKLADCAQLLDVDDMVRLAVPDSKCVYTYIQELYRSL 483          
BLAST of Cytospin-A vs. UniProt/SwissProt
Match: sp|Q99LM3|SMTL1_MOUSE (Smoothelin-like protein 1 OS=Mus musculus OX=10090 GN=Smtnl1 PE=1 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 5.925e-28
Identity = 56/122 (45.90%), Postives = 83/122 (68.03%), Query Frame = 3
Query: 1041 TPLRRFNRSATSA----KDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFTYVQCFYKAF 1394
            T L R  ++A +A    K+++L +C+  T  YE   V + N SSSWS G+AFCALIH F PEAFD+++L+   R+ NF LAF++A+K AD   LL++DDM+ +  PD KC++TY+Q  Y++ 
Sbjct:  329 TALFRNTKAAGAAIGGVKNMLLEWCRAMTRNYE--HVDIQNFSSSWSSGMAFCALIHKFFPEAFDYAELDPAKRRHNFTLAFSTAEKLADCAQLLEVDDMVRLAVPDSKCVYTYIQELYRSL 448          
BLAST of Cytospin-A vs. UniProt/SwissProt
Match: sp|Q8CI12|SMTL2_MOUSE (Smoothelin-like protein 2 OS=Mus musculus OX=10090 GN=Smtnl2 PE=1 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 7.069e-28
Identity = 56/112 (50.00%), Postives = 77/112 (68.75%), Query Frame = 3
Query: 1065 SATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIM-EKPDWKCIFTYVQCFYKAFR 1397
            SA+S K I+L +C+  T  Y+   V + N SSSWSDG+AFCAL+H F P+AFD++ L+   R+ NFELAFT A+  A+   L++++DMM+M  KPD  C+FTYVQ  Y   R
Sbjct:  344 SASSIKQILLEWCRSKTVGYQ--HVDLQNFSSSWSDGMAFCALVHSFFPDAFDYNALSPTQRQKNFELAFTMAENLANCERLIEVEDMMVMGRKPDPMCVFTYVQSLYNHLR 453          
BLAST of Cytospin-A vs. TrEMBL
Match: A0A1I8IPA3 (Calponin-homology (CH) domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 4.726e-41
Identity = 73/117 (62.39%), Postives = 89/117 (76.07%), Query Frame = 3
Query: 1047 LRRFNRSATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFTYVQCFYKAFR 1397
            L+R  +SA + K  +L +CK  T  Y  +GV V NLSSSW DGLAFCALIH FHPEAFDF++L+  NRK NFELAF +A+KYA I PLLD++DM+ M  PDWKC+FTY+Q FYK FR
Sbjct:  255 LKR-TQSAATIKQCLLDWCKAVTAPYRQWGVEVTNLSSSWGDGLAFCALIHSFHPEAFDFNELSAANRKRNFELAFDTAEKYAGIAPLLDVEDMVTMATPDWKCVFTYLQMFYKKFR 370          
BLAST of Cytospin-A vs. TrEMBL
Match: A0A0L8FRN9 (Calponin-homology (CH) domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22009987mg PE=4 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 1.347e-40
Identity = 69/126 (54.76%), Postives = 93/126 (73.81%), Query Frame = 3
Query: 1041 TPLRRFNRSATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFTYVQCFYKAFRTHPSNRL 1418
             P +   RSA++ K ++L + K  T+EY    V + N SSSWS+GLAFCALIHHF+PE+FDF  L+   R++NF+LAF +A+KYADI PLLD DDM+ M+KPDWKC+FTYVQ FY+  + H  N++
Sbjct:   12 APTKPVMRSASAIKQMLLEWTKAMTQEYAD-KVVITNFSSSWSNGLAFCALIHHFYPESFDFYALDPKKRRYNFDLAFQTAEKYADIAPLLDTDDMVKMQKPDWKCVFTYVQSFYRKLQKHERNKV 136          
BLAST of Cytospin-A vs. TrEMBL
Match: A0A087UWY1 (Smoothelin (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_16007 PE=4 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 9.165e-40
Identity = 71/126 (56.35%), Postives = 94/126 (74.60%), Query Frame = 3
Query: 1035 KQTPLR--------RFNRSATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFTYVQCFYK 1388
            KQTP R           RSA+  KD++L +CK  T EYE   V + N S+SW+DG+AFCALIHHF+P+AF+F  LN  NR++NF+LAF +A++ ADI PLLD++DM+IM+KPDWKC+FTYVQ FY+
Sbjct:  212 KQTPSRPNFQTRGAGVTRSASDIKDMLLQWCKSKTREYE--QVDITNFSTSWNDGMAFCALIHHFYPDAFEFESLNPKNRRYNFDLAFRTAEEKADIAPLLDVEDMVIMKKPDWKCVFTYVQSFYR 335          
BLAST of Cytospin-A vs. TrEMBL
Match: A0A267H2R6 (Calponin-homology (CH) domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001580g1 PE=4 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 9.835e-40
Identity = 66/115 (57.39%), Postives = 89/115 (77.39%), Query Frame = 3
Query: 1062 RSATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFTYVQCFYKAFRTHP 1406
            R+ +  K ++L +C+  T+ Y+  GVCV N SSSWSDGLAFCALIH+FHP++F+F +L    R+ NF+LAF +A+K ADI PLLD++DMM M+ PDWKC+FTYVQ FY+ FR+ P
Sbjct:  228 RNPSQIKQMLLEWCQAATKNYKDKGVCVTNFSSSWSDGLAFCALIHNFHPDSFNFDELKASERRKNFQLAFDTAEKVADIAPLLDVEDMMKMKNPDWKCVFTYVQSFYRKFRSVP 342          
BLAST of Cytospin-A vs. TrEMBL
Match: A0A267FQN8 (Calponin-homology (CH) domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001580g2 PE=4 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 1.046e-39
Identity = 66/115 (57.39%), Postives = 89/115 (77.39%), Query Frame = 3
Query: 1062 RSATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFTYVQCFYKAFRTHP 1406
            R+ +  K ++L +C+  T+ Y+  GVCV N SSSWSDGLAFCALIH+FHP++F+F +L    R+ NF+LAF +A+K ADI PLLD++DMM M+ PDWKC+FTYVQ FY+ FR+ P
Sbjct:  228 RNPSQIKQMLLEWCQAATKNYKDKGVCVTNFSSSWSDGLAFCALIHNFHPDSFNFDELKASERRKNFQLAFDTAEKVADIAPLLDVEDMMKMKNPDWKCVFTYVQSFYRKFRSVP 342          
BLAST of Cytospin-A vs. Ensembl Cavefish
Match: smtna (smoothelin a [Source:ZFIN;Acc:ZDB-GENE-091204-245])

