Synaptotagmin protein 5

Overview
NameSynaptotagmin protein 5
Smed IDSMED30022075
Length (bp)2081
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Synaptotagmin protein 5 (SMED30022075) t-SNE clustered cells

Violin plots show distribution of expression levels for Synaptotagmin protein 5 (SMED30022075) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Synaptotagmin protein 5 (SMED30022075) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Synaptotagmin protein 5 (SMED30022075) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022075

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30022075SMESG000074360.1 dd_Smed_v4_4335_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30022075SMESG000074360.1 dd_Smed_v4_4335_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
tailSMED30022075SMESG000074360.1 dd_Smed_v6_4335_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30022075SMESG000074360.1 dd_Smed_v4_4335_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30022075SMESG000074360.1 dd_Smed_v4_4335_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Synaptotagmin protein 5 vs. Ensembl Human
Match: SYTL4 (synaptotagmin like 4 [Source:HGNC Symbol;Acc:HGNC:15588])

HSP 1 Score: 187.578 bits (475), Expect = 3.828e-50
Identity = 124/333 (37.24%), Postives = 187/333 (56.16%), Query Frame = 1
Query:  985 SSNSIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKYKPST-------RRDGKGS----LHVLIVEAQQLEF--DGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWMDAQGIEKTTWENFLSNPNEYTDAILNLRPNLEYY*MG 1944
            S  SIYSE  D     + V+G + FS+ Y    ++L ++V +C  LA AD  K+++NPY+KTYLLPDK++  K+K++ KR  INP++ ETL Y + +  L+ RTL   VWH      N FLGE  + +    L K      PL  K+   + +G   +KGEL++ LKY P++       R+  KG     L V I EA+ L     G + + +VKG+LLP R+   K+KTPV K T N  ++    ++ V LE+L+   LEL+++    L SN+FLGGVRL +G G+ + + V WMD+ G E + W+     P  + +  L LR ++    +G
Sbjct:  340 SMMSIYSEAGDF--GNIFVTGRIAFSLKYEQQTQSLVVHVKECHQLAYADEAKKRSNPYVKTYLLPDKSRQGKRKTSIKRDTINPLYDETLRYEIPESLLAQRTLQFSVWHHGRFGRNTFLGEAEIQMDSWKLDKKLDHCLPLHGKISAESPTGLPSHKGELVVSLKYIPASKTPVGGDRKKSKGGEGGELQVWIKEAKNLTAAKAGGTSDSFVKGYLLPMRNKASKRKTPVMKKTLNPHYNHTFVYNGVRLEDLQHMCLELTVWDREPLASNDFLGGVRLGVGTGISNGEVVDWMDSTGEEVSLWQKMRQYPGSWAEGTLQLRSSMAKQKLG 670          
BLAST of Synaptotagmin protein 5 vs. Ensembl Human
Match: SYTL4 (synaptotagmin like 4 [Source:HGNC Symbol;Acc:HGNC:15588])

HSP 1 Score: 187.578 bits (475), Expect = 3.828e-50
Identity = 124/333 (37.24%), Postives = 187/333 (56.16%), Query Frame = 1
Query:  985 SSNSIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKYKPST-------RRDGKGS----LHVLIVEAQQLEF--DGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWMDAQGIEKTTWENFLSNPNEYTDAILNLRPNLEYY*MG 1944
            S  SIYSE  D     + V+G + FS+ Y    ++L ++V +C  LA AD  K+++NPY+KTYLLPDK++  K+K++ KR  INP++ ETL Y + +  L+ RTL   VWH      N FLGE  + +    L K      PL  K+   + +G   +KGEL++ LKY P++       R+  KG     L V I EA+ L     G + + +VKG+LLP R+   K+KTPV K T N  ++    ++ V LE+L+   LEL+++    L SN+FLGGVRL +G G+ + + V WMD+ G E + W+     P  + +  L LR ++    +G
Sbjct:  340 SMMSIYSEAGDF--GNIFVTGRIAFSLKYEQQTQSLVVHVKECHQLAYADEAKKRSNPYVKTYLLPDKSRQGKRKTSIKRDTINPLYDETLRYEIPESLLAQRTLQFSVWHHGRFGRNTFLGEAEIQMDSWKLDKKLDHCLPLHGKISAESPTGLPSHKGELVVSLKYIPASKTPVGGDRKKSKGGEGGELQVWIKEAKNLTAAKAGGTSDSFVKGYLLPMRNKASKRKTPVMKKTLNPHYNHTFVYNGVRLEDLQHMCLELTVWDREPLASNDFLGGVRLGVGTGISNGEVVDWMDSTGEEVSLWQKMRQYPGSWAEGTLQLRSSMAKQKLG 670          
BLAST of Synaptotagmin protein 5 vs. Ensembl Human
Match: SYTL4 (synaptotagmin like 4 [Source:HGNC Symbol;Acc:HGNC:15588])

HSP 1 Score: 187.578 bits (475), Expect = 3.828e-50
Identity = 124/333 (37.24%), Postives = 187/333 (56.16%), Query Frame = 1
Query:  985 SSNSIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKYKPST-------RRDGKGS----LHVLIVEAQQLEF--DGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWMDAQGIEKTTWENFLSNPNEYTDAILNLRPNLEYY*MG 1944
            S  SIYSE  D     + V+G + FS+ Y    ++L ++V +C  LA AD  K+++NPY+KTYLLPDK++  K+K++ KR  INP++ ETL Y + +  L+ RTL   VWH      N FLGE  + +    L K      PL  K+   + +G   +KGEL++ LKY P++       R+  KG     L V I EA+ L     G + + +VKG+LLP R+   K+KTPV K T N  ++    ++ V LE+L+   LEL+++    L SN+FLGGVRL +G G+ + + V WMD+ G E + W+     P  + +  L LR ++    +G
Sbjct:  340 SMMSIYSEAGDF--GNIFVTGRIAFSLKYEQQTQSLVVHVKECHQLAYADEAKKRSNPYVKTYLLPDKSRQGKRKTSIKRDTINPLYDETLRYEIPESLLAQRTLQFSVWHHGRFGRNTFLGEAEIQMDSWKLDKKLDHCLPLHGKISAESPTGLPSHKGELVVSLKYIPASKTPVGGDRKKSKGGEGGELQVWIKEAKNLTAAKAGGTSDSFVKGYLLPMRNKASKRKTPVMKKTLNPHYNHTFVYNGVRLEDLQHMCLELTVWDREPLASNDFLGGVRLGVGTGISNGEVVDWMDSTGEEVSLWQKMRQYPGSWAEGTLQLRSSMAKQKLG 670          
BLAST of Synaptotagmin protein 5 vs. Ensembl Human
Match: SYTL5 (synaptotagmin like 5 [Source:HGNC Symbol;Acc:HGNC:15589])

HSP 1 Score: 176.407 bits (446), Expect = 6.310e-46
Identity = 128/355 (36.06%), Postives = 184/355 (51.83%), Query Frame = 1
Query:  940 YLHPTNLETLKTMSHSSNSIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKYKPSTRR------------------------DGKGSLHVLIVEAQQLEF--DGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWMDAQGIEKTTWENFLSNPNEYTDAILNLRPNL 1926
            YL+  + ++  T  +S  S+YSET D     + VSG++L  + Y      L I+V  CRNLA+ D  K++T+ Y+K+YLLPDK++ +K+K+   R+  NP F ETL Y +S   L  RTL + VWH      N FLGEV +     +       W+ LQ KV +    G   YKGEL + L+Y P                               G L V I EA+ L     G + + +VKG+LLPD S   K KT V K + N +W+    FS +  +++K+  LEL+I+      SN FLGGVRLN G G+ H  +V WMD+QG E+  W+   +NP    + +L LR ++
Sbjct:  397 YLNVPDADSDTTSLNSMMSVYSETGD--YGNVKVSGEILLHISYCYKTGGLYIFVKNCRNLAIGDEKKQRTDAYVKSYLLPDKSRNNKRKTKI-RTGTNPEFNETLKYTISHTQLETRTLQLSVWHYDRFGRNSFLGEVEIPFDSWNFENPTDEWFVLQPKVEFAPDIGLQ-YKGELTVVLRYIPPEENLMLPPEQLQGNKTFKKGKKKESPVISGGILEVFIKEAKNLTAVKSGGTSDSFVKGYLLPDDSKATKHKTLVIKKSVNPQWNHTFMFSGIHPQDIKNVCLELTIWDKEAFSSNIFLGGVRLNSGSGVSHGKNVDWMDSQGEEQRLWQKMANNPGTPFEGVLMLRSSM 747          
BLAST of Synaptotagmin protein 5 vs. Ensembl Human
Match: SYTL5 (synaptotagmin like 5 [Source:HGNC Symbol;Acc:HGNC:15589])

HSP 1 Score: 174.096 bits (440), Expect = 3.169e-45
Identity = 124/337 (36.80%), Postives = 175/337 (51.93%), Query Frame = 1
Query:  994 SIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKYKPSTRR------------------------DGKGSLHVLIVEAQQLEF--DGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWMDAQGIEKTTWENFLSNPNEYTDAILNLRPNL 1926
            S+YSET D     + VSG++L  + Y      L I+V  CRNLA+ D  K++T+ Y+K+YLLPDK++ +K+K+   R+  NP F ETL Y +S   L  RTL + VWH      N FLGEV +     +       W+ LQ KV +    G   YKGEL + L+Y P                               G L V I EA+ L     G + + +VKG+LLPD S   K KT V K + N +W+    FS +  +++K+  LEL+I+      SN FLGGVRLN G G+ H  +V WMD+QG E+  W+   +NP    + +L LR ++
Sbjct:  393 SVYSETGD--YGNVKVSGEILLHISYCYKTGGLYIFVKNCRNLAIGDEKKQRTDAYVKSYLLPDKSRNNKRKTKI-RTGTNPEFNETLKYTISHTQLETRTLQLSVWHYDRFGRNSFLGEVEIPFDSWNFENPTDEWFVLQPKVEFAPDIGLQ-YKGELTVVLRYIPPEENLMLPPEQLQGNKTFKKGKKKESPVISGGILEVFIKEAKNLTAVKSGGTSDSFVKGYLLPDDSKATKHKTLVIKKSVNPQWNHTFMFSGIHPQDIKNVCLELTIWDKEAFSSNIFLGGVRLNSGSGVSHGKNVDWMDSQGEEQRLWQKMANNPGTPFEGVLMLRSSM 725          
BLAST of Synaptotagmin protein 5 vs. Ensembl Celegans
Match: snt-2 (Synaptotagmin 2 [Source:UniProtKB/Swiss-Prot;Acc:K8FE10])

HSP 1 Score: 77.411 bits (189), Expect = 6.283e-15
Identity = 74/304 (24.34%), Postives = 146/304 (48.03%), Query Frame = 1
Query:  871 NKTEHVVKSETLELQPRSQTSAHYLHPTNLETLKTMSHSSNSIYSETYDSYKSGLVVS--GDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKYKPSTRRDGKGSLHVLIVEAQQLE-FD-GQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEF 1770
            N    ++ S+ + +QP   T++ Y  P N  TL   S               SG ++   G++ F V Y+ +   L++ +    +L   DRN   ++PY+K Y+LP++ +  + +    R+ +NP + ET  +++    L ++TL + V+    ++ +  +G++ V L  +D      +  PLQ+  +   +       G++    +Y+P+T     G++ + I+EA+ L+  D G S + YVK +L   R    KKKT  +  T N  ++   QF  +    ++   L +S++ Y ++  N+F
Sbjct:   43 NGAVPILSSKPITVQP---TNSDYYEPVNNGTLPLSS---------------SGALIKQYGNIHFRVEYDFEQSKLSVTIVSASDLPAMDRNG-MSDPYVKVYVLPERKQKFETRII--RNTLNPTYNETFQFSIPFNELHSKTLMLVVYDYDRLSKDDKMGQLSVPLESIDFGITTDIERPLQKPEKDDEK---ECRLGDICFSTRYRPAT-----GTVTLTIMEARNLKKMDVGGSSDPYVKIYLHHGRKLLSKKKTSRKYKTLNPYYNESFQFK-IEPHMIEKVHLIVSVWDYDKMSKNDF 316          
BLAST of Synaptotagmin protein 5 vs. Ensembl Celegans
Match: snt-1 (Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:P34693])

HSP 1 Score: 67.3958 bits (163), Expect = 1.453e-11
Identity = 67/243 (27.57%), Postives = 120/243 (49.38%), Query Frame = 1
Query: 1045 GDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKYKPSTRRDGKGSLHVLIVEAQQL-EFDGQSL-NVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNE 1767
            G + + + Y+     L + V Q  +L   D +   ++PY+K YLLP   K  K ++   R  +NP+F ET I+ V+   ++A+TL   ++     + +  +G+V + L  +DL      W   ++    P+        G++   L+Y P+      G L V+I+EA+ L + D   L + YVK  L+       KKKT ++K T N  ++    F +V  E+++  SL +++  Y +L SN+
Sbjct:  161 GRIQYKLDYDFQQGQLTVTVIQAEDLPGMDMSGT-SDPYVKLYLLP--EKKKKVETKVHRKTLNPVFNETFIFKVAFNEITAKTLVFAIYDFDRFSKHDQIGQVLIPLGKIDLGAVIEEW---KDIAPPPDDKEAEKSLGDICFSLRYVPTA-----GKLTVVILEAKNLKKMDVGGLSDPYVKIVLMQGGKRLKKKKTSIKKCTLNPYYNESFSF-EVPFEQIQKVSLMITVMDYDKLGSND 391          
BLAST of Synaptotagmin protein 5 vs. Ensembl Celegans
Match: snt-1 (Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:P34693])

HSP 1 Score: 67.3958 bits (163), Expect = 1.655e-11
Identity = 67/244 (27.46%), Postives = 120/244 (49.18%), Query Frame = 1
Query: 1045 GDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKYKPSTRRDGKGSLHVLIVEAQQL-EFDGQSL-NVYVKGFLL-PDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNE 1767
            G + + + Y+     L + V Q  +L   D +   ++PY+K YLLP   K  K ++   R  +NP+F ET I+ V+   ++A+TL   ++     + +  +G+V + L  +DL      W   ++    P+        G++   L+Y P+      G L V+I+EA+ L + D   L + YVK  +   DR    KKKT +++ T N  ++    F  + L ++K  SL +++  Y +L SN+
Sbjct:  161 GRIQYKLDYDFQQGQLTVTVIQAEDLPGMDMSG-TSDPYVKLYLLP--EKKKKVETKVHRKTLNPVFNETFIFKVAFNEITAKTLVFAIYDFDRFSKHDQIGQVLIPLGKIDLGAVIEEW---KDIAPPPDDKEAEKSLGDICFSLRYVPTA-----GKLTVVILEAKNLKKMDVGGLSDPYVKLEMFGEDRKRLKKKKTNIKRKTLNPYFNESFVFDKLPLHKMKKVSLMITVMDYDKLGSND 393          
BLAST of Synaptotagmin protein 5 vs. Ensembl Celegans
Match: rbf-1 (Rabphilin-1 [Source:UniProtKB/Swiss-Prot;Acc:P41885])

HSP 1 Score: 60.4622 bits (145), Expect = 4.024e-9
Identity = 65/265 (24.53%), Postives = 132/265 (49.81%), Query Frame = 1
Query:  994 SIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETL-IYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIY--KGELIIKLKYKPSTRRDGKGSLHVLI---VEAQQLEFDGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEF 1770
            +I + T  + + G +  G +  ++ Y+  +K L +++ + +NL   D N   ++PY+K +LLP  TK +K  S +    +NP + E +  Y ++++    + L V V  +  +  + FLGE  + L  ++ ++ +     L+  +  P ++       +G++ + L+Y        +GSL + I   VE   ++  G S + Y K  L P  S   + KT  +K T N +W+  LQF  V  ++L  ++L++ +Y +   K +++
Sbjct:  670 AITASTESASEPGSL--GSITLTLTYHSADKKLKMHLIRAKNLKAMDSNGF-SDPYVKFHLLPGNTKATKLTSKTIEKTLNPEWNEEMSYYGITEDDKEKKILRVTVLDRDRIGSD-FLGETRIALKKLNDNEMKKFNLYLESALPVPQQTKEEENEDRGKINVGLQYNIQ-----QGSLFININRCVELVGMDSTGFS-DPYCKVSLTPITSKAHRAKTSTKKRTLNPEWNEQLQFV-VPFKDLPKKTLQIGVYDHDLGKHDDY 923          
BLAST of Synaptotagmin protein 5 vs. Ensembl Celegans
Match: snt-6 (SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:A0A0S4XQZ9])

HSP 1 Score: 59.3066 bits (142), Expect = 4.211e-9
Identity = 73/275 (26.55%), Postives = 128/275 (46.55%), Query Frame = 1
Query:  976 MSHSSNSIYSETYDSYKSGLV--VSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIY-NVSKESLSARTLSVGVWHKRLMTYNYF-----LGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKYKPSTRRDGKGSLHVLIVEAQQLEFDGQS--LNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFS-DVTLEELKDRSLELSIYHYRRLKSNE 1767
            +S S N   +   D  +  +V    G + FSV +  +  TL++++ +  +L V D     ++PY++ +LL D  ++ + K    R N+NP F ETL +   S + L   TL + V     M Y+ F     +GE+ + L  +    +   W  LQ     P  S      GE++I L Y P++     G + V I++A+ L    ++   + YVK +++   +   K+KT V+  T +  ++    FS  V    L + +L L+   Y  + SNE
Sbjct:   78 LSQSINPWKTSIIDQLRPEVVSEFRGRINFSVAFEKECSTLHVHLMEAVDLPVKDFTG-SSDPYVRAFLLQDPGQSERSKVH--RRNLNPTFNETLSFRGHSMKKLHDMTLVLQV-----MDYDRFSSDDPIGEILLPLKHVKFESSPVYWKHLQR----PTVSKDAC--GEIMISLCYLPTS-----GKITVSIIKARDLHAKDRTRHYDTYVKMWMVQQGNKLEKRKTSVKPHTPSPIFNESFAFSIPVKQVLLAEVNLVLTAMEYDVIGSNE 333          
BLAST of Synaptotagmin protein 5 vs. Ensembl Fly
Match: btsz (gene:FBgn0266756 transcript:FBtr0334289)

HSP 1 Score: 199.134 bits (505), Expect = 5.711e-55
Identity = 138/419 (32.94%), Postives = 219/419 (52.27%), Query Frame = 1
Query:  787 SPNVRKREINGVSNPVKENLIDVVDFAENKTEHVVKSETLELQPRSQTSAHYLHPTNLETLKTMSHSSNSIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKYKP-----------------------------------STRRDGKGSLHVLIVEAQQL---EFDGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWMDAQGIEKTTWENFLSNPNEYTDAILNLRPNLE 1929
            SP + +R+ +G  +P++         A ++T      E ++     +  A + + ++L +L   S S  S+YS   +     +VV G V F++ YN     L ++V +C++LA  D  + +++PY+K YLLPDK+K  K+K+  K+  +NPIF ET+ ++    SL +RTL + VWH  +   N FLGEV V L        +  WY LQE+    +      Y+G++++ LKY P                                   S R    G LHVL+ EA+ L   + +G + + + K +LLPDR+   K+KTPV K T +  W+    + DV+LEEL +R+LEL+++ + RL SNEF+GG+R +LG G  +   V WMDA G E + W+N L  PN + +  L LR +L+
Sbjct:  190 SPVIGQRQADGSGSPIQSR-------ASSETWPTQSDEDID-----RLVAMHQNRSSLSSLGVRSESMASVYSGAGEGRYGTVVVKGQVEFAMQYNYKLSALEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRFHTPISSLESRTLWLTVWHSDMFGRNDFLGEVSVNLQGRLFDNPQSQWYLLQERSEPFDEVA--TYRGDIVVGLKYIPPENIKSSFFSRGSSITGSSSNLRKFGGSIKSVASKSERTSKGGQLHVLVKEAKHLSPIKANG-TCDAFCKSYLLPDRTRSSKQKTPVVKRTLHPSWNYTFVYEDVSLEELSERALELTVWDHDRLASNEFVGGIRFSLGTGRSYGRQVEWMDATGKELSLWQNMLDRPNFWVEGSLVLRSSLD 593          
BLAST of Synaptotagmin protein 5 vs. Ensembl Fly
Match: btsz (gene:FBgn0266756 transcript:FBtr0334288)

HSP 1 Score: 198.749 bits (504), Expect = 3.314e-54
Identity = 138/419 (32.94%), Postives = 219/419 (52.27%), Query Frame = 1
Query:  787 SPNVRKREINGVSNPVKENLIDVVDFAENKTEHVVKSETLELQPRSQTSAHYLHPTNLETLKTMSHSSNSIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKYKP-----------------------------------STRRDGKGSLHVLIVEAQQL---EFDGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWMDAQGIEKTTWENFLSNPNEYTDAILNLRPNLE 1929
            SP + +R+ +G  +P++         A ++T      E ++     +  A + + ++L +L   S S  S+YS   +     +VV G V F++ YN     L ++V +C++LA  D  + +++PY+K YLLPDK+K  K+K+  K+  +NPIF ET+ ++    SL +RTL + VWH  +   N FLGEV V L        +  WY LQE+    +      Y+G++++ LKY P                                   S R    G LHVL+ EA+ L   + +G + + + K +LLPDR+   K+KTPV K T +  W+    + DV+LEEL +R+LEL+++ + RL SNEF+GG+R +LG G  +   V WMDA G E + W+N L  PN + +  L LR +L+
Sbjct:  298 SPVIGQRQADGSGSPIQSR-------ASSETWPTQSDEDID-----RLVAMHQNRSSLSSLGVRSESMASVYSGAGEGRYGTVVVKGQVEFAMQYNYKLSALEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRFHTPISSLESRTLWLTVWHSDMFGRNDFLGEVSVNLQGRLFDNPQSQWYLLQERSEPFDEVA--TYRGDIVVGLKYIPPENIKSSFFSRGSSITGSSSNLRKFGGSIKSVASKSERTSKGGQLHVLVKEAKHLSPIKANG-TCDAFCKSYLLPDRTRSSKQKTPVVKRTLHPSWNYTFVYEDVSLEELSERALELTVWDHDRLASNEFVGGIRFSLGTGRSYGRQVEWMDATGKELSLWQNMLDRPNFWVEGSLVLRSSLD 701          
BLAST of Synaptotagmin protein 5 vs. Ensembl Fly
Match: btsz (gene:FBgn0266756 transcript:FBtr0334287)

HSP 1 Score: 196.823 bits (499), Expect = 2.913e-52
Identity = 138/419 (32.94%), Postives = 219/419 (52.27%), Query Frame = 1
Query:  787 SPNVRKREINGVSNPVKENLIDVVDFAENKTEHVVKSETLELQPRSQTSAHYLHPTNLETLKTMSHSSNSIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKYKP-----------------------------------STRRDGKGSLHVLIVEAQQL---EFDGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWMDAQGIEKTTWENFLSNPNEYTDAILNLRPNLE 1929
            SP + +R+ +G  +P++         A ++T      E ++     +  A + + ++L +L   S S  S+YS   +     +VV G V F++ YN     L ++V +C++LA  D  + +++PY+K YLLPDK+K  K+K+  K+  +NPIF ET+ ++    SL +RTL + VWH  +   N FLGEV V L        +  WY LQE+    +      Y+G++++ LKY P                                   S R    G LHVL+ EA+ L   + +G + + + K +LLPDR+   K+KTPV K T +  W+    + DV+LEEL +R+LEL+++ + RL SNEF+GG+R +LG G  +   V WMDA G E + W+N L  PN + +  L LR +L+
Sbjct: 1107 SPVIGQRQADGSGSPIQSR-------ASSETWPTQSDEDID-----RLVAMHQNRSSLSSLGVRSESMASVYSGAGEGRYGTVVVKGQVEFAMQYNYKLSALEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRFHTPISSLESRTLWLTVWHSDMFGRNDFLGEVSVNLQGRLFDNPQSQWYLLQERSEPFDEVA--TYRGDIVVGLKYIPPENIKSSFFSRGSSITGSSSNLRKFGGSIKSVASKSERTSKGGQLHVLVKEAKHLSPIKANG-TCDAFCKSYLLPDRTRSSKQKTPVVKRTLHPSWNYTFVYEDVSLEELSERALELTVWDHDRLASNEFVGGIRFSLGTGRSYGRQVEWMDATGKELSLWQNMLDRPNFWVEGSLVLRSSLD 1510          
BLAST of Synaptotagmin protein 5 vs. Ensembl Fly
Match: btsz (gene:FBgn0266756 transcript:FBtr0334290)

HSP 1 Score: 194.512 bits (493), Expect = 1.361e-51
Identity = 138/419 (32.94%), Postives = 219/419 (52.27%), Query Frame = 1
Query:  787 SPNVRKREINGVSNPVKENLIDVVDFAENKTEHVVKSETLELQPRSQTSAHYLHPTNLETLKTMSHSSNSIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKYKP-----------------------------------STRRDGKGSLHVLIVEAQQL---EFDGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWMDAQGIEKTTWENFLSNPNEYTDAILNLRPNLE 1929
            SP + +R+ +G  +P++         A ++T      E ++     +  A + + ++L +L   S S  S+YS   +     +VV G V F++ YN     L ++V +C++LA  D  + +++PY+K YLLPDK+K  K+K+  K+  +NPIF ET+ ++    SL +RTL + VWH  +   N FLGEV V L        +  WY LQE+    +      Y+G++++ LKY P                                   S R    G LHVL+ EA+ L   + +G + + + K +LLPDR+   K+KTPV K T +  W+    + DV+LEEL +R+LEL+++ + RL SNEF+GG+R +LG G  +   V WMDA G E + W+N L  PN + +  L LR +L+
Sbjct: 1157 SPVIGQRQADGSGSPIQSR-------ASSETWPTQSDEDID-----RLVAMHQNRSSLSSLGVRSESMASVYSGAGEGRYGTVVVKGQVEFAMQYNYKLSALEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRFHTPISSLESRTLWLTVWHSDMFGRNDFLGEVSVNLQGRLFDNPQSQWYLLQERSEPFDEVA--TYRGDIVVGLKYIPPENIKSSFFSRGSSITGSSSNLRKFGGSIKSVASKSERTSKGGQLHVLVKEAKHLSPIKANG-TCDAFCKSYLLPDRTRSSKQKTPVVKRTLHPSWNYTFVYEDVSLEELSERALELTVWDHDRLASNEFVGGIRFSLGTGRSYGRQVEWMDATGKELSLWQNMLDRPNFWVEGSLVLRSSLD 1560          
BLAST of Synaptotagmin protein 5 vs. Ensembl Fly
Match: btsz (gene:FBgn0266756 transcript:FBtr0334293)

HSP 1 Score: 194.512 bits (493), Expect = 1.361e-51
Identity = 138/419 (32.94%), Postives = 219/419 (52.27%), Query Frame = 1
Query:  787 SPNVRKREINGVSNPVKENLIDVVDFAENKTEHVVKSETLELQPRSQTSAHYLHPTNLETLKTMSHSSNSIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKYKP-----------------------------------STRRDGKGSLHVLIVEAQQL---EFDGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWMDAQGIEKTTWENFLSNPNEYTDAILNLRPNLE 1929
            SP + +R+ +G  +P++         A ++T      E ++     +  A + + ++L +L   S S  S+YS   +     +VV G V F++ YN     L ++V +C++LA  D  + +++PY+K YLLPDK+K  K+K+  K+  +NPIF ET+ ++    SL +RTL + VWH  +   N FLGEV V L        +  WY LQE+    +      Y+G++++ LKY P                                   S R    G LHVL+ EA+ L   + +G + + + K +LLPDR+   K+KTPV K T +  W+    + DV+LEEL +R+LEL+++ + RL SNEF+GG+R +LG G  +   V WMDA G E + W+N L  PN + +  L LR +L+
Sbjct: 1157 SPVIGQRQADGSGSPIQSR-------ASSETWPTQSDEDID-----RLVAMHQNRSSLSSLGVRSESMASVYSGAGEGRYGTVVVKGQVEFAMQYNYKLSALEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRFHTPISSLESRTLWLTVWHSDMFGRNDFLGEVSVNLQGRLFDNPQSQWYLLQERSEPFDEVA--TYRGDIVVGLKYIPPENIKSSFFSRGSSITGSSSNLRKFGGSIKSVASKSERTSKGGQLHVLVKEAKHLSPIKANG-TCDAFCKSYLLPDRTRSSKQKTPVVKRTLHPSWNYTFVYEDVSLEELSERALELTVWDHDRLASNEFVGGIRFSLGTGRSYGRQVEWMDATGKELSLWQNMLDRPNFWVEGSLVLRSSLD 1560          
BLAST of Synaptotagmin protein 5 vs. Ensembl Zebrafish
Match: sytl5 (synaptotagmin-like 5 [Source:ZFIN;Acc:ZDB-GENE-070912-424])

HSP 1 Score: 163.696 bits (413), Expect = 3.489e-44
Identity = 123/362 (33.98%), Postives = 182/362 (50.28%), Query Frame = 1
Query:  916 PRSQTSAHYLHPTNLETLKTMSHSSNSIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKYKPSTRR------------------------DGKGSLHVLIVEAQQL-EFDGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWMDAQGIEKTTWENFLSNPNEYTDAILNLRPNL 1926
            P S+    +L+  + +   T  +S  S+YSET D Y S + VSG++L ++ Y+     LN+ V +CR LA  D  +++T+ Y+KTYLLPDK++ SK+K++ K ++ NP+F E L Y VS   L  RTL V VWH     +N FLGE  +     +       W+ LQ ++          YKGEL + LKY P+ R                            G + +L+ EA+ L    G S + +VKG+LLPD     K KT V K + N +W+    +  +   +L    LEL+++      SN FLGGVRL  G GL +   V W DA G E+  W+  + NP    +  L LR ++
Sbjct:    4 PASERKWGFLNVPDSDADTTSINSLMSVYSETGD-YGS-VRVSGEILLNISYSYKTGALNVLVRECRCLATGDERRQRTDAYVKTYLLPDKSRQSKRKTSIKSNSTNPVFNENLRYVVSHSQLETRTLQVSVWHHDRFGHNNFLGETELTFDSWEFDTQIEEWFALQPRIESDYVDSVMHYKGELTVVLKYIPAERNVSLPLDQVQVKKGFLKGKKKTITLPKGGMVELLVKEAKNLTAVKGGSSDPFVKGYLLPDDKKSTKHKTAVVKRSVNPRWNHTFTYCGLQHSDLDSVCLELTVWDREPFASNVFLGGVRLGAGTGLSYGKEVDWNDAYGEEQRLWQRMIDNPEVPQECTLMLRSSM 363          
BLAST of Synaptotagmin protein 5 vs. Ensembl Zebrafish
Match: sytl5 (synaptotagmin-like 5 [Source:ZFIN;Acc:ZDB-GENE-070912-424])

HSP 1 Score: 167.548 bits (423), Expect = 1.928e-43
Identity = 124/359 (34.54%), Postives = 184/359 (51.25%), Query Frame = 1
Query:  931 SAHYLHPTNLETLKTMS--HSSNSIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKYKPSTRR------------------------DGKGSLHVLIVEAQQL-EFDGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWMDAQGIEKTTWENFLSNPNEYTDAILNLRPNL 1926
            SAHY    ++ + ++M+  +S  S+YSET D Y S + VSG++L ++ Y+     LN+ V +CR LA  D  +++T+ Y+KTYLLPDK++ SK+K++ K ++ NP+F E L Y VS   L  RTL V VWH     +N FLGE  +     +       W+ LQ ++          YKGEL + LKY P+ R                            G + +L+ EA+ L    G S + +VKG+LLPD     K KT V K + N +W+    +  +   +L    LEL+++      SN FLGGVRL  G GL +   V W DA G E+  W+  + NP    +  L LR ++
Sbjct:  308 SAHYKTNRSVCSAQSMTSINSLMSVYSETGD-YGS-VRVSGEILLNISYSYKTGALNVLVRECRCLATGDERRQRTDAYVKTYLLPDKSRQSKRKTSIKSNSTNPVFNENLRYVVSHSQLETRTLQVSVWHHDRFGHNNFLGETELTFDSWEFDTQIEEWFALQPRIESDYVDSVMHYKGELTVVLKYIPAERNVSLPLDQVQVKKGFLKGKKKTITLPKGGMVELLVKEAKNLTAVKGGSSDPFVKGYLLPDDKKSTKHKTAVVKRSVNPRWNHTFTYCGLQHSDLDSVCLELTVWDREPFASNVFLGGVRLGAGTGLSYGKEVDWNDAYGEEQRLWQRMIDNPEVPQECTLMLRSSM 664          
BLAST of Synaptotagmin protein 5 vs. Ensembl Zebrafish
Match: sytl4 (synaptotagmin-like 4 [Source:ZFIN;Acc:ZDB-GENE-070209-217])

HSP 1 Score: 155.221 bits (391), Expect = 3.479e-39
Identity = 131/339 (38.64%), Postives = 191/339 (56.34%), Query Frame = 1
Query:  970 KTMSHSSNSIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEK-VRYPNRSGGHIYKGELIIKLKY----KPSTR-----------RDGKGSLHVLIVEAQQLEF--DGQSLNVYVKGFLLP-DRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWM-DAQGIEKTTWENFLSNPNEYTDAILNLRPNL 1926
            +T   S  S+YSE  D     + VSG+++FS+ Y++ +++L++ V +C+ LA AD  K++ NPY+K YLLPD    SKKK++ K +NINP FKETL Y++S+  L  RTL + VWH     +N FLGEV VL+   D+         L+ K V     S    YKGEL+I LKY     P+              DG   LHVLI EA+ L     G + + +VKG+LLP    +  KKKTPV K T +  ++    +++++L+ELKD  LEL+++    L SN+FLGGVRL+LG          WM D+ G E   W+  +  P+ + +  L LR ++
Sbjct:  353 RTTLGSMMSVYSEAGD--YDHVEVSGEIVFSLSYDEPSQSLSVMVHECKGLAYADPAKKKCNPYVKAYLLPD---KSKKKTSIKHNNINPSFKETLKYSISRTQLMTRTLQLSVWHYDRFGHNAFLGEVEVLMDSYDIDSAHEECMALRGKAVPQSLLSPFDQYKGELVISLKYVTPNAPNAEDSKGKGKKSKPADG-SELHVLIKEAKNLTALKAGGTCDSFVKGYLLPSKSKSSSKKKTPVVKKTKSPNYNHTFVYNNLSLDELKDMCLELTVWDRETLSSNDFLGGVRLSLGAVTVKEGKEEWMADSTGEEILLWKKMMQYPDSWAEGTLPLRSSM 685          
BLAST of Synaptotagmin protein 5 vs. Ensembl Zebrafish
Match: sytl2b (synaptotagmin-like 2b [Source:ZFIN;Acc:ZDB-GENE-121214-363])