HSP 1 Score: 125.176 bits (313), Expect = 3.327e-33
Identity = 54/105 (51.43%), Postives = 75/105 (71.43%), Query Frame = 3
Query: 1080 KDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFTYVQCFYKAF 1394
            K ++L +C+  TE YE  GV + N SSSW+DGLAFCAL+H F PE FD+  L+  +R+ NFE AF +A +  D  PLLD+DD++ M +PDWKC++TY+Q FY+  
Sbjct:   63 KQMLLDWCRAKTEPYE--GVNIQNFSSSWADGLAFCALVHRFFPEGFDYCTLDPYDRRANFEKAFKTA-RLGDCAPLLDVDDLLRMREPDWKCVYTYIQEFYRCL 164          
BLAST of Cytospin-A vs. Ensembl Cavefish
Match: ENSAMXT00000056105.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000095.1:180394:186664:-1 gene:ENSAMXG00000031006.1 transcript:ENSAMXT00000056105.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 127.872 bits (320), Expect = 9.300e-33
Identity = 57/109 (52.29%), Postives = 79/109 (72.48%), Query Frame = 3
Query: 1068 ATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFTYVQCFYKAF 1394
            A S K ++L +C+  T +YE   V + N SSSWSDG+AFCAL+H+F PEAFD++ L+  NR+ NFE+AF +A   AD   LLD+DDM+ M +PDWKC++TY+Q FY+  
Sbjct:  198 ANSIKQMLLDWCRAKTRDYE--NVDIQNFSSSWSDGMAFCALVHNFFPEAFDYAALSPSNRRQNFEVAFKTAT-LADCPQLLDVDDMVRMREPDWKCVYTYLQEFYRGL 303          
BLAST of Cytospin-A vs. Ensembl Cavefish
Match: smtnl (smoothelin like 2 [Source:NCBI gene;Acc:103036153])

HSP 1 Score: 122.479 bits (306), Expect = 1.202e-29
Identity = 56/112 (50.00%), Postives = 79/112 (70.54%), Query Frame = 3
Query: 1065 SATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIM-EKPDWKCIFTYVQCFYKAFR 1397
            SA+S K I+L +C+  T  Y+   + + N SSSWSDG+AFCAL+H F P  FD++ L+ V+RK NFELAF++A+K+A    L++++DMM+M  KPD  C+FTYVQ  Y   R
Sbjct:  392 SASSIKQILLEWCRSKTIGYQ--NIDIQNFSSSWSDGMAFCALVHSFFPTEFDYNALSPVDRKHNFELAFSTAEKHAGCDRLIEVEDMMVMGRKPDPMCVFTYVQSLYNHLR 501          
BLAST of Cytospin-A vs. Ensembl Cavefish
Match: smtnl1 (smoothelin-like 1 [Source:ZFIN;Acc:ZDB-GENE-050306-23])

HSP 1 Score: 115.546 bits (288), Expect = 1.105e-27
Identity = 57/107 (53.27%), Postives = 71/107 (66.36%), Query Frame = 3
Query: 1065 SATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIM-EKPDWKCIFTYVQCF 1382
               S K  IL +C   T +YE  GV ++N SSSWSDGLAFCAL+H F P AFDFS L    R+ NF LAF++A+  AD  PLLD+ DM++M +KPD   +FTYVQ  
Sbjct:  221 GGASIKQKILQWCSNKTRDYE--GVSIENFSSSWSDGLAFCALVHRFFPTAFDFSTLKASEREKNFTLAFSTAETLADCCPLLDVSDMLLMGKKPDPFSVFTYVQSL 325          
BLAST of Cytospin-A vs. Ensembl Cavefish
Match: smtnl1 (smoothelin-like 1 [Source:ZFIN;Acc:ZDB-GENE-050306-23])