HSP 1 Score: 146.747 bits (369), Expect = 2.863e-38
Identity = 92/307 (29.97%), Postives = 160/307 (52.12%), Query Frame = 1
Query: 1012 YDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKYKP----STRRDGKGSLHVLIVEAQQLEF-DGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWMDAQGIEKTTWENFLSNPNEYTDAILNLR 1917
            Y S  + + V G + FS+ Y    +  +I+V QC+NLA  D  + +++PY+K+YL+PD     K+K+  K+  +NP + E L Y V  E L+++ L++  WH  +   N FLGE+ + L+  D +  E    PL+ +V           KG++ + +++ P    S    G G +H+ + + + L      +++ YVK F+LPD S K ++KT V K T+N  ++  + +     E+LK+  +EL+++   RL S+   G           +   V WMD+   E   W   +++PNE+ + IL LR
Sbjct:   47 YTSDYNSVDVQGSIQFSLNYVHKLREFHIFVVQCQNLAAVDAKRNRSDPYVKSYLIPDPANLGKRKTAVKKKTLNPTYNEILRYRVRMEYLTSQVLNLSAWHNDMFGRNSFLGEIELDLSTWDFNDTERKLLPLKPRVHLQPSD----LKGQMRLAIRFLPQISHSKNVPGSGEVHIWVKDCKNLPLIRSPTIDPYVKCFVLPDTSKKSRQKTRVLKRTTNPIFNHTMVYDGFRAEDLKEACVELTVWDRDRLASHSLGGLRLGMGTGRS-YGVQVDWMDSTTEEVALWRRMMNSPNEWVEDILPLR 348          
BLAST of Synaptotagmin protein 5 vs. Ensembl Zebrafish
Match: sytl1 (synaptotagmin-like 1 [Source:ZFIN;Acc:ZDB-GENE-060503-439])

HSP 1 Score: 148.288 bits (373), Expect = 1.770e-37
Identity = 120/393 (30.53%), Postives = 197/393 (50.13%), Query Frame = 1
Query:  790 PNVRKREINGVSNPVKENLIDVVDFAENKTEHVVKSETLELQPRSQ-------TSAHYLHPTNLETLKTMSHSSNSIYSETYDSYKSG-LVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKYKPSTRRD----GKGSLHVLIVE-AQQLEFDGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWMDAQGIEKTTWENFLSNPNEYTDAILNLRPNLE 1929
            P  R R +   +  +     D V+ +ENK   ++ S +  LQ  S+       T  +Y    ++ +L T  H  N      Y     G +VVSG + FS+ Y+   + L +++ +C++LA A +N+  ++PY+K YLLPD T  SKKK+  +R  +NP++ ET+ Y V +  L AR LS+ VWH   M  N FLGE+ V L   D S+N+P W  LQ +V+    +   I +G ++  +K+ P           G LH+ + E    L     + N YVK  +LPD S    ++T V + + +  ++  + +      +L     E+++++      +  LGGVRL+ G GL +   V WMD+   E   W + + +PN + D  L +R NL+
Sbjct:  151 PQSRTRNVTKRNEILGSGFEDSVEESENKERRILPSTSPTLQIDSEGDIDSGSTEINYTRFGSVTSL-TSHHMMNGSLMSLYSVGDFGDVVVSGRIQFSLQYDVRTEELYVHIIRCQDLASARKNR--SDPYVKVYLLPDNTSRSKKKTAVRRKTLNPVYDETMTYKVRRLDLPARVLSMSVWHMERMRRNLFLGELEVRLGQWDWSQNQPTWQNLQPRVQLSPEA--IISRGTILFSIKFVPPGSEGRGNPATGELHIWLREIVGLLPTKRGAPNTYVKSVVLPDESGVSGQQTRVVRGSVSPVFNHTMVYDGFQSSDLIQACAEITVWNP---HPSGCLGGVRLSTGSGLSYGQSVCWMDSTEDEINVWSSVIQSPNSWVDTSLPIRTNLQ 535          
BLAST of Synaptotagmin protein 5 vs. Ensembl Xenopus
Match: slc41a1 (solute carrier family 41 member 1 [Source:Xenbase;Acc:XB-GENE-488920])

HSP 1 Score: 184.496 bits (467), Expect = 1.607e-51
Identity = 114/327 (34.86%), Postives = 191/327 (58.41%), Query Frame = 1
Query:  952 TNLETLKTMSHSSNSIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKYKP----STRRDGKGSLHVLIVEAQQLE-FDGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWMDAQGIEKTTWENFLSNPNEYTDAILNLR 1917
            + + +L ++S S  SIYS  + +      + G++ F++ Y D+ +   ++V QC++LA AD  K++++PY+K YLLP+K K  K+K+  K+  +NP++ + L Y ++K +L ++TL++ VWH  ++  N FLGEV V LA  D S  +  WYPLQ   R P    G   +GE+ + LKY P      +  G G +H+ + E   L    G  +N ++K  +LPD S K ++KT     T N  ++  + +     E+LK+  +EL+++ + +L +N FLGG+R+ LG G  +   V WMD+   E TTWE  +++P+ + +AIL LR
Sbjct:   45 SGMASLSSVSGSVMSIYSGDFGNVD----IKGNIQFALDYADNLQEFQVFVSQCKDLAAADVKKQRSDPYVKAYLLPEKAKMGKRKTGVKKKTLNPVYNDVLRYKINKNALLSQTLNLSVWHHDVLGRNSFLGEVDVNLASWDWSNKQMNWYPLQP--RTPAAGIGLENRGEMKLALKYVPEAFTGAKNAGTGEVHIWLKECTNLPMLRGNKINSFIKCTILPDTSRKSRQKTRAVDKTPNPYFNHTMVYDGFRKEDLKEACVELTVWDHNKL-TNHFLGGLRIGLGTGKSYGTPVDWMDSNAAEATTWEKMITSPDTWVEAILPLR 364          
BLAST of Synaptotagmin protein 5 vs. Ensembl Xenopus
Match: SYTL5 (synaptotagmin like 5 [Source:NCBI gene;Acc:100496000])

HSP 1 Score: 184.111 bits (466), Expect = 2.507e-50
Identity = 124/331 (37.46%), Postives = 179/331 (54.08%), Query Frame = 1
Query:  979 SHSSNSIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKY-------------KPSTRRDGKGSLHVLIVEAQQLEF--DGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWMDAQGIEKTTWENFLSNPNEYTDAILNLRPNL 1926
            S +S S+YSET D     L ++G++L ++ Y+     LN+ V  CRNLAVAD  K +T+PY+K YLLPDK++ SK+K+  K +  +P F ETL Y +S   L  RTL + VWH      N FLGEV + L   +    E   + LQ K+   +      YKGE+ + L+Y             K + +    G + VLI  A+ L     G S + +VKG+LLPD +   K KTPV K T N +W+    F+ +   +L +  +EL+++    L SN FLGGV L  G G+ + D V WMD+ G E+  W+  + NP    +A L LRP +
Sbjct:  143 SLTSISLYSETGDY--GNLRITGEILLNINYSYKTGALNVVVKNCRNLAVADEKKNRTDPYVKAYLLPDKSRQSKRKTKIKTNTTDPDFNETLKYVISHTQLETRTLQLTVWHNDRFGRNSFLGEVDIPLDSCNFENQEDECFQLQPKMDLASDVTLQ-YKGEITVGLRYITPEKNLTLPLDKKANVKVPSGGLVEVLIKNAKNLTAMKSGGSSDTFVKGYLLPDNNKSTKHKTPVVKKTVNPEWNHTFTFASLQTSDLSNVCVELTVWGKESLTSNVFLGGVCLGCGSGVSYGDIVDWMDSHGEEQFLWQKMMDNPGTMVEATLMLRPTM 470          
BLAST of Synaptotagmin protein 5 vs. Ensembl Xenopus
Match: SYTL5 (synaptotagmin like 5 [Source:NCBI gene;Acc:100496000])

HSP 1 Score: 182.57 bits (462), Expect = 4.313e-49
Identity = 128/343 (37.32%), Postives = 182/343 (53.06%), Query Frame = 1
Query:  970 KTMSHSSNSIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKY--------------KPSTRRDGK--------GSLHVLIVEAQQLEF--DGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWMDAQGIEKTTWENFLSNPNEYTDAILNLRPNL 1926
            K  S +S S+YSET D     L ++G++L ++ Y+     LN+ V  CRNLAVAD  K +T+PY+K YLLPDK++ SK+K+  K +  +P F ETL Y +S   L  RTL + VWH      N FLGEV + L   +    E   + LQ K+   +      YKGE+ + L+Y              K S R+  K        G + VLI  A+ L     G S + +VKG+LLPD +   K KTPV K T N +W+    F+ +   +L +  +EL+++    L SN FLGGV L  G G+ + D V WMD+ G E+  W+  + NP    +A L LRP +
Sbjct:  221 KVQSLTSISLYSETGDY--GNLRITGEILLNINYSYKTGALNVVVKNCRNLAVADEKKNRTDPYVKAYLLPDKSRQSKRKTKIKTNTTDPDFNETLKYVISHTQLETRTLQLTVWHNDRFGRNSFLGEVDIPLDSCNFENQEDECFQLQPKMDLASDVTLQ-YKGEITVGLRYITPEKNLTLPLDKVKKSFRKSKKANVKVPSGGLVEVLIKNAKNLTAMKSGGSSDTFVKGYLLPDNNKSTKHKTPVVKKTVNPEWNHTFTFASLQTSDLSNVCVELTVWGKESLTSNVFLGGVCLGCGSGVSYGDIVDWMDSHGEEQFLWQKMMDNPGTMVEATLMLRPTM 560          
BLAST of Synaptotagmin protein 5 vs. Ensembl Xenopus
Match: SYTL5 (synaptotagmin like 5 [Source:NCBI gene;Acc:100496000])

HSP 1 Score: 179.874 bits (455), Expect = 2.183e-48
Identity = 125/341 (36.66%), Postives = 180/341 (52.79%), Query Frame = 1
Query:  973 TMSHSSNSIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKY---------------------KPSTRRDGKGSLHVLIVEAQQLEF--DGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWMDAQGIEKTTWENFLSNPNEYTDAILNLRPNL 1926
            T S +S S+YSET D     L ++G++L ++ Y+     LN+ V  CRNLAVAD  K +T+PY+K YLLPDK++ SK+K+  K +  +P F ETL Y +S   L  RTL + VWH      N FLGEV + L   +    E   + LQ K+   +      YKGE+ + L+Y                     K + +    G + VLI  A+ L     G S + +VKG+LLPD +   K KTPV K T N +W+    F+ +   +L +  +EL+++    L SN FLGGV L  G G+ + D V WMD+ G E+  W+  + NP    +A L LRP +
Sbjct:  181 TRSLTSISLYSETGDY--GNLRITGEILLNINYSYKTGALNVVVKNCRNLAVADEKKNRTDPYVKAYLLPDKSRQSKRKTKIKTNTTDPDFNETLKYVISHTQLETRTLQLTVWHNDRFGRNSFLGEVDIPLDSCNFENQEDECFQLQPKMDLASDVTLQ-YKGEITVGLRYITPEKNLTLPLDKKKSFRKSKKANVKVPSGGLVEVLIKNAKNLTAMKSGGSSDTFVKGYLLPDNNKSTKHKTPVVKKTVNPEWNHTFTFASLQTSDLSNVCVELTVWGKESLTSNVFLGGVCLGCGSGVSYGDIVDWMDSHGEEQFLWQKMMDNPGTMVEATLMLRPTM 518          
BLAST of Synaptotagmin protein 5 vs. Ensembl Xenopus
Match: SYTL4 (synaptotagmin like 4 [Source:NCBI gene;Acc:100495134])

HSP 1 Score: 180.644 bits (457), Expect = 3.420e-48
Identity = 120/323 (37.15%), Postives = 183/323 (56.66%), Query Frame = 1
Query:  994 SIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKYKPSTRRDGK----------GSLHVLIVEAQQLEF--DGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWMDAQGIEKTTWENFLSNPNEYTDAILNLRPNL 1926
            SIYSE  D     ++++G+++FS+ Y+   + LNI V +CRNLA  D  K ++NPYIK+YLLPDK++  K+K+T KR+  NP++ E L Y V +  L  R+L + VWH      N FLG+V + L   +         PL  K    + +G +  KGEL++ LKY P T+  G           G LHV I EA+ L     G   + +VKG+L P ++   K+KTPV K T N  ++    ++ +  E+L++  LEL+++    L SN+FLGGVRL +G G+ + + V WMD+ G E + W+     P  + +  L LRP++
Sbjct:  278 SIYSEAGDF--GNVIITGEIIFSINYDAKVQLLNILVKECRNLAYGDELKMRSNPYIKSYLLPDKSRQGKRKTTIKRNTTNPMYNEVLKYIVPESMLHLRSLELSVWHYDRFGRNTFLGQVDIPLDSWNFDSLIEECLPLHGKGNMDSGAGFYNSKGELVVSLKYVPPTKPSGSERRKKKADEGGELHVWIKEAKNLTAVKTGGISDSFVKGYLFPHKNKNTKRKTPVVKKTLNPHYNHTFVYNGIKPEDLQNVCLELTVWDREPLSSNDFLGGVRLGIGNGMSNGELVDWMDSTGEELSLWQKMRQYPGSWAEGTLQLRPSM 598          
BLAST of Synaptotagmin protein 5 vs. Ensembl Mouse
Match: Sytl4 (synaptotagmin-like 4 [Source:MGI Symbol;Acc:MGI:1351606])

HSP 1 Score: 187.578 bits (475), Expect = 2.696e-50
Identity = 122/324 (37.65%), Postives = 184/324 (56.79%), Query Frame = 1
Query:  994 SIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKYKPSTR----------RDGKGS-LHVLIVEAQQLEF--DGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWMDAQGIEKTTWENFLSNPNEYTDAILNLRPNL 1926
            SIYSE  D     + V+G + FS+ +    +TL I+V +C  LA AD  K+++NPY+KTYLLPDK++  K+K++ KR  INP++ ET  Y +S+  L+ RTL   VWH      N FLGE  V +    L K      PL  K+   +  G   +KGEL++ LKY P+++          + G+G  L V I EA+ L     G + + +VKG+LLP R+   K+KTPV K T +  ++    ++ V LE+L+   LEL+++    L SN+FLGGVRL +G G+ + + V WMD+ G E + W+     P  + +  L LR ++
Sbjct:  345 SIYSEAGDF--GNISVTGKIAFSLKFEQKTQTLVIHVKECHQLAYADEAKKRSNPYVKTYLLPDKSRQGKRKTSIKRDTINPLYDETFRYEISESLLAQRTLQFSVWHHGRFGRNTFLGEAEVHMDSWKLDKKLDHCLPLHGKISTESSPGLPAHKGELVVSLKYIPASKLPVGGDRKKSKGGEGGELQVWIKEAKNLTAAKSGGTSDSFVKGYLLPMRNKASKRKTPVMKKTLSPHYNHTFVYNGVRLEDLQHMCLELTVWDREPLASNDFLGGVRLGVGTGISNGEVVDWMDSTGEEVSLWQKMRQYPGSWAEGTLQLRSSM 666          
BLAST of Synaptotagmin protein 5 vs. Ensembl Mouse
Match: Sytl5 (synaptotagmin-like 5 [Source:MGI Symbol;Acc:MGI:2668451])

HSP 1 Score: 169.474 bits (428), Expect = 1.035e-43
Identity = 137/414 (33.09%), Postives = 207/414 (50.00%), Query Frame = 1
Query:  772 LRKDESPNVRKREINGVSNPVKENLIDVVD--FAENKTEHVVKSETLELQPRSQTSAHYLHPTNLETLKTMSHSSNSIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRY-PNRSGGHIYKGELIIKLKYKP---------STRRD---------------GKGSLHVLIVEAQQLEF--DGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWMDAQGIEKTTWENFLSNPNEYTDAILNLRPNL 1926
            +R    P    +++N + +   E+ +D+V   F+ N T  +    +   Q  S     YL+  + ++  T  +S  S+YSET D     + V+G++L  + Y      L I+V  CRNLA  D  K++T+ Y+K+YLLPDK++ +K+K+   R+  NP F ETL Y +S   L  RTL + VWH      N FLGEV +     +       W+ LQ KV   P+ S    YKGEL I L+Y P           R++                 G L V I +A+ L     G + + +VKG+LLPD +   K KT V K + N +W+    FS +  +++K+  LEL+I+      SN FLGGVRLN G G+ +   V WMD+ G E+  W+    NP    + +L LR ++
Sbjct:  343 IRSRSVPGALDKDLNSLEDT--EDGVDLVSSRFSAN-THSLASGLSTNSQAGSDRKRSYLNVPDADSDTTSLNSMMSVYSETGD--YGNVKVTGEILLHISYCYKTGGLYIFVKSCRNLATGDEKKQRTDAYVKSYLLPDKSRNNKRKTKI-RTGTNPEFNETLKYTISHTQLETRTLQLSVWHYDRFGRNSFLGEVEIAFDSWNFENPCDEWFVLQPKVELAPDIS--LQYKGELTIVLRYIPPEENLIFPAGQRQEKKIFKRGKKKESSSISGGILEVFIKKAKNLTAVKSGGTSDSFVKGYLLPDDNKATKHKTAVVKKSVNPEWNHTFIFSGLYPQDIKNACLELTIWDKEAFSSNVFLGGVRLNSGSGMSYGKTVDWMDSHGEEQRLWQKMADNPGTSVEGVLMLRSSM 748          
BLAST of Synaptotagmin protein 5 vs. Ensembl Mouse
Match: Sytl5 (synaptotagmin-like 5 [Source:MGI Symbol;Acc:MGI:2668451])