HSP 1 Score: 115.546 bits (288), Expect = 1.862e-27
Identity = 57/107 (53.27%), Postives = 71/107 (66.36%), Query Frame = 3
Query: 1065 SATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIM-EKPDWKCIFTYVQCF 1382
               S K  IL +C   T +YE  GV ++N SSSWSDGLAFCAL+H F P AFDFS L    R+ NF LAF++A+  AD  PLLD+ DM++M +KPD   +FTYVQ  
Sbjct:  258 GGASIKQKILQWCSNKTRDYE--GVSIENFSSSWSDGLAFCALVHRFFPTAFDFSTLKASEREKNFTLAFSTAETLADCCPLLDVSDMLLMGKKPDPFSVFTYVQSL 362          
BLAST of Cytospin-A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008014.1 (pep scaffold:Pmarinus_7.0:GL480769:7574:15080:-1 gene:ENSPMAG00000007250.1 transcript:ENSPMAT00000008014.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 116.316 bits (290), Expect = 3.186e-31
Identity = 60/122 (49.18%), Postives = 83/122 (68.03%), Query Frame = 3
Query: 1035 KQTPLRRFNRSATSAKDII---LMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIM-EKPDWKCIFTYVQCFYK 1388
            + TPL+R + S  S  +++   L +CK  TE Y    V V N SSSW DG+AFCAL+H + PEAFDF++L+  N + NF+LAFT A++ A   PLLD++DM+IM  +PD KC+FTYVQ  + 
Sbjct:    4 QGTPLQR-SASVMSPGNVMQLTLEWCKTRTENYA--NVSVRNFSSSWCDGMAFCALVHSYFPEAFDFAELSPQNPRHNFQLAFTCAERLAHCDPLLDVEDMIIMGNRPDSKCVFTYVQSLFN 122          
BLAST of Cytospin-A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009649.1 (pep scaffold:Pmarinus_7.0:GL478928:16819:21705:-1 gene:ENSPMAG00000008722.1 transcript:ENSPMAT00000009649.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 111.309 bits (277), Expect = 7.305e-30
Identity = 51/89 (57.30%), Postives = 66/89 (74.16%), Query Frame = 3
Query: 1134 GVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIM-EKPDWKCIFTYVQCFYKAFR 1397
             V + N SSSW DG+AFCAL+H + PEAFDF+KL+  N + NF+LAFT A++ A   PLLD+DDM++M +KPD KC+FTYVQ  Y   R
Sbjct:    2 NVTIKNFSSSWCDGMAFCALVHSYFPEAFDFAKLSPQNPRHNFQLAFTCAEQLAHCDPLLDVDDMIMMGKKPDSKCVFTYVQSLYNKLR 90          
BLAST of Cytospin-A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000684.1 (pep scaffold:Pmarinus_7.0:GL483163:49540:93186:-1 gene:ENSPMAG00000000623.1 transcript:ENSPMAT00000000684.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.1301 bits (235), Expect = 3.641e-21
Identity = 49/108 (45.37%), Postives = 66/108 (61.11%), Query Frame = 3
Query: 1071 TSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFTYVQCFYKAF 1394
            TSAK+ +L++C+  T  Y+   V V N  +SW DGLAF ALIH   P+  D+ KL K +   N   AF  A+KY DI  +LD +D++   +PD K I TYV C+Y AF
Sbjct:  113 TSAKEGLLLWCQRKTAPYK--NVNVQNFHTSWKDGLAFNALIHRHRPDLIDYDKLRKDDPIGNLNNAFEVAEKYLDIPKMLDAEDIVNTARPDEKAIMTYVSCYYHAF 218          
BLAST of Cytospin-A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009295.1 (pep scaffold:Pmarinus_7.0:GL479988:2885:20778:1 gene:ENSPMAG00000008383.1 transcript:ENSPMAT00000009295.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.1301 bits (235), Expect = 7.382e-21
Identity = 49/108 (45.37%), Postives = 65/108 (60.19%), Query Frame = 3
Query: 1071 TSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFTYVQCFYKAF 1394
            TSAK+ +L++C+  T  Y+   V V N   SW DGLAF ALIH   P+  D+ KL K +   N   AF  A+KY DI  +LD +D++   +PD K I TYV C+Y AF
Sbjct:  109 TSAKEGLLLWCQRKTAPYK--NVNVQNFHISWKDGLAFNALIHRHRPDLIDYEKLRKDDPITNLNNAFEVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSCYYHAF 214          
BLAST of Cytospin-A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001834.1 (pep scaffold:Pmarinus_7.0:GL482425:158920:175005:1 gene:ENSPMAG00000001663.1 transcript:ENSPMAT00000001834.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 91.2781 bits (225), Expect = 1.598e-19
Identity = 45/112 (40.18%), Postives = 68/112 (60.71%), Query Frame = 3
Query: 1059 NRSATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFTYVQCFYKAF 1394
            ++   SAKD +L++C++ T  Y    V V N ++SW DGLAF A+IH   P+  DF KL K N + N + AF +A+++  +  LLD +  + +++PD K I TYV  FY  F
Sbjct:   69 SKETRSAKDALLLWCQMKTAGYP--NVNVHNFTTSWRDGLAFNAVIHKHRPDLVDFEKLKKSNAQHNLQHAFNAAEQHLGVTKLLDPEADVSVDQPDEKSIITYVVSFYHYF 178          
BLAST of Cytospin-A vs. Ensembl Nematostella
Match: ALPHA-ACTININ (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4X0])

HSP 1 Score: 93.2041 bits (230), Expect = 4.857e-20
Identity = 45/106 (42.45%), Postives = 66/106 (62.26%), Query Frame = 3
Query: 1077 AKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFTYVQCFYKAF 1394
            AKD +L++C+  T  Y+   V V N ++S+ DGLAFCALIH   P+  D+  L K +  +N   AF  A++Y DI  +LD +DM+  E+PD + + TYV  +Y AF
Sbjct:  142 AKDGLLLWCQRKTAPYK--NVSVKNFTTSFKDGLAFCALIHRHRPDLIDYDSLRKEDPLYNLNKAFDVAEQYLDIPRMLDPEDMVETERPDERAVMTYVSSYYHAF 245          
BLAST of Cytospin-A vs. Ensembl Nematostella
Match: EDO37708 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF38])

HSP 1 Score: 93.2041 bits (230), Expect = 6.875e-20
Identity = 50/112 (44.64%), Postives = 69/112 (61.61%), Query Frame = 3
Query: 1074 SAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFTYVQCFYKAFRTHPS 1409
            SAKD +L + K  T+ Y    V V N SSSW DG AF A+IH + P+  DFSKL+K + + N E AF  A+K  ++  LLD++D+++ E PD K I TYV   Y+ F   P+
Sbjct:  157 SAKDALLHWSKKVTQGYPK--VDVKNFSSSWRDGFAFNAIIHRYRPDLVDFSKLSKTSPEANIEYAFHVAEKELNVPRLLDVEDVVVSENPDEKSIMTYVASLYEVFPRTPT 266          
BLAST of Cytospin-A vs. Ensembl Nematostella
Match: EDO36878 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHE7])