HSP 1 Score: 163.696 bits (413), Expect = 6.548e-42
Identity = 122/338 (36.09%), Postives = 175/338 (51.78%), Query Frame = 1
Query:  994 SIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRY-PNRSGGHIYKGELIIKLKYKP---------STRRD---------------GKGSLHVLIVEAQQLEF--DGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWMDAQGIEKTTWENFLSNPNEYTDAILNLRPNL 1926
            S+YSET D     + V+G++L  + Y      L I+V  CRNLA  D  K++T+ Y+K+YLLPDK++ +K+K+   R+  NP F ETL Y +S   L  RTL + VWH      N FLGEV +     +       W+ LQ KV   P+ S    YKGEL I L+Y P           R++                 G L V I +A+ L     G + + +VKG+LLPD +   K KT V K + N +W+    FS +  +++K+  LEL+I+      SN FLGGVRLN G G+ +   V WMD+ G E+  W+    NP    + +L LR ++
Sbjct:  394 SVYSETGD--YGNVKVTGEILLHISYCYKTGGLYIFVKSCRNLATGDEKKQRTDAYVKSYLLPDKSRNNKRKTKI-RTGTNPEFNETLKYTISHTQLETRTLQLSVWHYDRFGRNSFLGEVEIAFDSWNFENPCDEWFVLQPKVELAPDIS--LQYKGELTIVLRYIPPEENLIFPAGQRQEKKIFKRGKKKESSSISGGILEVFIKKAKNLTAVKSGGTSDSFVKGYLLPDDNKATKHKTAVVKKSVNPEWNHTFIFSGLYPQDIKNACLELTIWDKEAFSSNVFLGGVRLNSGSGMSYGKTVDWMDSHGEEQRLWQKMADNPGTSVEGVLMLRSSM 726          
BLAST of Synaptotagmin protein 5 vs. Ensembl Mouse
Match: Sytl1 (synaptotagmin-like 1 [Source:MGI Symbol;Acc:MGI:1933365])

HSP 1 Score: 153.68 bits (387), Expect = 4.298e-39
Identity = 103/301 (34.22%), Postives = 151/301 (50.17%), Query Frame = 1
Query: 1039 VSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKYKPSTRRDG----KGSLHVLIVEAQQL-EFDGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWMDAQGIEKTTWENFLSNPNEYTDAILNLRPNL 1926
            V G VLFS+ Y      L + V QC+ LA A R  R+++PY+K+YLLPDK    K      + N+NPIF ETL ++V +  L  R LS+ VWH+  +  N FLGEV V L   +   +E  W PLQ +V  P        +G L + LKY P+    G     G LH  + EAQ L      SL+ Y++  +LPD S   +++T V + + +  ++  + +      +L+    ELS++ +  L S +  G           +   V WMD+   EK  W+  L  P E+ D +L LR NL
Sbjct:  272 VRGSVLFSLRYEPGTSELRVQVIQCQGLAAARR--RRSDPYVKSYLLPDKQSKRKTSVK--KRNLNPIFNETLRHSVQQADLPGRVLSLSVWHRESLGRNIFLGEVEVPLDTWNWD-SEATWLPLQPRV--PPSPDELPSRGLLSLSLKYVPAGSEGGGQPQSGELHFWVKEAQSLVPLRPGSLDTYIQCSVLPDDSRASRQRTRVVRRSLSPVFNHTMVYDGFGPADLRQACAELSLWDHGALASRQLGGTRLSLGTGSS-YGLQVPWMDSTPEEKQLWQTLLERPCEWVDGLLPLRTNL 564          
BLAST of Synaptotagmin protein 5 vs. Ensembl Mouse
Match: Sytl2 (synaptotagmin-like 2 [Source:MGI Symbol;Acc:MGI:1933366])

HSP 1 Score: 153.295 bits (386), Expect = 6.103e-38
Identity = 112/326 (34.36%), Postives = 179/326 (54.91%), Query Frame = 1
Query:  979 SHSSNSIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLA--DMDLSKNEPV-WYPLQEK-----VRYPNRSGGHIYKGELIIKLKYKPSTRRDGK----GSLHVLIVEAQQLE-FDGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWMDAQGIEKTTWENFLSNPNEYTDAILNLR 1917
            S S  S+YS  +      L V G V F++ Y +  K L+++V QC++LA AD  K++++PY+KTYLLPDK K  KKK+   +  +NP++ E L Y + ++ L  + L++ VWH+     N FLGEV + L   D D  +N+ + WYPL+ K     +   NR       GE+ + L+Y P      K    G +H+ + E   L    G  LN +VK  +LPD S K ++KT     T+N  ++  + +     E+L +  +EL+++ + +L +N+FLGG+R+  G G  +   V WMD+   E   WE  +++PN + +A L LR
Sbjct:  958 SGSVMSVYSGDF----GNLEVKGSVQFALDYVESLKELHVFVAQCKDLAAADVKKQRSDPYVKTYLLPDKGKMGKKKTLVVKKTLNPVYNEILRYKIERQFLKTQKLNLSVWHRDTFKRNSFLGEVELDLETWDWDSKQNKQLKWYPLKRKTAPVALETENR-------GEMKLALQYVPEPSPGKKLPTTGEVHIWVKECLDLPLLRGSHLNSFVKCTILPDTSRKSRQKTRAVGKTTNPVFNHTMVYDGFRPEDLMEACVELTVWDHYKL-TNQFLGGLRIGFGTGKSYGTEVDWMDSTSEEVALWEKMVNSPNTWVEATLPLR 1271          
BLAST of Synaptotagmin protein 5 vs. UniProt/SwissProt
Match: sp|Q8VHQ7|SYTL4_RAT (Synaptotagmin-like protein 4 OS=Rattus norvegicus OX=10116 GN=Sytl4 PE=1 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 1.740e-49
Identity = 124/327 (37.92%), Postives = 183/327 (55.96%), Query Frame = 1
Query:  985 SSNSIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKYKPST-------RRDGKGS----LHVLIVEAQQLEF--DGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWMDAQGIEKTTWENFLSNPNEYTDAILNLRPNL 1926
            S  S+YSE  D     + V+G + FS+ +    +TL I+V +C  LA AD  K+++NPY+KTYLLPDK++  K+K++ KR  INP++ ET  Y +S+  L+ RTL   VWH      N FLGE  V +    L K      PL  K+   +  G   +KGEL++ LKY P++       R+  KG     L V I EA+ L     G + + +VKG+LLP R+   K+KTPV K T N  ++    ++ V LE+L+   LEL+++    L SN+FLGGVRL +G G+   + V WMD+ G E + W+     P  + +  L LR ++
Sbjct:  341 SMMSLYSEAGDF--GNVSVTGKIAFSLKFEQKTQTLVIHVKECHQLAYADEAKKRSNPYVKTYLLPDKSRQGKRKTSIKRDTINPLYDETFRYEISESLLAQRTLQFSVWHHGRFGRNTFLGEAEVHMDSWKLDKKLDHCLPLHGKISTESSPGLPAHKGELVVSLKYIPASKLPVGGDRKKSKGGEGGELQVWIKEAKNLTAAKSGGTSDSFVKGYLLPMRNKASKRKTPVMKKTLNPHYNHTFVYNGVRLEDLQHMCLELTVWDREPLASNDFLGGVRLGVGTGISSGEVVDWMDSTGEEVSLWQKMRQYPGSWAEGTLQLRSSM 665          
BLAST of Synaptotagmin protein 5 vs. UniProt/SwissProt
Match: sp|Q96C24|SYTL4_HUMAN (Synaptotagmin-like protein 4 OS=Homo sapiens OX=9606 GN=SYTL4 PE=1 SV=2)

HSP 1 Score: 187.578 bits (475), Expect = 1.839e-49
Identity = 124/333 (37.24%), Postives = 187/333 (56.16%), Query Frame = 1
Query:  985 SSNSIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKYKPST-------RRDGKGS----LHVLIVEAQQLEF--DGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWMDAQGIEKTTWENFLSNPNEYTDAILNLRPNLEYY*MG 1944
            S  SIYSE  D     + V+G + FS+ Y    ++L ++V +C  LA AD  K+++NPY+KTYLLPDK++  K+K++ KR  INP++ ETL Y + +  L+ RTL   VWH      N FLGE  + +    L K      PL  K+   + +G   +KGEL++ LKY P++       R+  KG     L V I EA+ L     G + + +VKG+LLP R+   K+KTPV K T N  ++    ++ V LE+L+   LEL+++    L SN+FLGGVRL +G G+ + + V WMD+ G E + W+     P  + +  L LR ++    +G
Sbjct:  340 SMMSIYSEAGDF--GNIFVTGRIAFSLKYEQQTQSLVVHVKECHQLAYADEAKKRSNPYVKTYLLPDKSRQGKRKTSIKRDTINPLYDETLRYEIPESLLAQRTLQFSVWHHGRFGRNTFLGEAEIQMDSWKLDKKLDHCLPLHGKISAESPTGLPSHKGELVVSLKYIPASKTPVGGDRKKSKGGEGGELQVWIKEAKNLTAAKAGGTSDSFVKGYLLPMRNKASKRKTPVMKKTLNPHYNHTFVYNGVRLEDLQHMCLELTVWDREPLASNDFLGGVRLGVGTGISNGEVVDWMDSTGEEVSLWQKMRQYPGSWAEGTLQLRSSMAKQKLG 670          
BLAST of Synaptotagmin protein 5 vs. UniProt/SwissProt
Match: sp|Q9R0Q1|SYTL4_MOUSE (Synaptotagmin-like protein 4 OS=Mus musculus OX=10090 GN=Sytl4 PE=1 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 1.886e-49
Identity = 122/324 (37.65%), Postives = 184/324 (56.79%), Query Frame = 1
Query:  994 SIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKYKPSTR----------RDGKGS-LHVLIVEAQQLEF--DGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWMDAQGIEKTTWENFLSNPNEYTDAILNLRPNL 1926
            SIYSE  D     + V+G + FS+ +    +TL I+V +C  LA AD  K+++NPY+KTYLLPDK++  K+K++ KR  INP++ ET  Y +S+  L+ RTL   VWH      N FLGE  V +    L K      PL  K+   +  G   +KGEL++ LKY P+++          + G+G  L V I EA+ L     G + + +VKG+LLP R+   K+KTPV K T +  ++    ++ V LE+L+   LEL+++    L SN+FLGGVRL +G G+ + + V WMD+ G E + W+     P  + +  L LR ++
Sbjct:  345 SIYSEAGDF--GNISVTGKIAFSLKFEQKTQTLVIHVKECHQLAYADEAKKRSNPYVKTYLLPDKSRQGKRKTSIKRDTINPLYDETFRYEISESLLAQRTLQFSVWHHGRFGRNTFLGEAEVHMDSWKLDKKLDHCLPLHGKISTESSPGLPAHKGELVVSLKYIPASKLPVGGDRKKSKGGEGGELQVWIKEAKNLTAAKSGGTSDSFVKGYLLPMRNKASKRKTPVMKKTLSPHYNHTFVYNGVRLEDLQHMCLELTVWDREPLASNDFLGGVRLGVGTGISNGEVVDWMDSTGEEVSLWQKMRQYPGSWAEGTLQLRSSM 666          
BLAST of Synaptotagmin protein 5 vs. UniProt/SwissProt
Match: sp|Q812E4|SYTL5_RAT (Synaptotagmin-like protein 5 OS=Rattus norvegicus OX=10116 GN=Sytl5 PE=2 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 4.414e-45
Identity = 139/414 (33.57%), Postives = 208/414 (50.24%), Query Frame = 1
Query:  772 LRKDESPNVRKREINGVSNPVKENLIDVVD--FAENKTEHVVKSETLELQPRSQTSAHYLHPTNLETLKTMSHSSNSIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRY-PNRSGGHIYKGELIIKLKYKP------------------------STRRDGKGSLHVLIVEAQQLEF--DGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWMDAQGIEKTTWENFLSNPNEYTDAILNLRPNL 1926
            +R    P    +++N + +   E+ +D+V   F+ N T  +    +   Q  S     YLH  + ++  T  +S  S+YSET D     + V+G++L  + Y      L I+V  CRNLA+ D  K++T+ Y+K+YLLPDKT+ +K+K+   R+  NP F ETL Y +S   L  RTL + VWH      N FLGEV +     +       W+ LQ KV   P+ S    YKGEL I L+Y P                         +     G L V I EA+ L     G + + +VKG+LLPD +   K KT V K + N +W+ +  FS +  +++++  LEL+I+      SN FLGGVRLN G G+ H   V WMD++G E+  W+    NP    + +L LR ++
Sbjct:  343 IRSRSVPGALDKDLNSLED--TEDGVDLVSSRFSAN-THSLASGLSTSSQAGSDRKRSYLHVPDADSDTTSLNSMMSVYSETGD--YGNVKVTGEILLHISYCYKTGGLYIFVKNCRNLAIGDEKKQRTDAYVKSYLLPDKTRNNKRKTKI-RTGTNPEFNETLKYTISHTQLETRTLQLSVWHYDRFGRNSFLGEVEIAFDSWNFENPCDEWFVLQPKVELAPDIS--LQYKGELTIVLRYIPPEENLIFPVEQPQGKKIFKKGKKKESPAISGGILEVFIKEAKNLTAVKAGGTSDSFVKGYLLPDDNKATKHKTAVVKKSVNPQWNHVFIFSGLYPQDIQNACLELTIWDKEAFSSNIFLGGVRLNSGSGISHGKAVDWMDSRGEEQRLWQKMADNPGTSVEGVLMLRSSM 748          
BLAST of Synaptotagmin protein 5 vs. UniProt/SwissProt
Match: sp|Q8TDW5|SYTL5_HUMAN (Synaptotagmin-like protein 5 OS=Homo sapiens OX=9606 GN=SYTL5 PE=1 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 1.522e-44
Identity = 124/337 (36.80%), Postives = 175/337 (51.93%), Query Frame = 1
Query:  994 SIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKYKPSTRR------------------------DGKGSLHVLIVEAQQLEF--DGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWMDAQGIEKTTWENFLSNPNEYTDAILNLRPNL 1926
            S+YSET D     + VSG++L  + Y      L I+V  CRNLA+ D  K++T+ Y+K+YLLPDK++ +K+K+   R+  NP F ETL Y +S   L  RTL + VWH      N FLGEV +     +       W+ LQ KV +    G   YKGEL + L+Y P                               G L V I EA+ L     G + + +VKG+LLPD S   K KT V K + N +W+    FS +  +++K+  LEL+I+      SN FLGGVRLN G G+ H  +V WMD+QG E+  W+   +NP    + +L LR ++
Sbjct:  393 SVYSETGD--YGNVKVSGEILLHISYCYKTGGLYIFVKNCRNLAIGDEKKQRTDAYVKSYLLPDKSRNNKRKTKI-RTGTNPEFNETLKYTISHTQLETRTLQLSVWHYDRFGRNSFLGEVEIPFDSWNFENPTDEWFVLQPKVEFAPDIGLQ-YKGELTVVLRYIPPEENLMLPPEQLQGNKTFKKGKKKESPVISGGILEVFIKEAKNLTAVKSGGTSDSFVKGYLLPDDSKATKHKTLVIKKSVNPQWNHTFMFSGIHPQDIKNVCLELTIWDKEAFSSNIFLGGVRLNSGSGVSHGKNVDWMDSQGEEQRLWQKMANNPGTPFEGVLMLRSSM 725          
BLAST of Synaptotagmin protein 5 vs. TrEMBL
Match: A0A293LTR4 (Bitesize isoform (Fragment) OS=Ornithodoros erraticus OX=265619 PE=4 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 2.401e-61
Identity = 143/341 (41.94%), Postives = 201/341 (58.94%), Query Frame = 1
Query:  919 RSQTSAHYLHPTNLETLKTMSHSSNSIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKYKPS--TRRDGK-GSLHVLIVEAQQL--EFDGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWMDAQGIEKTTWENFLSNPNEYTDAILNLRPNL 1926
            RSQTS   + P+  E++        S+YS         +VV+G+  F++ YN  +  L ++V QCRNLA  D  K +++PY+K YLLPD+TK+ K+K+  K++N+NP+F E L + V+   L AR L + VWH  +   N FLGEV + L++    +N+  WYPLQE  R  +      YKG+L++ LKY P   T    K GSLH+L+ EA+ L       + + + K +LLPDRS  GK+KTPV K T N KW+    + DV+L+ LKDR LEL+++ Y +  SN+FLGGVRL  G G      V WMD+QG E   W   L  PN + +  L LRPNL
Sbjct:  349 RSQTSLSSIAPSRSESM-------TSVYSAA--GRYGTVVVTGEAQFNLLYNPKSGMLEVHVKQCRNLAPVDAKKNRSDPYVKVYLLPDRTKSGKRKTKVKKNNLNPVFDEVLKFRVTMSELQARVLWLSVWHSDIFGRNDFLGEVMLQLSERAFQQNDAKWYPLQE--RRESLEMPLSYKGDLLLSLKYMPPDVTNWASKLGSLHILVKEARNLMATRSNGTADPFCKSYLLPDRSKSGKQKTPVMKKTCNPKWNHTFVYKDVSLDTLKDRCLELTLWDYDKYISNDFLGGVRLGTGTGRALGADVDWMDSQGEEVVLWRTMLEKPNTWVEGKLQLRPNL 678          
BLAST of Synaptotagmin protein 5 vs. TrEMBL
Match: A0A131XGS8 (Putative ca2+-dependent phospholipid-binding protein synaptotagmin (Fragment) OS=Hyalomma excavatum OX=257692 PE=2 SV=1)