HSP 1 Score: 84.3445 bits (207), Expect = 3.294e-18
Identity = 43/121 (35.54%), Postives = 74/121 (61.16%), Query Frame = 3
Query: 1035 KQTPLRRFNRSATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFTYVQCFYKAFR 1397
            K+ P+ +  +S +S   ++L +C+  T++Y   GV + N S+S+ DGLAFCALIH F+P+ FDFS+L   +R+ N+ LA  + +    I  + D++ M+   KP+ + +  YVQ  +  +R
Sbjct:  164 KKKPMMQRQQSVSS---LVLTWCQDVTKDY--PGVEIKNFSTSFYDGLAFCALIHKFNPDKFDFSELTPEDRRHNWTLALETGESVG-ISQMFDLEMMLRQRKPEPRSVQCYVQMIFSKYR 278          
BLAST of Cytospin-A vs. Ensembl Nematostella
Match: EDO42431 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1C0])

HSP 1 Score: 85.8853 bits (211), Expect = 1.543e-17
Identity = 49/121 (40.50%), Postives = 70/121 (57.85%), Query Frame = 3
Query: 1074 SAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFTYVQCFYKAFRTHPSNRLKTVPIS 1436
            SAKD +L++C+  T  Y    V + N ++SW DGLAF A+IH   P+  +F KL K + + N E AF  A+    I PLLD +D+ + + PD K I TYV  +Y  F      ++KTV +S
Sbjct:  143 SAKDALLLWCQSKTVGY--VHVTITNFTTSWRDGLAFNAIIHRHRPDLIEFEKLTKADAEQNLEQAFEVAETQLGITPLLDAEDVNV-DFPDEKSILTYVAAYYHYFA-----KMKTVEVS 255          
BLAST of Cytospin-A vs. Ensembl Nematostella
Match: EDO36124 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJI6])

HSP 1 Score: 77.411 bits (189), Expect = 2.287e-17
Identity = 41/103 (39.81%), Postives = 66/103 (64.08%), Query Frame = 3
Query: 1089 ILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYAD-IYPLLDIDDMMIMEKPDWKCIFTYVQCFYKAF 1394
            +L +C+  T  +E  GV + N ++SW+DGLA CAL H+F PE   +  L+  +R  N+ LAF +A  YA+ I PLL+++D++ ++ P+ K + TYV   Y+ F
Sbjct:    1 MLEWCRRRTRGHE--GVEIQNFTTSWADGLAMCALFHNFSPELIPYETLDPKDRTRNWTLAFEAA--YAEGIDPLLELEDVLRVQVPEPKSLATYVHTIYQHF 99          
BLAST of Cytospin-A vs. Ensembl Medaka
Match: smtna (smoothelin-like protein 1 [Source:NCBI gene;Acc:101166813])

HSP 1 Score: 125.946 bits (315), Expect = 7.332e-33
Identity = 55/110 (50.00%), Postives = 80/110 (72.73%), Query Frame = 3
Query: 1065 SATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFTYVQCFYKAF 1394
            +A + K ++L +C+  TE YE  GV + N SSSW DG+AFCAL+H F P+AF++S LN    + NF+LAF++A+K A   PLLD DD++ M++PDWKC++TY+Q FY+  
Sbjct:  120 NAKNVKQMLLDWCRAKTEPYE--GVDIQNFSSSWKDGIAFCALVHRFFPDAFEYSILNPNKPRDNFQLAFSTAEKMAGCPPLLDADDLVRMQEPDWKCVYTYIQEFYRCL 227          
BLAST of Cytospin-A vs. Ensembl Medaka
Match: ENSORLT00000032959.1 (smoothelin [Source:NCBI gene;Acc:101173151])

HSP 1 Score: 132.109 bits (331), Expect = 3.417e-32
Identity = 57/111 (51.35%), Postives = 80/111 (72.07%), Query Frame = 3
Query: 1068 ATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFTYVQCFYKAFRT 1400
            A S K ++L +C+  T  YE   V + N SSSWSDG+AFCAL+H F P+AFD+S L+  NR+ NFE+AF++A+K  D   LLD++DM+ M +PDWKC++TY+Q FY+   T
Sbjct:  805 ANSIKQMLLDWCRAKTRSYE--HVDIQNFSSSWSDGMAFCALVHSFFPDAFDYSCLSPSNRRHNFEVAFSAAEKLVDCPQLLDVEDMVKMREPDWKCVYTYLQEFYRGLVT 913          
BLAST of Cytospin-A vs. Ensembl Medaka
Match: ENSORLT00000044871.1 (smoothelin [Source:NCBI gene;Acc:101173151])

HSP 1 Score: 132.109 bits (331), Expect = 3.993e-32
Identity = 57/111 (51.35%), Postives = 80/111 (72.07%), Query Frame = 3
Query: 1068 ATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFTYVQCFYKAFRT 1400
            A S K ++L +C+  T  YE   V + N SSSWSDG+AFCAL+H F P+AFD+S L+  NR+ NFE+AF++A+K  D   LLD++DM+ M +PDWKC++TY+Q FY+   T
Sbjct:  923 ANSIKQMLLDWCRAKTRSYE--HVDIQNFSSSWSDGMAFCALVHSFFPDAFDYSCLSPSNRRHNFEVAFSAAEKLVDCPQLLDVEDMVKMREPDWKCVYTYLQEFYRGLVT 1031          
BLAST of Cytospin-A vs. Ensembl Medaka
Match: ENSORLT00000028335.1 (smoothelin [Source:NCBI gene;Acc:101173151])

HSP 1 Score: 131.724 bits (330), Expect = 4.845e-32
Identity = 57/111 (51.35%), Postives = 80/111 (72.07%), Query Frame = 3
Query: 1068 ATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFTYVQCFYKAFRT 1400
            A S K ++L +C+  T  YE   V + N SSSWSDG+AFCAL+H F P+AFD+S L+  NR+ NFE+AF++A+K  D   LLD++DM+ M +PDWKC++TY+Q FY+   T
Sbjct:  830 ANSIKQMLLDWCRAKTRSYE--HVDIQNFSSSWSDGMAFCALVHSFFPDAFDYSCLSPSNRRHNFEVAFSAAEKLVDCPQLLDVEDMVKMREPDWKCVYTYLQEFYRGLVT 938          
BLAST of Cytospin-A vs. Ensembl Medaka
Match: ENSORLT00000007869.2 (smoothelin [Source:NCBI gene;Acc:101173151])

HSP 1 Score: 129.798 bits (325), Expect = 9.907e-32
Identity = 57/111 (51.35%), Postives = 80/111 (72.07%), Query Frame = 3
Query: 1068 ATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFTYVQCFYKAFRT 1400
            A S K ++L +C+  T  YE   V + N SSSWSDG+AFCAL+H F P+AFD+S L+  NR+ NFE+AF++A+K  D   LLD++DM+ M +PDWKC++TY+Q FY+   T
Sbjct:  502 ANSIKQMLLDWCRAKTRSYE--HVDIQNFSSSWSDGMAFCALVHSFFPDAFDYSCLSPSNRRHNFEVAFSAAEKLVDCPQLLDVEDMVKMREPDWKCVYTYLQEFYRGLVT 610          
BLAST of Cytospin-A vs. Planmine SMEST
Match: SMESG000039310.1 (SMESG000039310.1)

HSP 1 Score: 859.751 bits (2220), Expect = 0.000e+0
Identity = 452/459 (98.47%), Postives = 456/459 (99.35%), Query Frame = 3
Query:   60 MSQINSPVIEERINFYSQFDAKELEFQLLEEKSYQNRNIIRQVIXXXXXXXXXXXXXXXPDSSHKDGSNQEIEKLKIQLNETSDFFEQCKIRSTILLLQKNEKKSDLEKQPSLKNIDCGKENCVIKESMKKKTPTGDGKNLVFDEISPNNNILSTVLCFNDSFEFSWIMPFKILSSIEYTWTRDDTKIPVSQTSHLVVGFDGKWASLKIENLKTTDNGLYKLAIHSQRLKRTFLKFNILVNTDNQQLTSTIIDEFVLQKEKPKTDSCSTPAPIYEPKPRLLHKNRFNRHKTMVGQEMLESIKTAQMKDAXXXXXXXXXXXXXXXXKQTPLRRFNRSATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFTYVQCFYKAFRTHPSNRLKTVPIS 1436
            MSQINSPVIEERINFYSQFDAKELEFQLLEEKSYQNRNIIRQVIRKKRKEKDDNVKKNEPDSS KDGSNQEIEKLKIQLNETSDFFEQCKIRSTILLLQKNEKKSDLEKQPSLKNIDCGKENCVIKESMKKKTPTGDGK LVFDEISPNNNILSTVLCFNDSFEFSWIMPFKILSSIEYTWTRDDTKIPVSQTSHLVVGFDGK ASLKIENLKTTDNGLYKLAIHSQRLKRTFLKFNILVNTDNQQLTSTIIDEFVLQKEKPKTDSCSTPAPIYEPKP+LLHKNRFNRHKTMVGQEMLESIKTAQMKDANQNSIN+DESSNISPIKQTPL+RFNRSATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNK+NRKFNFELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFTYVQCFYKAFRTHPSNRLKTVPIS
Sbjct:    1 MSQINSPVIEERINFYSQFDAKELEFQLLEEKSYQNRNIIRQVIRKKRKEKDDNVKKNEPDSSCKDGSNQEIEKLKIQLNETSDFFEQCKIRSTILLLQKNEKKSDLEKQPSLKNIDCGKENCVIKESMKKKTPTGDGKKLVFDEISPNNNILSTVLCFNDSFEFSWIMPFKILSSIEYTWTRDDTKIPVSQTSHLVVGFDGKCASLKIENLKTTDNGLYKLAIHSQRLKRTFLKFNILVNTDNQQLTSTIIDEFVLQKEKPKTDSCSTPAPIYEPKPKLLHKNRFNRHKTMVGQEMLESIKTAQMKDANQNSINVDESSNISPIKQTPLKRFNRSATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKLNRKFNFELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFTYVQCFYKAFRTHPSNRLKTVPIS 459          
BLAST of Cytospin-A vs. Planmine SMEST
Match: SMESG000025457.1 (SMESG000025457.1)

HSP 1 Score: 137.502 bits (345), Expect = 3.431e-36
Identity = 61/113 (53.98%), Postives = 83/113 (73.45%), Query Frame = 3
Query: 1062 RSATSAKDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIM-EKPDWKCIFTYVQCFYKAFR 1397
            RS +S K ++L +C   T++Y   GV + + S SW++G+AFCALIHHF PEAFDF++L    R  N  LAF +A+K ADI PLLD+ DM++M ++PDWKC+F Y+QCFYK FR
Sbjct:  212 RSPSSIKQLLLEWCIRQTKDYP--GVEIKDFSGSWANGMAFCALIHHFFPEAFDFNQLKPGERSKNLTLAFETAEKLADISPLLDVKDMLMMKDRPDWKCVFCYIQCFYKRFR 322          
BLAST of Cytospin-A vs. Planmine SMEST
Match: SMESG000002849.1 (SMESG000002849.1)