HSP 1 Score: 218.779 bits (556), Expect = 1.889e-60
Identity = 145/347 (41.79%), Postives = 204/347 (58.79%), Query Frame = 1
Query:  919 RSQTSAHYLHPTNLETLKTMSHSSNSIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKYKPS--TRRDGK-----GSLHVLIVEAQQL---EFDGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWMDAQGIEKTTWENFLSNPNEYTDAILNLRPNLE 1929
            RSQTS   +  + +      S S  S+YS         + V+G+VLFS+ YN  +  L ++V +CRNLA  D  + +++PY+K YLLPDKTK+ K+K+  K+  +NP+F+E L + V+   L ARTL + VWH  +   N FLGEV + L    L K E   + LQE+   P       YKG++++ LKY P   T R  K     GSLHVL+ EA+ L     +G S + + K +LLPDR+   K+KTPV K   N KW+    + DV+L+ELKDR LEL+I+ Y ++ SN+FLGGVRL LG G  +   V WMD+ G E T W + L  PN + D  L LRP+++
Sbjct:   75 RSQTSLSSIGVSQMR-----SESMTSVYSAAGGGRYGTVAVTGEVLFSILYNYKSGLLEVHVRECRNLAPVDTKRNRSDPYVKVYLLPDKTKSGKRKTKVKKHTLNPVFEEVLKFRVTMSELQARTLWLSVWHSDMFGRNDFLGEVMLPLTYETLEKTEVRCFALQERFECPEVPLS--YKGDILLALKYMPPDVTSRSIKQGPVRGSLHVLVKEARNLTATRSNGTS-DPFCKSYLLPDRTKGSKQKTPVVKKCCNPKWNHTFVYPDVSLDELKDRCLELTIWDYDKITSNDFLGGVRLGLGTGKLYGRDVDWMDSHGEEVTLWRSMLERPNLWIDGSLLLRPSMQ 413          
BLAST of Synaptotagmin protein 5 vs. TrEMBL
Match: A0A1B6FHJ6 (Uncharacterized protein (Fragment) OS=Cuerna arida OX=1464854 GN=g.34692 PE=4 SV=1)

HSP 1 Score: 216.853 bits (551), Expect = 9.686e-60
Identity = 150/401 (37.41%), Postives = 222/401 (55.36%), Query Frame = 1
Query:  784 ESPNVRKREIN-GVSNPV----------KENLIDVVDFAENKTEHVVKSETLELQPRSQTSAHYLHPTNLETLKTMSHSSNSIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKY-----KPSTRRDGKGSLHVLIVEAQQL---EFDGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWMDAQGIEKTTWENFLSNPNEYTDAILNLRPNLE 1929
            ESP V KR +N  +  P+          K+  +D  +      +  V SE++ ++   +      +  +  +L   S S  S+YS   +     + V G+V F + YN     L IYV QCR+LA  D  + +++PY+K YLLPDK+K+ K+K+  K+  +NP+F+ETL ++++ E L +RTL + VWH  +   N FLGEV + L +       P +Y LQE+        G   KGELI+ LK+      PS +   KG L VL+ EA+ L   + +G S + + K +LLPD+    K+KTPV +   +  W     ++ VTL+EL  RSLEL+I+ + RL SNEFLGGVRLNLG G H+   V WMDA G E T W+  L  PN + ++ L LRP+L+
Sbjct:   15 ESPLVTKRSVNDAIIEPLTGAVFRKVTLKKRRVDTRNLPPVSDDASVCSESVSVRAVEEEDRLTNNRASSSSLGARSDSLASVYSGAGEGRYGSVAVRGEVEFGLQYNYKQGALEIYVKQCRDLAAVDTKRNRSDPYVKVYLLPDKSKSGKRKTRVKKHTLNPVFEETLKFHITLEGLESRTLWLSVWHSDMFGRNDFLGEVTMALENKVFDDPLPKFYTLQERSEPLEELVGS--KGELIVGLKFVPPEVSPSKKGGNKGCLQVLVKEAKNLAAVKSNGTS-DPFCKSYLLPDKGRSSKQKTPVLRKCCSPAWHHTFTYAGVTLDELASRSLELTIWDHDRLASNEFLGGVRLNLGSGKHNGKAVDWMDASGKETTLWQRMLERPNLWVESCLPLRPSLD 412          
BLAST of Synaptotagmin protein 5 vs. TrEMBL
Match: A0A2R5L821 (Putative ca2+-dependent phospholipid-binding protein synaptotagmin (Fragment) OS=Ornithodoros turicata OX=34597 PE=4 SV=1)

HSP 1 Score: 224.557 bits (571), Expect = 2.442e-59
Identity = 143/341 (41.94%), Postives = 199/341 (58.36%), Query Frame = 1
Query:  919 RSQTSAHYLHPTNLETLKTMSHSSNSIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKYKPS--TRRDGK-GSLHVLIVEAQQLEF--DGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWMDAQGIEKTTWENFLSNPNEYTDAILNLRPNL 1926
            RSQTS   + P+  E++        S+YS         +VV+G+  FS+ YN  +  L ++V QCR LA  D  K +++PY+K YLLPD+TK+ K+K+  K++N+NP+F E L + V+   L AR L + VWH  +   N FLGEV + L++    + +  WYPLQE  R  +      YKG+L++ LKY P   T    K GSLHVL+ EA+ L       + + + K +LLPDRS  GK+KTPV K T N KW+    + DV+L+ LKDR LEL+++ Y +  SN+FLGGVRL  G G      V WMD+QG E   W   L  PN + +  L LRPNL
Sbjct:  481 RSQTSLSSIAPSRSESM-------TSVYSAA--GRYGTVVVTGEAQFSLVYNPKSGMLEVHVKQCRGLAPVDTKKNRSDPYVKVYLLPDRTKSGKRKTKVKKNNLNPVFDEVLKFRVTMSELQARVLWLSVWHSDIFGRNDFLGEVMLQLSERAFKQTDSKWYPLQE--RRESLEMPLSYKGDLLLSLKYMPPDVTNWASKLGSLHVLVKEARNLMATRSNGTADPFCKSYLLPDRSKSGKQKTPVMKKTCNPKWNHTFVYKDVSLDTLKDRCLELTLWDYDKYISNDFLGGVRLGTGTGRVLGAEVDWMDSQGEEVLLWRTMLEKPNTWVEGKLQLRPNL 810          
BLAST of Synaptotagmin protein 5 vs. TrEMBL
Match: A0A067R2Z2 (Synaptotagmin-like protein 4 OS=Zootermopsis nevadensis OX=136037 GN=L798_09339 PE=4 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 3.069e-59
Identity = 143/375 (38.13%), Postives = 209/375 (55.73%), Query Frame = 1
Query:  853 VVDFAENKTEHVVKSETLELQPRSQTS---AHYLHPTNLETLKTMSHSSNSIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKYKPS---------TRRDGKGSLHVLIVEAQQL---EFDGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWMDAQGIEKTTWENFLSNPNEYTDAILNLRPNLEY 1932
            +V     K    V S    L P        A +   ++L +L   S S  S+YS   +     + V G+V F + YN     L I+V QCR+LA  D  + +++PY+K YLLPDK+K+ K+K+  K+  +NP+F ETL + ++   L  RTL + VWH  +   N FLGEV + L +       P WYPLQE+    +      YKG+LII LK+ P           +R  +GSL+VL+  A+ L   + +G S + + K +LLPD+    K+KTPV + T +  W+    + DV+L+EL +RSLEL+++ + RL SNEFLGG+R NLG G H+   V WMDA G E T W++ L  PN + +  L LRP+LE+
Sbjct:  185 IVGAGGRKGPGSVSSGEWPLSPEEDIDRLVAIHQQRSSLSSLGPRSDSLASVYSGAGEGQYGTVAVKGEVEFGLEYNYKAGALEIHVKQCRDLAPVDTKRNRSDPYVKVYLLPDKSKSGKRKTKVKKHTLNPVFDETLKFQITLHGLETRTLWLTVWHSDMFGRNDFLGEVMMALENKMFDDPSPHWYPLQERTEPFDDL--LSYKGDLIIGLKFVPPDVTSAIQKKGKRSSRGSLNVLVKGAKNLTAVKANGTS-DPFCKSYLLPDKGRSSKQKTPVLRRTCSPVWNYSFIYEDVSLQELSERSLELTVWDHDRLASNEFLGGLRFNLGAGKHYGKAVDWMDATGKEVTLWQHMLERPNFWVEGCLTLRPSLEH 556          
BLAST of Synaptotagmin protein 5 vs. Ensembl Cavefish
Match: sytl5 (synaptotagmin like 5 [Source:NCBI gene;Acc:103044935])

HSP 1 Score: 170.629 bits (431), Expect = 1.753e-44
Identity = 135/406 (33.25%), Postives = 204/406 (50.25%), Query Frame = 1
Query:  799 RKREINGVSNPVKENLIDVVDFAENKTEHVVKS-ETLELQPRSQTSAHYLHPTNLETLKTMSHSSNSIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHI-----YKGELIIKLKYKPSTRR---------------DGK--------GSLHVLIVEAQQL-EFDGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWMDAQGIEKTTWENFLSNPNEYTDAILNLRPNL 1926
            R   + G+++   +  ID +  A  KT   V S +++   PRS+    +L+  + +   +  +S  S+YSET D Y +  V SG++L ++ Y+     LN+ V +CR LA  D  K++T+PY+KTYLLPDK++ SK+K++ K +  NP+F + L Y VS   L  RTL V VWH     +N FLGE  +     +       W+ LQ       R+ G +     YKGEL + LKY P+ R                 GK        G + +L+ EA+ L      S + +VKG+LLPD     K KT V K + N +W+    +  +   +L    LEL+++    L SN FLGGVRL  G GL +   V W D+ G E+  W+  + NP    +  L LR ++
Sbjct:  291 RCHSVPGLNDAESDEDIDALLSAHYKTSRSVGSAQSVSSTPRSERKWSFLNVPDSDAETSSLNSMMSVYSETGD-YGNARV-SGEILLNISYSYKTGALNVLVRECRCLATGDERKQRTDPYVKTYLLPDKSRQSKRKTSIKNNTTNPVFNDNLRYVVSHSQLETRTLQVSVWHHDRFGHNSFLGETELTFDSWEFDTQIEEWFALQP------RAEGSVDSMIQYKGELTVVLKYIPAERNLSLPLDQIQVKKGFLKGKKSITLPKGGMVELLVKEAKNLTAVKSGSSDPFVKGYLLPDDKKSTKHKTAVVKRSVNPRWNHTFTYCGLQHTDLDSVCLELTVWDKEPLASNVFLGGVRLGAGTGLSYGKEVDWNDSYGEEQRLWQRMIDNPEVPQECTLMLRSSM 688          
BLAST of Synaptotagmin protein 5 vs. Ensembl Cavefish
Match: sytl5 (synaptotagmin like 5 [Source:NCBI gene;Acc:103044935])

HSP 1 Score: 165.622 bits (418), Expect = 8.230e-43
Identity = 127/363 (34.99%), Postives = 187/363 (51.52%), Query Frame = 1
Query:  931 SAHYLHPTNLETLKTMS--HSSNSIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHI-----YKGELIIKLKYKPSTRR---------------DGK--------GSLHVLIVEAQQL-EFDGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWMDAQGIEKTTWENFLSNPNEYTDAILNLRPNL 1926
            SAHY    ++ + +++S  +S  S+YSET D Y +  V SG++L ++ Y+     LN+ V +CR LA  D  K++T+PY+KTYLLPDK++ SK+K++ K +  NP+F + L Y VS   L  RTL V VWH     +N FLGE  +     +       W+ LQ       R+ G +     YKGEL + LKY P+ R                 GK        G + +L+ EA+ L      S + +VKG+LLPD     K KT V K + N +W+    +  +   +L    LEL+++    L SN FLGGVRL  G GL +   V W D+ G E+  W+  + NP    +  L LR ++
Sbjct:  312 SAHYKTSRSVGSAQSVSSLNSMMSVYSETGD-YGNARV-SGEILLNISYSYKTGALNVLVRECRCLATGDERKQRTDPYVKTYLLPDKSRQSKRKTSIKNNTTNPVFNDNLRYVVSHSQLETRTLQVSVWHHDRFGHNSFLGETELTFDSWEFDTQIEEWFALQP------RAEGSVDSMIQYKGELTVVLKYIPAERNLSLPLDQIQVKKGFLKGKKSITLPKGGMVELLVKEAKNLTAVKSGSSDPFVKGYLLPDDKKSTKHKTAVVKRSVNPRWNHTFTYCGLQHTDLDSVCLELTVWDKEPLASNVFLGGVRLGAGTGLSYGKEVDWNDSYGEEQRLWQRMIDNPEVPQECTLMLRSSM 666          
BLAST of Synaptotagmin protein 5 vs. Ensembl Cavefish
Match: sytl4 (synaptotagmin like 4 [Source:NCBI gene;Acc:103045066])

HSP 1 Score: 158.303 bits (399), Expect = 2.040e-40
Identity = 123/333 (36.94%), Postives = 185/333 (55.56%), Query Frame = 1
Query:  994 SIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHI-------YKGELIIKLKY-----KPS-------TRRDGKGSLHVLIVEAQQLEF--DGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWM-DAQGIEKTTWENFLSNPNEYTDAILNLRPNL 1926
            S+YSE  D     + VSG+++FS+ Y++  ++L + V +CR LA AD  K++ NPY+K+YLLPDK++ SKKK+ +K   INP + ETL Y++S+  L  RTL + VWH      N FLGEV + L   D+          +E V    ++ G +       YKGEL+I LKY      PS        + +  G LHVLI EA+ L     G + + +VKG+LLP +    KKKT V K T N  +D    + D++L++L+   LEL+++    + SN+FLGGVRL+ G          W+ D+ G E + WE  +  P+ + +  L LR ++
Sbjct:  327 SVYSEAGD--YDIVDVSGEIVFSLHYDETAQSLAVMVKECRGLAYADAAKKKCNPYVKSYLLPDKSRQSKKKTATKSKTINPTYNETLKYSISRSQLMTRTLQLSVWHYDRFGRNAFLGEVQLPLDCHDIDSAH------EECVILRGKAAGSLAPSAFAQYKGELVISLKYVSEKKAPSEKQKAKKAKAESGGELHVLIKEAKNLSAMKAGGTSDSFVKGYLLPSKGKSTKKKTQVVKKTLNPHYDHTFIYKDLSLDQLRGVCLELTVWDREAMSSNDFLGGVRLSSGAAHLKEGKQEWVADSTGEEVSVWEKMMQFPDSWAEGTLPLRSSM 651          
BLAST of Synaptotagmin protein 5 vs. Ensembl Cavefish
Match: sytl4 (synaptotagmin like 4 [Source:NCBI gene;Acc:103045066])

HSP 1 Score: 158.303 bits (399), Expect = 3.138e-40
Identity = 123/333 (36.94%), Postives = 185/333 (55.56%), Query Frame = 1
Query:  994 SIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHI-------YKGELIIKLKY-----KPS-------TRRDGKGSLHVLIVEAQQLEF--DGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWM-DAQGIEKTTWENFLSNPNEYTDAILNLRPNL 1926
            S+YSE  D     + VSG+++FS+ Y++  ++L + V +CR LA AD  K++ NPY+K+YLLPDK++ SKKK+ +K   INP + ETL Y++S+  L  RTL + VWH      N FLGEV + L   D+          +E V    ++ G +       YKGEL+I LKY      PS        + +  G LHVLI EA+ L     G + + +VKG+LLP +    KKKT V K T N  +D    + D++L++L+   LEL+++    + SN+FLGGVRL+ G          W+ D+ G E + WE  +  P+ + +  L LR ++
Sbjct:  398 SVYSEAGD--YDIVDVSGEIVFSLHYDETAQSLAVMVKECRGLAYADAAKKKCNPYVKSYLLPDKSRQSKKKTATKSKTINPTYNETLKYSISRSQLMTRTLQLSVWHYDRFGRNAFLGEVQLPLDCHDIDSAH------EECVILRGKAAGSLAPSAFAQYKGELVISLKYVSEKKAPSEKQKAKKAKAESGGELHVLIKEAKNLSAMKAGGTSDSFVKGYLLPSKGKSTKKKTQVVKKTLNPHYDHTFIYKDLSLDQLRGVCLELTVWDREAMSSNDFLGGVRLSSGAAHLKEGKQEWVADSTGEEVSVWEKMMQFPDSWAEGTLPLRSSM 722          
BLAST of Synaptotagmin protein 5 vs. Ensembl Cavefish
Match: sytl1 (synaptotagmin-like protein 1 [Source:NCBI gene;Acc:103029374])