HSP 1 Score: 123.635 bits (309), Expect = 5.753e-30
Identity = 55/114 (48.25%), Postives = 80/114 (70.18%), Query Frame = 3
Query: 1080 KDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFTYVQCFYKAFRTHPSNRLK 1421
            KD++L++ + NT+EY+   V + N S SW+DGLAFCALIHHF+PE+FD+S L+  +   NF LAF +A  YA I PL++  D+ I+  PD KC++TY+Q  Y + ++HP N  K
Sbjct:  448 KDLLLIWIEKNTQEYQ--NVKITNYSKSWADGLAFCALIHHFYPESFDYSVLSSNDPLKNFTLAFETAKNYAGIEPLIEPGDVNILGSPDEKCVYTYIQFMYNSLKSHPRNSAK 559          
BLAST of Cytospin-A vs. Planmine SMEST
Match: SMESG000002849.1 (SMESG000002849.1)

HSP 1 Score: 124.02 bits (310), Expect = 6.119e-30
Identity = 55/114 (48.25%), Postives = 80/114 (70.18%), Query Frame = 3
Query: 1080 KDIILMFCKLNTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFTYVQCFYKAFRTHPSNRLK 1421
            KD++L++ + NT+EY+   V + N S SW+DGLAFCALIHHF+PE+FD+S L+  +   NF LAF +A  YA I PL++  D+ I+  PD KC++TY+Q  Y + ++HP N  K
Sbjct:  485 KDLLLIWIEKNTQEYQ--NVKITNYSKSWADGLAFCALIHHFYPESFDYSVLSSNDPLKNFTLAFETAKNYAGIEPLIEPGDVNILGSPDEKCVYTYIQFMYNSLKSHPRNSAK 596          
BLAST of Cytospin-A vs. Planmine SMEST
Match: SMESG000002849.1 (SMESG000002849.1)

HSP 1 Score: 114.005 bits (284), Expect = 1.001e-26
Identity = 52/115 (45.22%), Postives = 78/115 (67.83%), Query Frame = 3
Query: 1080 KDIILMFCKLNTEEYEPYGVCVD-NLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFNFELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFTYVQCFYKAFRTHPSNRLK 1421
            KD++L++ + NT+EY+   + +      SW+DGLAFCALIHHF+PE+FD+S L+  +   NF LAF +A  YA I PL++  D+ I+  PD KC++TY+Q  Y + ++HP N  K
Sbjct:  448 KDLLLIWIEKNTQEYQLISMILTFKTYLSWADGLAFCALIHHFYPESFDYSVLSSNDPLKNFTLAFETAKNYAGIEPLIEPGDVNILGSPDEKCVYTYIQFMYNSLKSHPRNSAK 562          
The following BLAST results are available for this feature:
BLAST of Cytospin-A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SMTN4.341e-3452.34smoothelin [Source:HGNC Symbol;Acc:HGNC:11126][more]
SMTN2.003e-3353.98smoothelin [Source:HGNC Symbol;Acc:HGNC:11126][more]
SMTN2.218e-3353.98smoothelin [Source:HGNC Symbol;Acc:HGNC:11126][more]
SMTN1.502e-3252.34smoothelin [Source:HGNC Symbol;Acc:HGNC:11126][more]
SMTN2.170e-3252.34smoothelin [Source:HGNC Symbol;Acc:HGNC:11126][more]
back to top
BLAST of Cytospin-A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
T15B12.19.265e-3652.85pep chromosome:WBcel235:III:5294501:5298361:1 gene... [more]
T15B12.19.265e-3652.85pep chromosome:WBcel235:III:5294620:5298361:1 gene... [more]
T15B12.18.553e-3452.85pep chromosome:WBcel235:III:5288180:5298361:1 gene... [more]
atn-11.731e-2144.35AcTiniN [Source:UniProtKB/TrEMBL;Acc:Q9XVU8][more]
atn-12.067e-2144.35AcTiniN [Source:UniProtKB/TrEMBL;Acc:Q9XVU8][more]
back to top
BLAST of Cytospin-A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG344176.446e-4157.89gene:FBgn0085446 transcript:FBtr0308093[more]
CG344175.953e-3957.89gene:FBgn0085446 transcript:FBtr0336671[more]
CG344172.299e-3656.10gene:FBgn0085446 transcript:FBtr0336670[more]
CG344173.267e-3656.10gene:FBgn0085446 transcript:FBtr0336669[more]
CG344176.970e-3656.10gene:FBgn0085446 transcript:FBtr0336673[more]
back to top
BLAST of Cytospin-A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smtna2.496e-3654.29smoothelin a [Source:ZFIN;Acc:ZDB-GENE-091204-245][more]
smtnb1.456e-3452.29smoothelin b [Source:ZFIN;Acc:ZDB-GENE-070912-2][more]
smtnb2.742e-3452.29smoothelin b [Source:ZFIN;Acc:ZDB-GENE-070912-2][more]
smtnb7.301e-3452.29smoothelin b [Source:ZFIN;Acc:ZDB-GENE-070912-2][more]
smtnb2.014e-3051.89smoothelin b [Source:ZFIN;Acc:ZDB-GENE-070912-2][more]
back to top
BLAST of Cytospin-A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smtn3.695e-3555.14ES1 protein homolog, mitochondrial-like [Source:Xe... [more]
smtn1.286e-3455.14ES1 protein homolog, mitochondrial-like [Source:Xe... [more]
smtn5.889e-3455.14ES1 protein homolog, mitochondrial-like [Source:Xe... [more]
smtn4.037e-3353.98ES1 protein homolog, mitochondrial-like [Source:Xe... [more]
smtn4.068e-3353.98ES1 protein homolog, mitochondrial-like [Source:Xe... [more]
back to top
BLAST of Cytospin-A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Smtn4.433e-3353.10smoothelin [Source:MGI Symbol;Acc:MGI:1354727][more]
Smtn6.264e-3352.34smoothelin [Source:MGI Symbol;Acc:MGI:1354727][more]
Smtn1.511e-3252.34smoothelin [Source:MGI Symbol;Acc:MGI:1354727][more]
Smtn1.511e-3252.34smoothelin [Source:MGI Symbol;Acc:MGI:1354727][more]
Smtn6.690e-3044.85smoothelin [Source:MGI Symbol;Acc:MGI:1354727][more]
back to top
BLAST of Cytospin-A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P53814|SMTN_HUMAN9.617e-3353.98Smoothelin OS=Homo sapiens OX=9606 GN=SMTN PE=1 SV... [more]
sp|Q921U8|SMTN_MOUSE3.101e-3253.10Smoothelin OS=Mus musculus OX=10090 GN=Smtn PE=1 S... [more]
sp|A8MU46|SMTL1_HUMAN4.798e-2845.90Smoothelin-like protein 1 OS=Homo sapiens OX=9606 ... [more]
sp|Q99LM3|SMTL1_MOUSE5.925e-2845.90Smoothelin-like protein 1 OS=Mus musculus OX=10090... [more]
sp|Q8CI12|SMTL2_MOUSE7.069e-2850.00Smoothelin-like protein 2 OS=Mus musculus OX=10090... [more]
back to top
BLAST of Cytospin-A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8IPA34.726e-4162.39Calponin-homology (CH) domain-containing protein O... [more]
A0A0L8FRN91.347e-4054.76Calponin-homology (CH) domain-containing protein O... [more]
A0A087UWY19.165e-4056.35Smoothelin (Fragment) OS=Stegodyphus mimosarum OX=... [more]
A0A267H2R69.835e-4057.39Calponin-homology (CH) domain-containing protein O... [more]
A0A267FQN81.046e-3957.39Calponin-homology (CH) domain-containing protein O... [more]
back to top
BLAST of Cytospin-A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smtna3.327e-3351.43smoothelin a [Source:ZFIN;Acc:ZDB-GENE-091204-245][more]
ENSAMXT00000056105.19.300e-3352.29pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
smtnl1.202e-2950.00smoothelin like 2 [Source:NCBI gene;Acc:103036153][more]
smtnl11.105e-2753.27smoothelin-like 1 [Source:ZFIN;Acc:ZDB-GENE-050306... [more]
smtnl11.862e-2753.27smoothelin-like 1 [Source:ZFIN;Acc:ZDB-GENE-050306... [more]
back to top
BLAST of Cytospin-A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008014.13.186e-3149.18pep scaffold:Pmarinus_7.0:GL480769:7574:15080:-1 g... [more]
ENSPMAT00000009649.17.305e-3057.30pep scaffold:Pmarinus_7.0:GL478928:16819:21705:-1 ... [more]
ENSPMAT00000000684.13.641e-2145.37pep scaffold:Pmarinus_7.0:GL483163:49540:93186:-1 ... [more]
ENSPMAT00000009295.17.382e-2145.37pep scaffold:Pmarinus_7.0:GL479988:2885:20778:1 ge... [more]
ENSPMAT00000001834.11.598e-1940.18pep scaffold:Pmarinus_7.0:GL482425:158920:175005:1... [more]
back to top
BLAST of Cytospin-A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Cytospin-A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
ALPHA-ACTININ4.857e-2042.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO377086.875e-2044.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO368783.294e-1835.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424311.543e-1740.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361242.287e-1739.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cytospin-A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smtna7.332e-3350.00smoothelin-like protein 1 [Source:NCBI gene;Acc:10... [more]
ENSORLT00000032959.13.417e-3251.35smoothelin [Source:NCBI gene;Acc:101173151][more]
ENSORLT00000044871.13.993e-3251.35smoothelin [Source:NCBI gene;Acc:101173151][more]
ENSORLT00000028335.14.845e-3251.35smoothelin [Source:NCBI gene;Acc:101173151][more]
ENSORLT00000007869.29.907e-3251.35smoothelin [Source:NCBI gene;Acc:101173151][more]
back to top
BLAST of Cytospin-A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000039310.10.000e+098.47SMESG000039310.1[more]
SMESG000025457.13.431e-3653.98SMESG000025457.1[more]
SMESG000002849.15.753e-3048.25SMESG000002849.1[more]
SMESG000002849.16.119e-3048.25SMESG000002849.1[more]
SMESG000002849.11.001e-2645.22SMESG000002849.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022077 ID=SMED30022077|Name=Cytospin-A|organism=Schmidtea mediterranea sexual|type=transcript|length=1538bp
TAACTACTATTTTATTAGTACTCTCTCCGTTACTGTGTTTTTCTTAAATT
CTAGAAACAATGTCACAAATTAATTCTCCAGTAATTGAAGAAAGAATAAA
TTTTTATTCCCAATTTGATGCAAAAGAATTAGAATTTCAATTATTGGAAG
AAAAATCATATCAAAATCGGAATATTATTCGTCAAGTAATTAGAAAAAAA
AGAAAGGAAAAAGATGACAATGTGAAGAAAAATGAACCTGATTCTTCACA
TAAAGATGGATCCAATCAAGAAATTGAAAAACTCAAAATACAACTCAACG
AAACATCAGATTTTTTTGAGCAATGCAAAATTAGAAGCACAATTTTGCTT
CTTCAAAAGAATGAAAAAAAATCAGATCTGGAAAAACAGCCATCTTTAAA
AAATATTGACTGTGGAAAAGAAAATTGTGTAATTAAGGAAAGTATGAAAA
AAAAAACACCGACTGGAGATGGGAAAAACTTAGTTTTTGATGAAATTTCA
CCGAATAACAACATACTGAGCACGGTGCTGTGCTTCAATGATTCCTTTGA
ATTTTCATGGATTATGCCGTTCAAAATTTTGAGCTCTATCGAATATACCT
GGACGAGAGATGATACAAAAATTCCTGTTTCACAAACTAGTCACCTTGTC
GTCGGATTCGATGGAAAATGGGCTAGTCTTAAAATAGAAAATCTCAAGAC
CACGGACAATGGCCTTTATAAACTTGCAATTCATTCTCAAAGGTTAAAAA
GGACATTTCTCAAATTCAATATCCTAGTCAACACAGATAATCAACAACTT
ACTTCGACAATTATAGATGAGTTTGTCCTTCAGAAAGAGAAACCCAAGAC
AGATTCTTGTTCGACTCCAGCTCCTATATATGAACCCAAACCGAGATTAC
TCCACAAAAACCGATTCAACAGACACAAAACGATGGTCGGACAAGAAATG
CTTGAAAGTATCAAAACTGCTCAAATGAAAGATGCCAATCAAAACAGCAT
AAATATCGACGAATCATCAAACATATCTCCCATAAAACAAACCCCTTTGA
GGAGATTTAACCGCTCCGCAACATCAGCCAAAGATATAATCCTTATGTTT
TGTAAATTAAACACCGAAGAATATGAGCCTTATGGTGTCTGTGTTGATAA
TTTGTCTTCGAGCTGGTCAGACGGGCTAGCGTTTTGTGCCCTGATCCACC
ATTTCCACCCAGAAGCATTTGATTTTTCTAAATTAAATAAAGTAAATCGC
AAATTCAATTTCGAATTGGCATTCACCAGTGCTGATAAATATGCAGATAT
TTATCCCCTGCTAGACATTGACGACATGATGATAATGGAGAAACCAGATT
GGAAATGTATTTTCACATATGTTCAGTGCTTCTACAAGGCATTCAGAACT
CATCCTTCCAACAGATTGAAAACAGTGCCAATTTCTTGAGTTTCTAAAAT
TTATTGTATCTAATTTTTGATGTGAACATAATCTACAGAATTTCATTTTT
AGTTTTAATGAATACATATTTTTTATTTTCGAAAAAAA
back to top