HSP 1 Score: 149.828 bits (377), Expect = 3.730e-38
Identity = 119/357 (33.33%), Postives = 189/357 (52.94%), Query Frame = 1
Query:  877 TEHVVKSETLELQPRSQTSAHYLHPTNLETLKTMSHSSNSIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRY-PNRSGGHIYKGELIIKLKYKPSTRRDG----KGSLHVLIVEAQQLEFDGQSL-NVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWMDAQGIEKTTWENFLSNPNEYTDAILNLRPNLE 1929
            +E  + S + EL      S + LH +++     MS S  S+YS        G+ V+G +  S+ Y+   + L++ V  C++LA A RN R ++PY+K YLLPD T  SKKK+  KR  +NP++ ETL Y V K  L AR LSV VWH   +  N FLGEV V L   D  +++P WY LQ +V+  P+     I +G ++  +K+ P     G     G LH+ + E   L    + + N +VK  +LPD S    ++T V + + +  ++  + +  +   +L     E+++++     S+  LGGVRL+ G G+ +   V WMD+   E + W   + NPN + DA L +R +L+
Sbjct:  194 SEGDIDSGSTELADTRFGSINSLHSSHM-----MSGSLMSLYSV---GDFGGVTVTGRIQLSLHYDPKKEELHVRVCCCQDLAPA-RNNR-SDPYVKVYLLPDNTSRSKKKTAVKRKTLNPVYDETLKYKVRKSELQARVLSVSVWHMERVRRNLFLGEVEVGLDQWDWGRSQPTWYSLQPRVQMNPD---AIISRGTILFSMKFIPPGSEGGGFPLTGELHIWLREVIGLLPPKRGIPNTHVKSVVLPDESGVSGQQTRVVRGSVSPVFNHTMVYDGLQSSDLLQACAEITVWN-----SSNCLGGVRLSTGSGVSYGQKVCWMDSTEEEISVWNTIIGNPNSWVDAALPVRTSLQ 532          
BLAST of Synaptotagmin protein 5 vs. Ensembl Sea Lamprey
Match: sytl2a (synaptotagmin-like 2a [Source:ZFIN;Acc:ZDB-GENE-130723-2])

HSP 1 Score: 131.339 bits (329), Expect = 1.462e-34
Identity = 88/261 (33.72%), Postives = 151/261 (57.85%), Query Frame = 1
Query: 1159 YIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKYKPSTR----RDGKGSLHVLIVEAQQ-LEFDGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWMDAQGIEKTTWENFLSNPNEYTDAILNLRPNL 1926
            Y+KTYLLPDK++ SKKK+T +++N+NP++ E L Y +    L +R L++ VWH      N FLGEV + L+  D       W+ LQ +V           +G L + LK+ P+      ++  G +H+ + EA+  L      ++ +VK ++LPD S K ++KT   K + N  ++  + +     E++++  +EL+++  + + SN+FLGG+RL LG G+ +   V WMD++  E   W N ++ P E+T+A+L LRP++
Sbjct:    1 YVKTYLLPDKSRQSKKKTTVRKNNLNPVYNEILKYKIPARELQSRVLNLSVWHNDKFGKNSFLGEVEMELSTWDWGNTAYNWFDLQPRVHISQED--LTSRGYLNLALKFIPANSVGKTKNASGEIHIWVKEAKNLLPLKPHGVDAFVKCYILPDLSRKSRQKTRTVKKSMNPVFNHTMVYDGFQDEDMREACVELTVWD-QEMFSNQFLGGLRLGLGGGMSYGKPVDWMDSREGEVAVWHNMITRPGEWTEALLPLRPDM 258          
BLAST of Synaptotagmin protein 5 vs. Ensembl Sea Lamprey
Match: sytl2a (synaptotagmin-like 2a [Source:ZFIN;Acc:ZDB-GENE-130723-2])

HSP 1 Score: 124.02 bits (310), Expect = 5.891e-32
Identity = 87/267 (32.58%), Postives = 149/267 (55.81%), Query Frame = 1
Query: 1159 YIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKYKPSTR----------RDGKGSLHVLIVEAQQ-LEFDGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWMDAQGIEKTTWENFLSNPNEYTDAILNLRPNL 1926
            Y+KTYLLPDK++ SKKK+T +++N+NP++ E L Y +    L +R L++ VWH      N FLGEV + L+  D       W+ LQ +     +      +G L + LK+ P+                G +H+ + EA+  L      ++ +VK ++LPD S K ++KT   K + N  ++  + +     E++++  +EL+++  + + SN+FLGG+RL LG G+ +   V WMD++  E   W N ++ P E+T+A+L LRP++
Sbjct:    1 YVKTYLLPDKSRQSKKKTTVRKNNLNPVYNEILKYKIPARELQSRVLNLSVWHNDKFGKNSFLGEVEMELSTWDWGNTAYNWFDLQPRTSPALKD--LTSRGYLNLALKFIPANSVAPPTPEGQFTPASGEIHIWVKEAKNLLPLKPHGVDAFVKCYILPDLSRKSRQKTRTVKKSMNPVFNHTMVYDGFQDEDMREACVELTVWD-QEMFSNQFLGGLRLGLGGGMSYGKPVDWMDSREGEVAVWHNMITRPGEWTEALLPLRPDM 264          
BLAST of Synaptotagmin protein 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006493.1 (pep scaffold:Pmarinus_7.0:GL476457:113922:122135:1 gene:ENSPMAG00000005868.1 transcript:ENSPMAT00000006493.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 111.309 bits (277), Expect = 1.182e-28
Identity = 63/151 (41.72%), Postives = 92/151 (60.93%), Query Frame = 1
Query: 1039 VSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKV-RYPNRSGGHIYKGELIIKLKY 1488
            VSGD+ FSV Y+     L++ + QCRNLA  +   ++ +PY+K YLLPDK++  K+K+  K++ INP+F ETL Y +S   L  R + + VWH     +N FLG+  + L   DL + +  W  LQ +V R P  +  + YKGELI+ LKY
Sbjct:    1 VSGDINFSVSYDYRVGVLSLTLRQCRNLAYGEERTKRCDPYVKVYLLPDKSRQGKRKTKIKKNTINPVFNETLKYAISHTQLEVRCVHLSVWHHDSFRHNSFLGQASLPLDCCDLERGDDRWCALQPRVTRNPFAAINNKYKGELILALKY 151          

HSP 2 Score: 49.2914 bits (116), Expect = 4.460e-7
Identity = 23/63 (36.51%), Postives = 44/63 (69.84%), Query Frame = 1
Query: 1582 YVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEF 1770
            YVK +LLPD+S +GK+KT ++K+T N  ++  L+++ ++  +L+ R + LS++H+   + N F
Sbjct:   41 YVKVYLLPDKSRQGKRKTKIKKNTINPVFNETLKYA-ISHTQLEVRCVHLSVWHHDSFRHNSF 102          
BLAST of Synaptotagmin protein 5 vs. Ensembl Sea Lamprey
Match: pik3c2a (phosphatidylinositol-4-phosphate 3-kinase, catalytic subunit type 2 alpha [Source:ZFIN;Acc:ZDB-GENE-030328-39])

HSP 1 Score: 78.1814 bits (191), Expect = 3.289e-15
Identity = 49/127 (38.58%), Postives = 68/127 (53.54%), Query Frame = 1
Query: 1039 VSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNV-SKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQ 1416
            V G V  SV Y   N  L I V   ++L   D      +PY+KTYLLPD  + +K+K+   R  +NP + E L+YN  SKE+L  R L + VW    +  N FLG + + L ++DL      W+PLQ
Sbjct:  820 VGGKVKLSVSYR--NAALFIMVMHIKDLVFTD--GADPDPYVKTYLLPDPNRVTKRKTKIARKTLNPTYNEMLVYNCFSKEALKQRRLQLSVWSAEALRENIFLGGLSLSLRELDLDHETVGWFPLQ 942          

HSP 2 Score: 54.6842 bits (130), Expect = 5.919e-8
Identity = 37/111 (33.33%), Postives = 62/111 (55.86%), Query Frame = 1
Query: 1516 GSLHVLIVEAQQLEF-DGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWMDAQG 1845
             +L ++++  + L F DG   + YVK +LLPD +   K+KT + + T N  ++ +L ++  + E LK R L+LS++    L+ N FLGG+ L+L       + V W   QG
Sbjct:  833 AALFIMVMHIKDLVFTDGADPDPYVKTYLLPDPNRVTKRKTKIARKTLNPTYNEMLVYNCFSKEALKQRRLQLSVWSAEALRENIFLGGLSLSLRELDLDHETVGWFPLQG 943          
BLAST of Synaptotagmin protein 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004426.1 (pep scaffold:Pmarinus_7.0:GL476335:1496408:1550941:1 gene:ENSPMAG00000004026.1 transcript:ENSPMAT00000004426.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.855 bits (159), Expect = 2.067e-11
Identity = 46/168 (27.38%), Postives = 83/168 (49.40%), Query Frame = 1
Query:  949 PTNLETLKTMSHSSNSIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRS---------NINPIFKETLIY-NVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEK 1422
            P+   +  + S   +S  S T +  K    ++G++   + ++  +  L I+V Q R LA  D N   ++P++K YLLP + +    ++ S  +          +NP + +T++Y N+  + L  +TL   VW     + N FLGEV + L+D+        WYPL+E+
Sbjct:  129 PSRPASPASGSKKRHSKTSYTIEVTKPSHPITGEIQLQMSFDRHSGNLIIHVLQARGLAPRDNNGF-SDPFVKVYLLPGRGQVMVVQNASSENKRRTKYIHKTLNPEWNQTVVYKNIMLDELKRKTLEFSVWDYDRFSSNDFLGEVRIELSDVSHLDGAQRWYPLREQ 295          

HSP 2 Score: 50.0618 bits (118), Expect = 1.339e-6
Identity = 32/116 (27.59%), Postives = 58/116 (50.00%), Query Frame = 1
Query: 1450 HIYKGELIIKLKYKPSTRRDGKGSLHVLIVEAQQLEFDGQSLNVYVKGFLLPDR---------SNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEF 1770
            H   GE+ +++ +    R  G   +HVL         +    + +VK +LLP R         S++ K++T     T N +W+  + + ++ L+ELK ++LE S++ Y R  SN+F
Sbjct:  157 HPITGEIQLQMSFD---RHSGNLIIHVLQARGLAPRDNNGFSDPFVKVYLLPGRGQVMVVQNASSENKRRTKYIHKTLNPEWNQTVVYKNIMLDELKRKTLEFSVWDYDRFSSNDF 269          
BLAST of Synaptotagmin protein 5 vs. Ensembl Nematostella
Match: EDO29765 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2P9])

HSP 1 Score: 108.227 bits (269), Expect = 6.300e-26
Identity = 101/316 (31.96%), Postives = 159/316 (50.32%), Query Frame = 1
Query:  994 SIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYN-VSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKL-KYKPSTRRDG---KGSLHVLIVEAQQL---EFDGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWMDAQGIEKTTWENFLSNPNEYTDAILNLR 1917
            S YS+  +     + V+G+V   + Y+  ++ L + V + R++A  D  K++++PY    LLPDK + SK+K+ + R N+NP +     Y+ V+ E L  R+L + VW       N FLG V + +   + S    V Y            G    KGE+ +   K K  ++R     KG LHV I+EA+ L   + DG S + + K  LLPD+  K + KT + K T N  WD  L + +++ EEL+ R LE+SI+ +     +EFLGG+RL LG   +      W D+   E   W   L+  N +   ++ LR
Sbjct:    4 SYYSDAGEGNYGNIPVTGEVQVGLRYDYKHEKLEVQVHRARDIAPVDTKKKRSDPY----LLPDKGRKSKRKTPTIRKNLNPQWNFPFTYDDVTLEELMDRSLELTVWDWDRGASNDFLGGVRLGMETRNYSSRHRVRYWFVGMCTMAPGVGRGKNKGEVYVTAEKVKRKSKRQSIASKGELHVHIMEAKNLPGKDADGMS-DPFCKITLLPDKKGKTRHKTAIIKRTLNPSWDYNLIYEELSQEELRQRVLEISIWDHDIASRDEFLGGLRLGLGTSANE-----WDDSSKDEAQIWHTMLTRTNVWIQVVVPLR 309          
BLAST of Synaptotagmin protein 5 vs. Ensembl Nematostella
Match: EDO41933 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S352])

HSP 1 Score: 81.2629 bits (199), Expect = 8.399e-17
Identity = 80/286 (27.97%), Postives = 147/286 (51.40%), Query Frame = 1
Query: 1045 GDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLI-YNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKYKPSTRRDGKGSLHVLIVEAQQL---EFDGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWMDAQGIEKTTWENFLSNPNE 1890
            G + F++ Y   +  L++ +   + L   D     ++PY+K +LLP  +K++K +S +K   +NP+F ETL  Y +++E +S++TL + V+ +  +  N F+GE  + L  ++ +  +     L  K         H   G + + LKY  +T+R   G L V ++    L   + +G S + YVK +L PD   K K++T ++K T N +++    + D+   EL  +SLE++++ Y   KSN+F+GGV             +  ++A+G     W + L  PN+
Sbjct:   20 GLLEFTLRYQKLDSRLDVVLHDAKGLKPMDHGG-TSDPYVKLHLLPGASKSNKLRSHTKYKTLNPVFNETLTYYGITEEEISSKTLRLQVFDEDTIGRNDFIGETSINLKLLNSNPTQTFKRSLIPKA----LDSPHSPLGRIQLALKY--NTQR---GMLFVTVMRCSGLASMDANGYS-DPYVKCYLKPDPQKKSKRRTNIRKKTLNPEFNEEFVY-DIAHHELAKKSLEVTVWDYDVGKSNDFIGGV-------------ILNINAEGSALKHWYDMLKGPNQ 280          

HSP 2 Score: 58.5362 bits (140), Expect = 2.507e-9
Identity = 39/121 (32.23%), Postives = 64/121 (52.89%), Query Frame = 1
Query:  994 SIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEV 1356
            S+  +  DS  S L   G +  ++ YN     L + V +C  LA  D N   ++PY+K YL PD  K SK+++  ++  +NP F E  +Y+++   L+ ++L V VW   +   N F+G V
Sbjct:  141 SLIPKALDSPHSPL---GRIQLALKYNTQRGMLFVTVMRCSGLASMDANG-YSDPYVKCYLKPDPQKKSKRRTNIRKKTLNPEFNEEFVYDIAHHELAKKSLEVTVWDYDVGKSNDFIGGV 257          
BLAST of Synaptotagmin protein 5 vs. Ensembl Nematostella
Match: EDO43704 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXY7])

HSP 1 Score: 70.4774 bits (171), Expect = 2.211e-13
Identity = 63/246 (25.61%), Postives = 120/246 (48.78%), Query Frame = 1
Query: 1045 GDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIY-NVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKYKPSTRRDGKGSLHVLIVEAQQL---EFDGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEF 1770
            G + FS+ Y   +  L + V + + L   D +   ++P++K  LLPDK    + +    R N+NP++ E   +       L  +TL + V      + N  +GEV + L ++DL    PV     + +  P +    +  G+L++ L Y+P+  R     + V++++A +L   +  G S + YVK +++       KKKT +++ T +  W+    F DV L++++D +   ++  Y R+  NE 
Sbjct:    4 GKIFFSLTYYSSDSVLTLKVLKAQGLPAKDFSG-TSDPFVKIMLLPDKKHKLETRVK--RKNLNPVWNEVFTFEGFPHNKLMGKTLYMQVLDYDRFSRNDPIGEVEIPLENIDLG---PVTLTFTKDL-LPCKKD-RVPLGDLLVSLMYQPTNNR-----IIVVVMKANKLKAMDLTGSS-DPYVKMYIMHKDRRLDKKKTTIKRRTRDPVWNESFIF-DVPLDKIRDLTFVFNVMDYDRITQNEL 234          
BLAST of Synaptotagmin protein 5 vs. Ensembl Nematostella
Match: EDO31746 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX17])

HSP 1 Score: 70.0922 bits (170), Expect = 7.240e-13
Identity = 78/264 (29.55%), Postives = 132/264 (50.00%), Query Frame = 1
Query: 1003 SETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIY-NVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYK----GELIIKLKYKPSTRRDGKGSLHVLIVEAQQL---EFDGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEF 1770
            SE Y S  S  V  G + F++ Y+  + TL + + +  ++   D +   ++PY+K  LLPDK K  + K    R  +NP+F E  ++ N+    ++ R L + ++     + +  +GE  + L D+DL+ N   W  L      P+ SGG  +     G++   L+Y PS+     G L + IVEA+ L   +  G S + YVK  L+ +     KKKT V+K T N  ++    F+ V  E+++  SL +S+  Y R+  +E 
Sbjct:   71 SEDYHSDLSSGVKIGRINFTLDYSFTDNTLTVGIIRAEDIPAKDFSG-SSDPYVKIMLLPDKKKKYETKVH--RKTLNPVFNEQFVFKNIPYSEITNRILLMELFDFDRFSRHDLIGEARLPLIDVDLASNINEWRVLTP----PSGSGGAGHSKSDLGDICFSLRYVPSS-----GKLQITIVEAKSLKSMDLTGYS-DPYVKIALVQEGRKIKKKKTTVKKRTLNPYYNETFTFT-VAFEKIEQTSLIISVLDYDRVGKSEM 320          
BLAST of Synaptotagmin protein 5 vs. Ensembl Nematostella
Match: EDO45977 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRA6])