protein sequence of SMED30022077-orf-1

>SMED30022077-orf-1 ID=SMED30022077-orf-1|Name=SMED30022077-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=460bp
MSQINSPVIEERINFYSQFDAKELEFQLLEEKSYQNRNIIRQVIRKKRKE
KDDNVKKNEPDSSHKDGSNQEIEKLKIQLNETSDFFEQCKIRSTILLLQK
NEKKSDLEKQPSLKNIDCGKENCVIKESMKKKTPTGDGKNLVFDEISPNN
NILSTVLCFNDSFEFSWIMPFKILSSIEYTWTRDDTKIPVSQTSHLVVGF
DGKWASLKIENLKTTDNGLYKLAIHSQRLKRTFLKFNILVNTDNQQLTST
IIDEFVLQKEKPKTDSCSTPAPIYEPKPRLLHKNRFNRHKTMVGQEMLES
IKTAQMKDANQNSINIDESSNISPIKQTPLRRFNRSATSAKDIILMFCKL
NTEEYEPYGVCVDNLSSSWSDGLAFCALIHHFHPEAFDFSKLNKVNRKFN
FELAFTSADKYADIYPLLDIDDMMIMEKPDWKCIFTYVQCFYKAFRTHPS
NRLKTVPIS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005819spindle
GO:0005856cytoskeleton
GO:0005921gap junction
GO:0030054cell junction
GO:0005622intracellular
GO:0005865striated muscle thin filament
GO:0005903brush border
GO:0030017sarcomere
GO:0030018Z disc
Vocabulary: biological process
TermDefinition
GO:0007049cell cycle
GO:0051301cell division
GO:0006936muscle contraction
GO:0014728regulation of the force of skeletal muscle contraction
GO:0014732skeletal muscle atrophy
GO:0014883transition between fast and slow fiber
GO:0014894response to denervation involved in regulation of muscle adaptation
GO:0031448positive regulation of fast-twitch skeletal muscle fiber contraction
GO:0045820negative regulation of glycolytic process
GO:0048633positive regulation of skeletal muscle tissue growth
GO:0048743positive regulation of skeletal muscle fiber development
GO:0060349bone morphogenesis
GO:0070885negative regulation of calcineurin-NFAT signaling cascade
GO:0090257regulation of muscle system process
GO:0090324negative regulation of oxidative phosphorylation
GO:1900159positive regulation of bone mineralization involved in bone maturation
GO:1901078negative regulation of relaxation of muscle
GO:1903715regulation of aerobic respiration
GO:1904025positive regulation of glucose catabolic process to lactate via pyruvate
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR036872CH_dom_sf
IPR036179Ig-like_dom_sf
IPR001715CH-domain
IPR013783Ig-like_fold
IPR007110Ig-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003779actin binding
GO:0005509calcium ion binding
GO:0030674protein binding, bridging
GO:0042803protein homodimerization activity
GO:0046872metal ion binding
GO:0051015actin filament binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001715Calponin homology domainSMARTSM00033ch_5coord: 340..441
e-value: 1.0E-11
score: 54.9
IPR001715Calponin homology domainPFAMPF00307CHcoord: 340..446
e-value: 1.1E-13
score: 51.3
IPR001715Calponin homology domainPROSITEPS50021CHcoord: 338..446
score: 18.714
IPR001715Calponin homology domainCDDcd00014CHcoord: 339..446
e-value: 2.60047E-15
score: 69.6471
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 153..241
e-value: 6.2E-6
score: 28.2
IPR036872CH domain superfamilyGENE3DG3DSA:1.10.418.10coord: 335..452
e-value: 2.6E-34
score: 119.5
IPR036872CH domain superfamilySUPERFAMILYSSF47576Calponin-homology domain, CH-domaincoord: 337..446
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 46..67
NoneNo IPR availablePANTHERPTHR23167:SF55coord: 334..446
NoneNo IPR availablePANTHERPTHR23167FAMILY NOT NAMEDcoord: 334..446
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 111..220
score: 6.814
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 160..237