HSP 1 Score: 70.0922 bits (170), Expect = 2.596e-12
Identity = 50/129 (38.76%), Postives = 72/129 (55.81%), Query Frame = 1
Query: 1039 VSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQT-NPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIY-NVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQE 1419
            VSG +  S+    +   L + V   ++L+   RN     +PY+K YLLPD +KT+K K+   + + NP + ETL+Y N+S   L  R L V VW    +  N F+G V + LADMD S N   WYPL++
Sbjct: 1183 VSGQIKLSI--RHERGALRVMVMHAKDLS--SRNSSTAGDPYVKLYLLPDPSKTTKLKTKIAKKSQNPTYNETLVYSNLSAADLKTRHLQVTVWDHDRVGENDFMGGVVINLADMDSSINITNWYPLKD 1307          

HSP 2 Score: 52.7582 bits (125), Expect = 4.811e-7
Identity = 29/91 (31.87%), Postives = 54/91 (59.34%), Query Frame = 1
Query: 1504 RDGKGSLHVLIVEAQQLEFDGQSL--NVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEF 1770
            R  +G+L V+++ A+ L     S   + YVK +LLPD S   K KT + K + N  ++  L +S+++  +LK R L+++++ + R+  N+F
Sbjct: 1192 RHERGALRVMVMHAKDLSSRNSSTAGDPYVKLYLLPDPSKTTKLKTKIAKKSQNPTYNETLVYSNLSAADLKTRHLQVTVWDHDRVGENDF 1282          
BLAST of Synaptotagmin protein 5 vs. Ensembl Medaka
Match: sytl5 (synaptotagmin like 5 [Source:NCBI gene;Acc:101155809])

HSP 1 Score: 168.318 bits (425), Expect = 1.611e-43
Identity = 127/364 (34.89%), Postives = 186/364 (51.10%), Query Frame = 1
Query:  916 PRSQTSAHYLHPTNLETLKTMSHSSNSIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKYKPSTRR---------------DGK----------GSLHVLIVEAQQLEF--DGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWMDAQGIEKTTWENFLSNPNEYTDAILNLRPNL 1926
            P S+    YL   + +   +  +S  S+YSET D Y +  V SG++L ++ Y+     LN+ V +C NLA  D  K++T+ Y+KTYLLPDK++ SK+K++ K + INP+F E+L Y +S   L  RTL V VWH     YN FLGEV +     +       WY LQ +V     S  H YKGEL + LKY P+                   GK          G + +L+  A+ L     G   + +VKG+LLPD +   K KT V++ T N  W+    +  +   +L +  LEL+++    L SN FLGGVRL  G G  + + V WMD+ G E+  W+  +  P    +  L LR ++
Sbjct:  376 PASERRWGYLSVPDSDAETSSINSMTSMYSETGD-YGNARV-SGEILMNISYSYKTGALNVLVKECHNLATGDERKQRTDAYVKTYLLPDKSRQSKRKTSIKANTINPVFNESLRYVISHSQLELRTLQVSVWHHDRFGYNSFLGEVELSFDSWEFDSQIEEWYALQPRVDGSTDSTMH-YKGELTVVLKYIPAEINTTPPPDQVQVKKGFLKGKKTSSFTLPKGGMVELLVKGAKNLTAVKAGGYSDPFVKGYLLPDSNKSTKHKTAVERRTVNPHWNHTFTYCGLQPGDLNNICLELTVWDKEALASNVFLGGVRLGAGTGNSYGNEVDWMDSYGEEQRVWQRMIETPGVPHECTLLLRSSM 736          
BLAST of Synaptotagmin protein 5 vs. Ensembl Medaka
Match: sytl5 (synaptotagmin like 5 [Source:NCBI gene;Acc:101155809])

HSP 1 Score: 166.777 bits (421), Expect = 3.242e-43
Identity = 123/342 (35.96%), Postives = 178/342 (52.05%), Query Frame = 1
Query:  982 HSSNSIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKYKPSTRR---------------DGK----------GSLHVLIVEAQQLEF--DGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWMDAQGIEKTTWENFLSNPNEYTDAILNLRPNL 1926
            +S  S+YSET D Y +  V SG++L ++ Y+     LN+ V +C NLA  D  K++T+ Y+KTYLLPDK++ SK+K++ K + INP+F E+L Y +S   L  RTL V VWH     YN FLGEV +     +       WY LQ +V     S  H YKGEL + LKY P+                   GK          G + +L+  A+ L     G   + +VKG+LLPD +   K KT V++ T N  W+    +  +   +L +  LEL+++    L SN FLGGVRL  G G  + + V WMD+ G E+  W+  +  P    +  L LR ++
Sbjct:  335 NSMTSMYSETGD-YGNARV-SGEILMNISYSYKTGALNVLVKECHNLATGDERKQRTDAYVKTYLLPDKSRQSKRKTSIKANTINPVFNESLRYVISHSQLELRTLQVSVWHHDRFGYNSFLGEVELSFDSWEFDSQIEEWYALQPRVDGSTDSTMH-YKGELTVVLKYIPAEINTTPPPDQVQVKKGFLKGKKTSSFTLPKGGMVELLVKGAKNLTAVKAGGYSDPFVKGYLLPDSNKSTKHKTAVERRTVNPHWNHTFTYCGLQPGDLNNICLELTVWDKEALASNVFLGGVRLGAGTGNSYGNEVDWMDSYGEEQRVWQRMIETPGVPHECTLLLRSSM 673          
BLAST of Synaptotagmin protein 5 vs. Ensembl Medaka
Match: sytl4 (synaptotagmin like 4 [Source:NCBI gene;Acc:101163586])

HSP 1 Score: 159.844 bits (403), Expect = 9.586e-41
Identity = 118/342 (34.50%), Postives = 196/342 (57.31%), Query Frame = 1
Query:  952 TNLETLKTMSHSSNSIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLL--ADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKYKP-----STRRDGK-------GSLHVLIVEAQQLEF--DGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXX-HHSDHVSWMDAQGIEKTTWENFLSNPNEYTDAILNLRPNL 1926
            +NL   K+   S+ SIYS+  D Y + + VSG V+F++ Y++  ++L +++ +C+ LA  D +++ +NPY+K YLL  KT+ +KKK++ K++ INP+F ETL Y++S+  L  +++S+ VWH   ++ N FLGEV + L  A++D    E +    +     P+ +      GEL+I LKY P     + +  GK       G LHVLI EA+ L+    G + + +V+G L P ++   K KTPV K   N  +DS   + ++TLE++KD  LEL+++    + +NE LGGVRL+ G G          +D+ G E + W+  +  P+ + +  L LR  +
Sbjct:  361 SNLYNSKSSLGSTMSIYSDAGD-YGT-VEVSGQVVFALRYDEHTQSLQVFIKECQGLAHGDASRKLSNPYVKCYLLHGKTRQNKKKTSIKKNTINPVFSETLKYSMSRSELLGQSVSISVWHHGRLSRNVFLGEVTIPLDSANLDTPHEECLHLMGKMSSDVPD-AAFERCSGELVISLKYVPPNKTTTEKVKGKKAAQVQRGELHVLIKEAKNLKSGKSGSTSDSFVRGHLFPSKAKTAKMKTPVVKKNLNPHYDSTFVYKELTLEQMKDMCLELTVWDKEAVLNNELLGGVRLSSGNGAIKVGKEEVELDSVGEEVSLWQKMMQYPDSWAEGTLPLRSTM 699          
BLAST of Synaptotagmin protein 5 vs. Ensembl Medaka
Match: sytl4 (synaptotagmin like 4 [Source:NCBI gene;Acc:101163586])

HSP 1 Score: 149.443 bits (376), Expect = 3.422e-37
Identity = 118/370 (31.89%), Postives = 195/370 (52.70%), Query Frame = 1
Query:  952 TNLETLKTMSHSSNSIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLL--ADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKYKPSTRR---------------------------------DGK-------GSLHVLIVEAQQLEF--DGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXX-HHSDHVSWMDAQGIEKTTWENFLSNPNEYTDAILNLRPNL 1926
            +NL   K+   S+ SIYS+  D Y + + VSG V+F++ Y++  ++L +++ +C+ LA  D +++ +NPY+K YLL  KT+ +KKK++ K++ INP+F ETL Y++S+  L  +++S+ VWH   ++ N FLGEV + L  A++D    E +    +     P+ +      GEL+I LKY P  +                                   GK       G LHVLI EA+ L+    G + + +V+G L P ++   K KTPV K   N  +DS   + ++TLE++KD  LEL+++    + +NE LGGVRL+ G G          +D+ G E + W+  +  P+ + +  L LR  +
Sbjct:  361 SNLYNSKSSLGSTMSIYSDAGD-YGT-VEVSGQVVFALRYDEHTQSLQVFIKECQGLAHGDASRKLSNPYVKCYLLHGKTRQNKKKTSIKKNTINPVFSETLKYSMSRSELLGQSVSISVWHHGRLSRNVFLGEVTIPLDSANLDTPHEECLHLMGKMSSDVPD-AAFERCSGELVISLKYVPPNKTTTEKVKGILKTCIFCLFILLKLLPLFFKYLNFPSGKKAAQVQRGELHVLIKEAKNLKSGKSGSTSDSFVRGHLFPSKAKTAKMKTPVVKKNLNPHYDSTFVYKELTLEQMKDMCLELTVWDKEAVLNNELLGGVRLSSGNGAIKVGKEEVELDSVGEEVSLWQKMMQYPDSWAEGTLPLRSTM 727          
BLAST of Synaptotagmin protein 5 vs. Ensembl Medaka
Match: ENSORLT00000041991.1 (synaptotagmin-like protein 2 [Source:NCBI gene;Acc:101169380])

HSP 1 Score: 145.976 bits (367), Expect = 1.088e-35
Identity = 106/334 (31.74%), Postives = 183/334 (54.79%), Query Frame = 1
Query:  946 HP-TNLETLKTMSHSSNSIYSETYDSYKSGLV-VSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKYKPS-TRRDG-------KGSLHVLIVEAQQLEFDGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWMDAQGIEKTTWENFLSNPNEYTDAILNLR 1917
            HP TNL +  +M+  S S+ +     Y   LV V G++ FS+ Y    +  +I+V +CR+LA  D  + +++PY+K+YL+PDK    K+K++ K+  +NP F E L Y V  + L  + L + VWH      N FLGEV V L+  D    +  +  L+ K   P     +  +GE+ + +++ P  +  +G        G +H+ + + + L     +++ YVK F+LPD S KG++KT V + T +  ++  + +  +++ +L +  +EL+++   RL SN  LGGVRL +G G  +   V WMD+   E   W+  +++PNE+ + +L LR
Sbjct:  895 HPVTNLRSSPSMTSLSGSVMT----MYSGDLVEVQGNIHFSINYVQRLREFHIFVSECRDLAAVDPKRGRSDPYVKSYLVPDKANLGKRKTSVKKKTLNPTFNEILRYRVRMDYLQTQMLVLSVWHHDTFGRNSFLGEVDVDLSKWDFDHTQMNYLALKAKT-MPTVEPTN-GRGEMRLAIRFLPQISHSEGVAKDISNSGEIHIWVKDCKGLPLIRATIDPYVKCFVLPDTSRKGRQKTRVLRRTVDPVFNHTMVYDGISMADLTEACVELTVWDRDRLASN-LLGGVRLGVGTGRSYGTLVDWMDSGPYEVALWDRMMASPNEWVEGVLPLR 1221          
BLAST of Synaptotagmin protein 5 vs. Planmine SMEST
Match: SMESG000074360.1 (SMESG000074360.1)

HSP 1 Score: 1018.45 bits (2632), Expect = 0.000e+0
Identity = 576/577 (99.83%), Postives = 577/577 (100.00%), Query Frame = 1
Query:  142 MDFDDSFSAITEAYVDLDIDLEDTDPEISKLTPEEIKEISQVIEKDKTXXXXXXXXXXKIEEGIDEKIVEISLKNVDDGDKYCLCCGEKFKIIINPRRECSECKKGICNGCTAIMFKDERICYLCYLKACKDLKTGKWFAVTSKLNGRFRRNPAAVLVNSMRKLKSKXXXXXXXNXXXXXXXXXXXXXXXDTXXXXXXXXXXXXXXXPIYLRKDESPNVRKREINGVSNPVKENLIDVVDFAENKTEHVVKSETLELQPRSQTSAHYLHPTNLETLKTMSHSSNSIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKYKPSTRRDGKGSLHVLIVEAQQLEFDGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWMDAQGIEKTTWENF 1872
            MDFDDSFSAITEAYVDLDIDLEDTDPEISKLTPEEIKEISQVIEKDKTLRREERLRRRKIEEGIDEKIVEISLKNVDDGDKYCLCCGEKFKIIINPRRECSECKKGICNGCTAIMFKDERICYLCYLKACKDLKTGKWFAVTSKLNGRFRRNPAAVLVNSMRKLKSKPPPPPIPNGSIVSKGSIGSKESIDTIGSVGSIKSIGSKHIPIYLRKDESPNVRKREINGVSNPVKENLIDVVDFAENKTEHVVKSETLELQPRSQTSAHYLHPTNLETLKTMSHSSNSIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQC+NLAVADRNKRQTNPYIKTYLLPDKTKTSKKKSTSKRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKYKPSTRRDGKGSLHVLIVEAQQLEFDGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFLGGVRLNLGLGLHHSDHVSWMDAQGIEKTTWENF
Sbjct:    1 MDFDDSFSAITEAYVDLDIDLEDTDPEISKLTPEEIKEISQVIEKDKTLRREERLRRRKIEEGIDEKIVEISLKNVDDGDKYCLCCGEKFKIIINPRRECSECKKGICNGCTAIMFKDERICYLCYLKACKDLKTGKWFAVTSKLNGRFRRNPAAVLVNSMRKLKSKPPPPPIPNGSIVSKGSIGSKESIDTIGSVGSIKSIGSKHIPIYLRKDESPNVRKREINGVSNPVKENLIDVVDFAENKTEHVVKSETLELQPRSQTSAHYLHPTNLETLKTMSHSSNSIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCQNLAVADRNKRQTNPYIKTYLLPDKTKTSKKKSTSKRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKYKPSTRRDGKGSLHVLIVEAQQLEFDGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFLGGVRLNLGLGLHHSDHVSWMDAQGIEKTTWENF 577          
BLAST of Synaptotagmin protein 5 vs. Planmine SMEST
Match: SMESG000010162.1 (SMESG000010162.1)

HSP 1 Score: 140.969 bits (354), Expect = 6.442e-35
Identity = 87/281 (30.96%), Postives = 153/281 (54.45%), Query Frame = 1
Query:  949 PTNLETLKTMSHSSNSIYSETYDS--YKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKYKPSTRRDGK--------GSLHVLIVEAQQLEFDGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKS 1761
            P++ E    ++ SS + YS    S  + +  +V G++L  + +  +   L I + +CRNL +A+R +  TNPYIK YLLPDK+   K+K++ K++  +PIF E L Y + + SL  RTL+V VWH+  +  N FLGE ++ + ++ L+  +  W+ L+ K   P     + YKGE++I L++  +T+R           G L++ I   + +  +    N +V+  +       GKK+T V  +T+N  WD +  F+D+    L +  +EL I + + +K+
Sbjct:  291 PSDNERFLKLARSSANSYSSMNSSEYFTNDFIVQGEILLKIEHIQNISLLKIMILKCRNLIIANRKENTTNPYIKLYLLPDKSPNGKRKTSVKKNITSPIFNEELSYKIDRNSLIGRTLNVSVWHQESLKGNLFLGETNIPIYNIRLNNAQECWHSLKTKEAVPQILSLYQYKGEILIGLQFIQNTKRRNSETISEYETGKLNIFIQSGKHIGDEKNIPNSFVRCTIKHIGIQVGKKETKVVSNTTNPIWDEVFTFNDIDKLSLGETEIELCILNKKLIKT 571          
BLAST of Synaptotagmin protein 5 vs. Planmine SMEST
Match: SMESG000004656.1 (SMESG000004656.1)

HSP 1 Score: 108.612 bits (270), Expect = 2.545e-24
Identity = 83/304 (27.30%), Postives = 143/304 (47.04%), Query Frame = 1
Query:  892 KSETLELQPRSQTSAHYL-HPTNLETLKTMSHSSNSIYSETYDSYKSGLVVSGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIY-NVSKESLSARTLSVGVWHKRLMTYNYFLGEVHVLLADMDLSKNEPVWYPLQEK---VRYPNRSGGHIYKGELIIKLKY-----------KPSTR----RDGKGSLHVLIVEAQQLEFDGQS--LNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSI 1737
            KSE   +  +S++  H + + +N  +L  ++  ++S+ S+  ++ + G    GD++  + YN   +   I + +CRNL +A  N   +NPY+K  L+P        ++ +  SN+NP F E   Y N+  E + +R   V VWH   +  + FLG+V +  +   L    P W+ L+EK   +  P  S    Y G++ + +KY            PS          GS+ + I +A  L     S   N Y K  LLP+ S    KKTP+ +   N  W+    F +++  EL D  +E+++
Sbjct:  322 KSENSTISKKSRSDVHSMTNKSNASSLNDLTIINSSVVSKPENAVELGSDRQGDIMIGLSYNYIEEEFRIIIKKCRNLEIAIPNSNSSNPYVKVELVPPIFSEKHFRTKTISSNLNPDFNEQCKYKNIKYEDVVSRNALVTVWHDEKLGKHVFLGQVFLKFSLFQLDDATPNWFKLKEKGPTIITPVLSK---YYGDIQVSIKYTINGKSSMSTNSPSDNFSEMSSTTGSITLWIKQANNLLTSSYSHLPNSYAKCLLLPESSKVPSKKTPIIRKNFNPIWNIQFTFPNISQSELPDLGMEITV 622          
BLAST of Synaptotagmin protein 5 vs. Planmine SMEST
Match: SMESG000013300.1 (SMESG000013300.1)

HSP 1 Score: 75.485 bits (184), Expect = 2.517e-14
Identity = 68/210 (32.38%), Postives = 103/210 (49.05%), Query Frame = 1
Query: 1342 FLGEVHVLLADMDLSKNEPVWYPLQEK---VRYPNRSGGHIYKGELIIKLKYKPST--------RRDGKGSLHVLIVEAQQLEFDGQS---LNVYVKGFLLP-DRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFXXXXXXXXXXXXHHSDHVSWMDAQGIEKTTWENFLSNPNEYTDAILNLRPNL 1926
            F+G+  + +     + N+  WY  Q K   + Y       +Y+G+L I LKY  ST          D    + + I +A+ L F GQ     N +VK  LLP D+     +KT   K+T N  W+ +L+F D+ L+ L+   L++ IY+   L    F+GGVRLNLG        ++WMDA  IE   W   L+ PN +    + LRP++
Sbjct:  150 FIGQTFINIWQQS-TFNDLEWYDFQNKPPSIYY--FISSLVYRGDLHIALKYATSTTINVTSIDNLDPTNQVMLWIKKAENL-FSGQVNKLCNAFVKVQLLPTDKKLHPIQKTKCIKNTCNPSWNVILKFEDINLQSLRQMGLQILIYNRISLFRKLFIGGVRLNLGPTTTKRAIINWMDASSIETIIWRQMLNRPNTWICGEIRLRPDM 355          
BLAST of Synaptotagmin protein 5 vs. Planmine SMEST
Match: SMESG000040037.1 (SMESG000040037.1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.897e-13
Identity = 65/249 (26.10%), Postives = 124/249 (49.80%), Query Frame = 1
Query: 1045 GDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDXXXXXXXXXXXXRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNYF-----LGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKYKPSTRRDGKGSLHVLIVEAQQL---EFDGQSLNVYVKGFLLPDRSNKGKKKTPVQKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNE 1767
            G + FS  Y++  + L++ + +C +L   D     ++PY+K  LLP+K +  K +    R  +NP+F ET  +N    S +   +     H  +++++ F     +GEV   L ++DL+    V   L ++++          +GE+++ + ++P+ +      L V+I++A+ L   +  G + + YVK +L+ +     KKKT V+K T N  ++    F     E L + ++EL I  Y R+  NE
Sbjct:  122 GSLEFSASYDNQKQILSVSILRCCDLPSKDTQLGTSDPYVKLQLLPEKRQRVKTQIQ--RKTLNPVFGETFTFN----SFTLNQVKSTSLHFVVLSFDRFSRDDIIGEVVCPLMELDLNLGSEVV--LTKEIQPRRFKAKDDDRGEILLSICHQPAAKM-----LTVVILKARNLPKTDATGLAGDPYVKLYLVQNGQRLAKKKTHVKKRTLNPVYNQSFSFDLQDNENLLNIAIELLIMDYDRVTKNE 357          
The following BLAST results are available for this feature:
BLAST of Synaptotagmin protein 5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYTL43.828e-5037.24synaptotagmin like 4 [Source:HGNC Symbol;Acc:HGNC:... [more]
SYTL43.828e-5037.24synaptotagmin like 4 [Source:HGNC Symbol;Acc:HGNC:... [more]
SYTL43.828e-5037.24synaptotagmin like 4 [Source:HGNC Symbol;Acc:HGNC:... [more]
SYTL56.310e-4636.06synaptotagmin like 5 [Source:HGNC Symbol;Acc:HGNC:... [more]
SYTL53.169e-4536.80synaptotagmin like 5 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Synaptotagmin protein 5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snt-26.283e-1524.34Synaptotagmin 2 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
snt-11.453e-1127.57Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
snt-11.655e-1127.46Synaptotagmin-1 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
rbf-14.024e-924.53Rabphilin-1 [Source:UniProtKB/Swiss-Prot;Acc:P418... [more]
snt-64.211e-926.55SyNapTotagmin [Source:UniProtKB/TrEMBL;Acc:A0A0S4... [more]
back to top
BLAST of Synaptotagmin protein 5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
btsz5.711e-5532.94gene:FBgn0266756 transcript:FBtr0334289[more]
btsz3.314e-5432.94gene:FBgn0266756 transcript:FBtr0334288[more]
btsz2.913e-5232.94gene:FBgn0266756 transcript:FBtr0334287[more]
btsz1.361e-5132.94gene:FBgn0266756 transcript:FBtr0334290[more]
btsz1.361e-5132.94gene:FBgn0266756 transcript:FBtr0334293[more]
back to top
BLAST of Synaptotagmin protein 5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sytl53.489e-4433.98synaptotagmin-like 5 [Source:ZFIN;Acc:ZDB-GENE-070... [more]
sytl51.928e-4334.54synaptotagmin-like 5 [Source:ZFIN;Acc:ZDB-GENE-070... [more]
sytl43.479e-3938.64synaptotagmin-like 4 [Source:ZFIN;Acc:ZDB-GENE-070... [more]
sytl2b2.863e-3829.97synaptotagmin-like 2b [Source:ZFIN;Acc:ZDB-GENE-12... [more]
sytl11.770e-3730.53synaptotagmin-like 1 [Source:ZFIN;Acc:ZDB-GENE-060... [more]
back to top
BLAST of Synaptotagmin protein 5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc41a11.607e-5134.86solute carrier family 41 member 1 [Source:Xenbase;... [more]
SYTL52.507e-5037.46synaptotagmin like 5 [Source:NCBI gene;Acc:1004960... [more]
SYTL54.313e-4937.32synaptotagmin like 5 [Source:NCBI gene;Acc:1004960... [more]
SYTL52.183e-4836.66synaptotagmin like 5 [Source:NCBI gene;Acc:1004960... [more]
SYTL43.420e-4837.15synaptotagmin like 4 [Source:NCBI gene;Acc:1004951... [more]
back to top
BLAST of Synaptotagmin protein 5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sytl42.696e-5037.65synaptotagmin-like 4 [Source:MGI Symbol;Acc:MGI:13... [more]
Sytl51.035e-4333.09synaptotagmin-like 5 [Source:MGI Symbol;Acc:MGI:26... [more]
Sytl56.548e-4236.09synaptotagmin-like 5 [Source:MGI Symbol;Acc:MGI:26... [more]
Sytl14.298e-3934.22synaptotagmin-like 1 [Source:MGI Symbol;Acc:MGI:19... [more]
Sytl26.103e-3834.36synaptotagmin-like 2 [Source:MGI Symbol;Acc:MGI:19... [more]
back to top
BLAST of Synaptotagmin protein 5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8VHQ7|SYTL4_RAT1.740e-4937.92Synaptotagmin-like protein 4 OS=Rattus norvegicus ... [more]
sp|Q96C24|SYTL4_HUMAN1.839e-4937.24Synaptotagmin-like protein 4 OS=Homo sapiens OX=96... [more]
sp|Q9R0Q1|SYTL4_MOUSE1.886e-4937.65Synaptotagmin-like protein 4 OS=Mus musculus OX=10... [more]
sp|Q812E4|SYTL5_RAT4.414e-4533.57Synaptotagmin-like protein 5 OS=Rattus norvegicus ... [more]
sp|Q8TDW5|SYTL5_HUMAN1.522e-4436.80Synaptotagmin-like protein 5 OS=Homo sapiens OX=96... [more]
back to top
BLAST of Synaptotagmin protein 5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A293LTR42.401e-6141.94Bitesize isoform (Fragment) OS=Ornithodoros errati... [more]
A0A131XGS81.889e-6041.79Putative ca2+-dependent phospholipid-binding prote... [more]
A0A1B6FHJ69.686e-6037.41Uncharacterized protein (Fragment) OS=Cuerna arida... [more]
A0A2R5L8212.442e-5941.94Putative ca2+-dependent phospholipid-binding prote... [more]
A0A067R2Z23.069e-5938.13Synaptotagmin-like protein 4 OS=Zootermopsis nevad... [more]
back to top
BLAST of Synaptotagmin protein 5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sytl51.753e-4433.25synaptotagmin like 5 [Source:NCBI gene;Acc:1030449... [more]
sytl58.230e-4334.99synaptotagmin like 5 [Source:NCBI gene;Acc:1030449... [more]
sytl42.040e-4036.94synaptotagmin like 4 [Source:NCBI gene;Acc:1030450... [more]
sytl43.138e-4036.94synaptotagmin like 4 [Source:NCBI gene;Acc:1030450... [more]
sytl13.730e-3833.33synaptotagmin-like protein 1 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Synaptotagmin protein 5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sytl2a1.462e-3433.72synaptotagmin-like 2a [Source:ZFIN;Acc:ZDB-GENE-13... [more]
sytl2a5.891e-3232.58synaptotagmin-like 2a [Source:ZFIN;Acc:ZDB-GENE-13... [more]
ENSPMAT00000006493.11.182e-2841.72pep scaffold:Pmarinus_7.0:GL476457:113922:122135:1... [more]
pik3c2a3.289e-1538.58phosphatidylinositol-4-phosphate 3-kinase, catalyt... [more]
ENSPMAT00000004426.12.067e-1127.38pep scaffold:Pmarinus_7.0:GL476335:1496408:1550941... [more]
back to top
BLAST of Synaptotagmin protein 5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Synaptotagmin protein 5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO297656.300e-2631.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO419338.399e-1727.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO437042.211e-1325.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317467.240e-1329.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO459772.596e-1238.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Synaptotagmin protein 5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sytl51.611e-4334.89synaptotagmin like 5 [Source:NCBI gene;Acc:1011558... [more]
sytl53.242e-4335.96synaptotagmin like 5 [Source:NCBI gene;Acc:1011558... [more]
sytl49.586e-4134.50synaptotagmin like 4 [Source:NCBI gene;Acc:1011635... [more]
sytl43.422e-3731.89synaptotagmin like 4 [Source:NCBI gene;Acc:1011635... [more]
ENSORLT00000041991.11.088e-3531.74synaptotagmin-like protein 2 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Synaptotagmin protein 5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074360.10.000e+099.83SMESG000074360.1[more]
SMESG000010162.16.442e-3530.96SMESG000010162.1[more]
SMESG000004656.12.545e-2427.30SMESG000004656.1[more]
SMESG000013300.12.517e-1432.38SMESG000013300.1[more]
SMESG000040037.11.897e-1326.10SMESG000040037.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022075 ID=SMED30022075|Name=Synaptotagmin protein 5|organism=Schmidtea mediterranea sexual|type=transcript|length=2081bp
CAACCACCTACACAAGGCACCCATTCTAAAAATTATAAACAGATATATTT
CATTACGTCTGATCAGTGCTTACGATTGTGATATATAAAATAGCATCTAC
GCACACCCAGATTACTATTGATAGATAATTATACATAAAAGATGGATTTC
GATGATAGTTTTTCGGCCATAACGGAAGCCTATGTCGATTTGGACATAGA
TCTTGAGGATACAGATCCAGAAATCTCCAAACTTACTCCGGAAGAAATCA
AAGAAATTTCACAAGTAATTGAAAAAGACAAAACTCTCCGACGAGAAGAG
AGACTGCGACGAAGAAAAATAGAAGAAGGTATTGATGAGAAAATCGTGGA
AATCAGTTTGAAAAATGTTGACGATGGAGACAAATATTGTCTTTGCTGTG
GGGAAAAGTTTAAAATAATAATAAATCCTAGACGGGAATGTAGTGAATGC
AAGAAAGGCATTTGCAACGGATGCACTGCGATTATGTTTAAGGACGAACG
AATATGCTATTTGTGCTATTTGAAAGCCTGCAAAGATCTTAAAACTGGAA
AATGGTTTGCTGTGACATCGAAATTGAATGGGAGATTTCGAAGAAATCCG
GCTGCTGTTTTAGTTAATTCAATGAGAAAACTAAAAAGCAAACCACCTCC
ACCACCAATACCTAATGGAAGCATTGTCAGTAAAGGCAGTATTGGAAGTA
AGGAAAGTATCGATACTATCGGCAGTGTGGGCAGTATTAAAAGTATTGGT
AGCAAACATATTCCAATATATCTACGTAAAGATGAATCTCCAAATGTTAG
GAAGAGAGAGATAAATGGAGTAAGTAATCCTGTAAAAGAAAATCTGATCG
ATGTTGTGGATTTTGCAGAAAATAAGACTGAACACGTAGTAAAGTCTGAA
ACTCTTGAACTTCAACCTAGGTCGCAGACAAGTGCTCATTATCTTCATCC
AACAAACCTCGAAACTCTAAAAACCATGTCTCATTCGTCTAATAGTATCT
ACAGTGAAACATATGATAGTTATAAATCAGGATTAGTGGTCTCTGGGGAC
GTCTTATTTTCAGTGTTTTACAACGACGACAACAAAACATTGAATATATA
TGTAGACCAGTGTCGAAATCTTGCAGTTGCTGATAGAAATAAGAGACAAA
CAAATCCATACATTAAAACCTATTTATTACCCGATAAAACAAAAACGAGT
AAAAAGAAGTCAACCAGTAAAAGATCAAATATCAATCCAATTTTCAAAGA
GACCTTGATATATAATGTCTCTAAAGAAAGTCTCTCAGCTAGAACTTTAA
GTGTCGGTGTATGGCACAAGCGATTAATGACATACAATTATTTTCTGGGA
GAAGTTCACGTCTTATTGGCAGACATGGATCTATCAAAGAATGAACCCGT
TTGGTATCCTCTTCAAGAAAAGGTAAGATATCCAAACAGATCAGGTGGCC
ATATTTATAAAGGAGAATTAATTATAAAATTAAAATACAAACCCAGCACA
AGAAGAGACGGAAAAGGATCACTTCATGTCTTAATTGTTGAAGCCCAACA
ATTGGAGTTTGACGGGCAGTCTTTGAATGTTTACGTTAAAGGTTTTCTCT
TGCCAGATCGATCAAATAAAGGTAAGAAAAAGACTCCAGTTCAAAAAAGT
ACTTCAAATATCAAATGGGATTCACTGCTTCAGTTCTCAGATGTTACTCT
GGAGGAATTGAAAGACAGATCACTTGAATTATCAATTTATCATTATAGAA
GACTAAAAAGTAACGAGTTTTTGGGAGGAGTTCGGCTTAATCTTGGACTT
GGTTTGCATCATTCTGATCATGTTTCTTGGATGGATGCACAAGGAATCGA
AAAGACTACCTGGGAGAATTTCCTCTCAAACCCAAATGAATATACAGATG
CTATCCTCAATTTGAGGCCAAACCTCGAGTACTATTAAATGGGACAATTT
TTTACAACATTAGAAATATGGCGATTTTTGTATTGGTATTATTATTAATG
GTTTTTCTAAGCAGATGCTTATTAATATTTTTGAACATGTTTTGACAGTA
AAAGAAAAATGAATAATTTTTTTAAATTCAA
back to top

protein sequence of SMED30022075-orf-1

>SMED30022075-orf-1 ID=SMED30022075-orf-1|Name=SMED30022075-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=599bp
MDFDDSFSAITEAYVDLDIDLEDTDPEISKLTPEEIKEISQVIEKDKTLR
REERLRRRKIEEGIDEKIVEISLKNVDDGDKYCLCCGEKFKIIINPRREC
SECKKGICNGCTAIMFKDERICYLCYLKACKDLKTGKWFAVTSKLNGRFR
RNPAAVLVNSMRKLKSKPPPPPIPNGSIVSKGSIGSKESIDTIGSVGSIK
SIGSKHIPIYLRKDESPNVRKREINGVSNPVKENLIDVVDFAENKTEHVV
KSETLELQPRSQTSAHYLHPTNLETLKTMSHSSNSIYSETYDSYKSGLVV
SGDVLFSVFYNDDNKTLNIYVDQCRNLAVADRNKRQTNPYIKTYLLPDKT
KTSKKKSTSKRSNINPIFKETLIYNVSKESLSARTLSVGVWHKRLMTYNY
FLGEVHVLLADMDLSKNEPVWYPLQEKVRYPNRSGGHIYKGELIIKLKYK
PSTRRDGKGSLHVLIVEAQQLEFDGQSLNVYVKGFLLPDRSNKGKKKTPV
QKSTSNIKWDSLLQFSDVTLEELKDRSLELSIYHYRRLKSNEFLGGVRLN
LGLGLHHSDHVSWMDAQGIEKTTWENFLSNPNEYTDAILNLRPNLEYY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000421tail
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR000008C2_dom
IPR011011Znf_FYVE_PHD
IPR013083Znf_RING/FYVE/PHD
IPR010911Rab_BD
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0017137Rab GTPase binding
Vocabulary: biological process
TermDefinition
GO:0006886intracellular protein transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane