slc47a-5

Overview
Nameslc47a-5 (AKN21702.1)
Smed IDSMED30022038
Length (bp)1835
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc47a-5 (SMED30022038) t-SNE clustered cells

Violin plots show distribution of expression levels for slc47a-5 (SMED30022038) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc47a-5 (SMED30022038) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc47a-5 (SMED30022038) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022038

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30022038h1SMcG0011309 PL08009A2H07smed_ncbi_20240424PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30022038h1SMcG0011309 dd_Smed_v4_9513_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30022038h1SMcG0011309 dd_Smed_v4_9513_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30022038h1SMcG0011309 dd_Smed_v6_9513_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc47a-5 vs. Ensembl Human
Match: SLC47A1 (solute carrier family 47 member 1 [Source:HGNC Symbol;Acc:HGNC:25588])

HSP 1 Score: 236.498 bits (602), Expect = 2.436e-69
Identity = 151/500 (30.20%), Postives = 257/500 (51.40%), Query Frame = 3
Query:   96 SEYPKLCRALIILFGPLFPTTFLQFLINVTPIMFVGQLDKIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPXXXXXXXXXXXXXXFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVTCPLYVAIGICANVKIGQYLGAGQHERAKKIAQISIVAXXXXXXXXXXXXXXXREYWPLIFTTDKIVNEQVSKLIAFYPIYFVPESVNGVLSGIMRGCAKHSLTMYLAFGCMYLMGLPVAAMLGFLAQLQVFGLWIG---NTVGLSTLMIGYVISVWFFNWETLALDA---AHRLTRGQYEDQNEIFEKNPLLITKPKENE--------KVNYPNGPYQLKHNR 1553
            S + +  RAL++L GP F    + FLI+    +F G L K++LD V   ++VI++ G SVG+GL+ ACDTL SQ YGS + K  G  LQ+S  + LL  FP  A+ LN  H+LLLF QDP +  ++  Y++ ++PA P  + Y +  +YL NQ    P +V  +  N+ N  A YL L++ +     SA+  +I+   +A+    Y++  K ++ TW GW++  L +W  FLRLAIP +     E   +E   F++GI+G+V +   S++ +   +   +     + A+V++G  LGAG  E+A+K + +S++  V+ ++    ++   +++   IFTTD+ +   V++++  Y +  + E++     G++RG     +   +     Y++GLP+   L F   L V GLW G    TV  +   +G++I     NW+     A   A+          N    ++PL    P+  E        K   P    Q++   
Sbjct:   29 SAFREELRALLVLAGPAFLVQLMVFLISFISSVFCGHLGKLELDAVTLAIAVINVTGVSVGFGLSSACDTLISQTYGSQNLKHVGVILQRSALVLLLCCFPCWALFLNTQHILLLFRQDPDVSRLTQTYVTIFIPALPATFLYMLQVKYLLNQGIVLPQIVTGVAANLVNALANYLFLHQLHLGVIGSALANLISQYTLALLLFLYILGKKLHQATWGGWSLECLQDWASFLRLAIPSMLMLCMEWWAYEVGSFLSGILGMVELGAQSIVYELAIIVYMVPAGFSVAASVRVGNALGAGDMEQARKSSTVSLLITVLFAVAFSVLLLSCKDHVGYIFTTDRDIINLVAQVVPIYAVSHLFEALACTSGGVLRGSGNQKVGAIVNTIGYYVVGLPIGIALMFATTLGVMGLWSGIIICTVFQAVCFLGFIIQ---LNWKKACQQAQVHANLKVNNVPRSGNSALPQDPLHPGCPENLEGILTNDVGKTGEPQSDQQMRQEE 525          
BLAST of slc47a-5 vs. Ensembl Human
Match: SLC47A1 (solute carrier family 47 member 1 [Source:HGNC Symbol;Acc:HGNC:25588])

HSP 1 Score: 235.728 bits (600), Expect = 7.124e-69
Identity = 151/500 (30.20%), Postives = 257/500 (51.40%), Query Frame = 3
Query:   96 SEYPKLCRALIILFGPLFPTTFLQFLINVTPIMFVGQLDKIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPXXXXXXXXXXXXXXFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVTCPLYVAIGICANVKIGQYLGAGQHERAKKIAQISIVAXXXXXXXXXXXXXXXREYWPLIFTTDKIVNEQVSKLIAFYPIYFVPESVNGVLSGIMRGCAKHSLTMYLAFGCMYLMGLPVAAMLGFLAQLQVFGLWIG---NTVGLSTLMIGYVISVWFFNWETLALDA---AHRLTRGQYEDQNEIFEKNPLLITKPKENE--------KVNYPNGPYQLKHNR 1553
            S + +  RAL++L GP F    + FLI+    +F G L K++LD V   ++VI++ G SVG+GL+ ACDTL SQ YGS + K  G  LQ+S  + LL  FP  A+ LN  H+LLLF QDP +  ++  Y++ ++PA P  + Y +  +YL NQ    P +V  +  N+ N  A YL L++ +     SA+  +I+   +A+    Y++  K ++ TW GW++  L +W  FLRLAIP +     E   +E   F++GI+G+V +   S++ +   +   +     + A+V++G  LGAG  E+A+K + +S++  V+ ++    ++   +++   IFTTD+ +   V++++  Y +  + E++     G++RG     +   +     Y++GLP+   L F   L V GLW G    TV  +   +G++I     NW+     A   A+          N    ++PL    P+  E        K   P    Q++   
Sbjct:   29 SAFREELRALLVLAGPAFLVQLMVFLISFISSVFCGHLGKLELDAVTLAIAVINVTGVSVGFGLSSACDTLISQTYGSQNLKHVGVILQRSALVLLLCCFPCWALFLNTQHILLLFRQDPDVSRLTQTYVTIFIPALPATFLYMLQVKYLLNQGIVLPQIVTGVAANLVNALANYLFLHQLHLGVIGSALANLISQYTLALLLFLYILGKKLHQATWGGWSLECLQDWASFLRLAIPSMLMLCMEWWAYEVGSFLSGILGMVELGAQSIVYELAIIVYMVPAGFSVAASVRVGNALGAGDMEQARKSSTVSLLITVLFAVAFSVLLLSCKDHVGYIFTTDRDIINLVAQVVPIYAVSHLFEALACTSGGVLRGSGNQKVGAIVNTIGYYVVGLPIGIALMFATTLGVMGLWSGIIICTVFQAVCFLGFIIQ---LNWKKACQQAQVHANLKVNNVPRSGNSALPQDPLHPGCPENLEGILTNDVGKTGEPQSDQQMRQEE 525          
BLAST of slc47a-5 vs. Ensembl Human
Match: SLC47A2 (solute carrier family 47 member 2 [Source:HGNC Symbol;Acc:HGNC:26439])

HSP 1 Score: 225.713 bits (574), Expect = 2.612e-65
Identity = 169/562 (30.07%), Postives = 286/562 (50.89%), Query Frame = 3
Query:  123 LIILFGPLFPTTFLQFLINVTPIMFVGQLDKIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPXXXXXXXXXXXXXXFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVT----------------CPLYVAIGICANVKIGQYLGAGQHERAKKIAQISIVAXXXXXXXXXXXXXXXREYWPLIFTTDKIVNEQVSKLIAFYPIYFVPESVNGVLSGIMRGCAKHSLTMYLAFGCMYLMGLPVAAMLGFLAQLQVFGLWIGNTVGLSTLMIGYVISVWFFNWETLALDAAHRLTRGQYEDQNEIFEKNPLLITKPKENEKVNYPNGPYQLKHNRLPSQGIT-SSY-------DLIRTKKIIVFENLRLKSKLNK-NHKSIIIKRSVTLFVCLLMLFIGIIGRL 1733
            L  L GPLF    L F+I +   +F G L K++L  V   V+ +++ G SVG GL+ ACDTL SQ++GS +KK  G  LQ+   + LL   P  A+ LN  H+LLLF QDP +  ++  Y+  ++P  PV + Y +L++YLQNQ  TWP +++ ++GN  N  A Y  +   N   + SA   II+     +F L Y++  K +  TW GW+   L +W  F  LA+P +     E   +E   F+ G++ +V ++  +V+ +  TVT                 PL ++IG+C  V++G  LGA    +AK+ A   ++++V +SL +G++ISI++     IFT D+ V   VS+++  Y ++ V E++  V  G++RG  K +    +     Y++GLP+  +L F+ ++++ GLW+G    +      +V      +W+ LA + A + +  Q + + E     P     P++    +   G          S GIT ++Y       D  RT +    E   L +  ++ + K ++I+R   L      L +G+  R+
Sbjct:   34 LFALSGPLFLFQVLTFMIYIVSTVFCGHLGKVELASVTLAVAFVNVCGVSVGVGLSSACDTLMSQSFGSPNKKHVGVILQRGALVLLLCCLPCWALFLNTQHILLLFRQDPDVSRLTQDYVMIFIPGLPVIFLYNLLAKYLQNQKITWPQVLSGVVGNCVNGVANYALVSVLNLGVRGSAYANIISQFAQTVFLLLYIVLKKLHLETWAGWSSQCLQDWGPFFSLAVPSMLMICVEWWAYEIGSFLMGLLSVVDLSAQAVIYEVATVTYMRHSHRLAYAAHVTRIPLGLSIGVC--VRVGMALGAADTVQAKRSAVSGVLSIVGISLVLGTLISILKNQLGHIFTNDEDVIALVSQVLPVYSVFHVFEAICCVYGGVLRGTGKQAFGAAVNAITYYIIGLPLGILLTFVVRMRIMGLWLGMLACVFLATAAFVAYTARLDWK-LAAEEAKKHSGRQQQQRAESTATRP----GPEKAVLSSVATG---------SSPGITLTTYSRSECHVDFFRTPE----EAHALSAPTSRLSVKQLVIRRGAALGAASATLMVGLTVRI 575          
BLAST of slc47a-5 vs. Ensembl Human
Match: SLC47A2 (solute carrier family 47 member 2 [Source:HGNC Symbol;Acc:HGNC:26439])

HSP 1 Score: 213.001 bits (541), Expect = 2.327e-60
Identity = 169/584 (28.94%), Postives = 286/584 (48.97%), Query Frame = 3
Query:  123 LIILFGPLFPTTFLQFLINVTPIMFVGQLDKIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPXXXXXXXXXXXXXXFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQ------------------------------------DKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVT--CPLYVAIGICANVKIGQYLGAGQHERAKKIAQISIVAXXXXXXXXXXXXXXXREYWPLIFTTDKIVNEQVSKLIAFYPIYFVPESVNGVLSGIMRGCAKHSLTMYLAFGCMYLMGLPVAAMLGFLAQLQVFGLWIGNTVGLSTLMIGYVISVWFFNWETLALDAAHRLTRGQYEDQNEIFEKNPLLITKPKENEKVNYPNGPYQLKHNRLPSQGIT-SSY-------DLIRTKKIIVFENLRLKSKLNK-NHKSIIIKRSVTLFVCLLMLFIGIIGRL 1733
            L  L GPLF    L F+I +   +F G L K++L  V   V+ +++ G SVG GL+ ACDTL SQ++GS +KK  G  LQ+   + LL   P  A+ LN  H+LLLF QDP +  ++  Y+  ++P  PV + Y +L++YLQNQ                                      TWP +++ ++GN  N  A Y  +   N   + SA   II+     +F L Y++  K +  TW GW+   L +W  F  LA+P +     E   +E   F+ G++ +V ++  +V+ +  TVT   PL ++IG+C  V++G  LGA    +AK+ A   ++++V +SL +G++ISI++     IFT D+ V   VS+++  Y ++ V E++  V  G++RG  K +    +     Y++GLP+  +L F+ ++++ GLW+G    +      +V      +W+ LA + A + +  Q + + E     P     P++    +   G          S GIT ++Y       D  RT +    E   L +  ++ + K ++I+R   L      L +G+  R+
Sbjct:   34 LFALSGPLFLFQVLTFMIYIVSTVFCGHLGKVELASVTLAVAFVNVCGVSVGVGLSSACDTLMSQSFGSPNKKHVGVILQRGALVLLLCCLPCWALFLNTQHILLLFRQDPDVSRLTQDYVMIFIPGLPVIFLYNLLAKYLQNQGWLKGQEEESPFQTPGLSILHPSHSHLSRASFHLFQKITWPQVLSGVVGNCVNGVANYALVSVLNLGVRGSAYANIISQFAQTVFLLLYIVLKKLHLETWAGWSSQCLQDWGPFFSLAVPSMLMICVEWWAYEIGSFLMGLLSVVDLSAQAVIYEVATVTYMIPLGLSIGVC--VRVGMALGAADTVQAKRSAVSGVLSIVGISLVLGTLISILKNQLGHIFTNDEDVIALVSQVLPVYSVFHVFEAICCVYGGVLRGTGKQAFGAAVNAITYYIIGLPLGILLTFVVRMRIMGLWLGMLACVFLATAAFVAYTARLDWK-LAAEEAKKHSGRQQQQRAESTATRP----GPEKAVLSSVATG---------SSPGITLTTYSRSECHVDFFRTPE----EAHALSAPTSRLSVKQLVIRRGAALGAASATLMVGLTVRI 597          
BLAST of slc47a-5 vs. Ensembl Human
Match: SLC47A2 (solute carrier family 47 member 2 [Source:HGNC Symbol;Acc:HGNC:26439])

HSP 1 Score: 185.267 bits (469), Expect = 2.429e-52
Identity = 110/301 (36.54%), Postives = 170/301 (56.48%), Query Frame = 3
Query:  123 LIILFGPLFPTTFLQFLINVTPIMFVGQLDKIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPXXXXXXXXXXXXXXFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVT--CPLYVAIGICANVKIGQYLGAGQHERAKKIA 1019
            L  L GPLF    L F+I +   +F G L K++L  V   V+ +++ G SVG GL+ ACDTL SQ++GS +KK  G  LQ+   + LL   P  A+ LN  H+LLLF QDP +  ++  Y+  ++P  PV + Y +L++YLQNQ  TWP +++ ++GN  N  A Y  +   N   + SA   II+     +F L Y++  K +  TW GW+   L +W  F  LA+P +     E   +E   F+ G++ +V ++  +V+ +  TVT   PL ++IG+C  V++G  LGA    +AK+ A
Sbjct:   34 LFALSGPLFLFQVLTFMIYIVSTVFCGHLGKVELASVTLAVAFVNVCGVSVGVGLSSACDTLMSQSFGSPNKKHVGVILQRGALVLLLCCLPCWALFLNTQHILLLFRQDPDVSRLTQDYVMIFIPGLPVIFLYNLLAKYLQNQKITWPQVLSGVVGNCVNGVANYALVSVLNLGVRGSAYANIISQFAQTVFLLLYIVLKKLHLETWAGWSSQCLQDWGPFFSLAVPSMLMICVEWWAYEIGSFLMGLLSVVDLSAQAVIYEVATVTYMIPLGLSIGVC--VRVGMALGAADTVQAKRSA 332          
BLAST of slc47a-5 vs. Ensembl Zebrafish
Match: slc47a2.1 (solute carrier family 47 member 2.1 [Source:NCBI gene;Acc:560024])

HSP 1 Score: 238.424 bits (607), Expect = 4.157e-70
Identity = 161/554 (29.06%), Postives = 273/554 (49.28%), Query Frame = 3
Query:   81 EKLLKSEYPKLCRALIILFGPLFPTTFLQFLINVTPIMFVGQLDKIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPXXXXXXXXXXXXXXFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVTCPLYVAIGICANVKIGQYLGAGQHERAKKIAQISIVAXXXXXXXXXXXXXXXREYWPLIFTTDKIVNEQVSKLIAFYPIYFVPESVNGVLSGIMRGCAKHSLTMYLAFGCMYLMGLPVAAMLGFLAQLQVFGLWIG--NTVGLSTLMIGYVISVWFFNWETLALDAAHRLTRGQYEDQNEIFEKNPLLITKPKENEKVNYPNGPYQLKHNRLPSQGITSS----YDLIRTKKIIVFENLRLKSKLNKNHKSIIIKRSVTLFVCLLMLFIGII 1724
              LL   Y      L+ L GP+F +  + FLI+    +F G L K +L GVA  ++VI++ G S+G GL  ACDTL SQ +GS + K+ G  LQ+ + I LL  FP  A+L+N + +LL   Q P +  +S +Y+  ++PA P  + Y +  RYLQNQ   WP ++    GNI N    Y+ L+        SA    I+   +A+F   Y+     +K TW GW+   L  W  F+RLA+P +     E   +E   F+AG++    +   SV+ +  T+     +   + A+V++G  LGAG  ERAK  A++++V  V++S  + ++I   ++    IFTT++ +  +VS+++  Y  + + +++ G+  GI+RG  K  L         Y +G P    L F   + + GLWIG    V L +L   ++I ++  +W+    +A  R      E ++E F           EN+           K +++  +G+T +      L +  + I     +         K +I++R + + + +L+L  GI+
Sbjct:   42 RSLLPVNYKTEIVELLKLAGPVFISQLMIFLISFVSTVFCGHLGKTELAGVALAIAVINVTGISIGSGLASACDTLISQTFGSNNLKRVGVILQRGILILLLACFPCWALLINTEPILLAVRQSPNVASLSQLYVKIFMPALPAAFMYQLQGRYLQNQGIIWPQVITGAAGNILNALINYVFLHLLELGVAGSAAANTISQYSLAVFLYVYIRWKNLHKATWDGWSRDCLQEWGAFIRLALPSMLMLCVEWWTYEIGGFLAGLISETELGAQSVVYELATIAYMFPLGFAVAASVRVGNALGAGNTERAKLSAKVALVCGVLVSCVVATLIGCTKDVIAYIFTTEEEIVSRVSQVMIMYGFFHLFDAIAGITGGIVRGAGKQLLGALCNIVGYYFVGFPTGVSLMFALSMGIIGLWIGFFGCVFLQSLF--FIILIYKLDWKKATQEALIRAGVQLTETKDESF---------GLENKGCTEEAA----KESQITEEGLTDANTDLEGLSKGGEGISEAGAKTTVGAVLTTKQLIVRRGLAVLLMVLILAGGIV 580          
BLAST of slc47a-5 vs. Ensembl Zebrafish
Match: BX248108.1 (multidrug and toxin extrusion protein 1-like [Source:NCBI gene;Acc:560089])

HSP 1 Score: 235.728 bits (600), Expect = 4.627e-69
Identity = 161/554 (29.06%), Postives = 269/554 (48.56%), Query Frame = 3
Query:   81 EKLLKSEYPKLCRALIILFGPLFPTTFLQFLINVTPIMFVGQLDKIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPXXXXXXXXXXXXXXFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVTCPLYVAIGICANVKIGQYLGAGQHERAKKIAQISIVAXXXXXXXXXXXXXXXREYWPLIFTTDKIVNEQVSKLIAFYPIYFVPESVNGVLSGIMRGCAKHSLTMYLAFGCMYLMGLPVAAMLGFLAQLQVFGLWIG--NTVGLSTLMIGYVISVWFFNWETLALDAAHR----LTRGQYEDQNEIFEKNPLLITKPKENEKVNYPNGPYQLKHNRLPSQGITSSYDLIRTKKIIVFENLRLKSKLNKNHKSIIIKRSVTLFVCLLMLFIGII 1724
             +LL   Y +    L+ L GP+F +  + FLI+    +F G L K +L GVA  ++VI++ G S+G GL  ACDTL SQ +GS + K+ G  LQ+ + I LL  FP  A+L+N + +LL   Q P +  +S +Y+  ++PA P  + Y +   YLQNQ   WP ++    GNI N    Y+ LY  +     SA    I+   +A+   TY+     +K TW GW+   L  W  F+RLA+P +     E   +E   F+AG++  V +   S++ +  +V     +   + A V++G  LGAG  E+AK  A++S+V  +++S  I  +I+        IF+ D+ +  +VS+++  Y    + ++ + +  GI+RG  K  +         Y +G P+   L F   + + GLWIG    V L +L   ++I ++  +W+    +A  R    LT  +YE      E         +EN +    +    L+       GIT +  L+   +++               K + ++R +  F  LL+L  GI+
Sbjct:   40 RRLLPVNYKEEVMQLLKLAGPVFISQLMIFLISFVSTVFCGHLGKTELAGVALAIAVINVTGISIGSGLASACDTLISQTFGSNNLKRVGVILQRGILILLLACFPCWALLINTEPILLAVRQSPNVASLSQLYVKIFMPALPATFMYQLQGLYLQNQGIIWPQVITGAAGNILNALINYVFLYLLDLGVPGSAAANAISQYSLAVILYTYIRCMGLHKATWDGWSWDCLQEWGSFIRLALPSMLMLCAEWWTYEIGGFLAGLISEVELGAQSIVYELASVMYMFPLGFAVAAGVRVGNALGAGNTEQAKLSAKVSLVCGLLVSSVIAVVIAGTNNIIGYIFSKDEDIVLRVSQVMVMYGFVHLFDATSAITGGIVRGAGKQQIGALCNMVGYYCVGFPIGVSLMFAFNMGIVGLWIGFFTCVFLQSLF--FIILIYRLDWKKATQEALIRAGVQLTEIKYESFG--LENKGCTEEAAQENTEEGQTDTNTDLEGLSKGEGGITDAVALVTVGEVL-------------TAKQLAVRRGLAFFFMLLILTGGIV 576          
BLAST of slc47a-5 vs. Ensembl Zebrafish
Match: slc47a3 (solute carrier family 47 member 3 [Source:ZFIN;Acc:ZDB-GENE-130530-755])

HSP 1 Score: 227.639 bits (579), Expect = 1.762e-66
Identity = 143/470 (30.43%), Postives = 242/470 (51.49%), Query Frame = 3
Query:   90 LKSEYPKLCRALIILFGPLFPTTFLQFLINVTPIMFVGQLDKIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPXXXXXXXXXXXXXXFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVTCPLYVAIGICANVKIGQYLGAGQHERAKKIAQISIVAXXXXXXXXXXXXXXXREYWPLIFTTDKIVNEQVSKLIAFYPIYFVPESVNGVLSGIMRGCAKHSLTMYLAFGCMYLMGLPVAAMLGFLAQLQVFGLWIGNTVGLSTLMIGYVISVWFFNWETLALDA------AHRLTRG--QYEDQNEIFEKN 1475
            L  +Y +   ++  L  P+F      +LI  T  +F G L K++LDGV   V+VI++ G  +G+GL+ ACDTL SQ YG+ + ++ G   QK++ I LL   P  A+L+N + +LLL GQ P +  +S +Y++ +LP  P  Y + +  +YLQNQ   WP ++  ++ NI N    Y+ L+  N   + SA    I+   +A     Y+     YK TW GW++  L  WD F+ LAIP +     E   +E    +AG++  V +   SV+     +     +   I  +V++G  +GAG   +AK  A++SI+  V +++ + ++I   +     IFT DK + ++V+ ++  Y  + + ++     S I++G  K  L         Y +G P+   L F A++ +FGLWIG  V +    I +++ +   NW+  + +A      A R T G  Q + +NE  + N
Sbjct:   24 LPVDYTREFVSMCTLAFPVFLAILFDYLILFTSSVFCGHLGKLELDGVTLAVAVINVLGVGIGFGLSAACDTLISQTYGAGNLQQVGVITQKAIIILLLTCLPCCAILINTESILLLAGQSPEVARVSQLYVNVFLPGLPAVYMFIVQVKYLQNQGIFWPLVITGVVANILNALINYILLFVLNMGVEGSAAANTISQYSLATILFIYIRWKGLYKETWKGWSMDCLQEWDSFIYLAIPSMLMMCGEWWTYEIGGLLAGLISEVELGAQSVMYGLANIAYMFPIGFSIAGSVRVGNAMGAGDVAQAKLSAKVSIMCAVSVAVVLATVIGCSKNVIARIFTNDKDIIQRVATVMVLYTPFHIFDATTAAGSSIVKGLGKQKLGAICNLLGYYGIGCPIGIPLMFAAKMGIFGLWIGLLVSVFLQSIFFIVLLVKLNWKKASEEAQIRAGVAIRRTDGASQEDGENEGCDVN 493          
BLAST of slc47a-5 vs. Ensembl Zebrafish
Match: slc47a4 (solute carrier family 47 member 4 [Source:ZFIN;Acc:ZDB-GENE-130530-865])

HSP 1 Score: 214.542 bits (545), Expect = 5.084e-61
Identity = 162/567 (28.57%), Postives = 268/567 (47.27%), Query Frame = 3
Query:  138 GPLFPTTFLQFLINVTPIMFVGQLDKIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPXXXXXXXXXXXXXXFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVTCPLYVAIGICANVKIGQYLGAGQHERAKKIAQISIVAXXXXXXXXXXXXXXXREYWPLIFTTDKIVNEQVSKLIAFY-PIYFVPESVNGVLS---GIMRGCAKHSLTMYLAFGCMYLMGLPVAAMLGFLAQLQVFGLWIGNTVGLSTLMIGYVISVWFFNWETLALDAAHRLTRGQYEDQNEIFEKNPLLITKPKENEKVNYPNGPYQLKHNRLPSQG--ITSSYDLI-RTKKIIVFENLRLKSKLNK-----NHKSIIIKRSVTLFVCLLMLFIGIIGRLSI---RPDYNRYKAFVTDSKFNS 1793
            GPL    FL FL+     MF G+L    L G A   + I++   + G GL  ACDTL SQ +GS +  + G  LQ+ + I  LF  P  A+L+N   LLL  GQ+P +  I+ +Y+  YLPA P  + Y +   YLQNQ    P + A  + N+ N  A Y  LY ++F    SA       +        ++   K ++ TW GW++ AL +W  +++LAIP      FE   +E   F+AG++  V +A   V+     +   + + +   A V++G  LGAG+   A   +++S+++  V+++  G ++   +     IFT+D+ + E VS+L+  Y P+ F     NG+L    G++ G  +  +         Y +GLP + +L F A LQV G W+G  + +  L I + ++++  NW+ +  +A  R  +            N  + T+   N +    N  YQ+  N     G  + SS D   R     V E   +     K     +   ++++R +T    LL+L +GII  L++   +  Y     +  DS F +
Sbjct:   45 GPLLVCRFLNFLLFFVVTMFCGRLGNTVLAGYAMASATINVTAAATGLGLALACDTLVSQTFGSKNLLRVGIILQRGIVILTLFSLPCWALLVNTQPLLLYLGQEPEVARIAQLYVVVYLPAIPAMFLYQLQLSYLQNQGVIKPQMYASAVANVANVIANYFLLYWWDFGVYGSAAANTFAQVFNCFALFCFIRWQKLHEKTWGGWSLEALQDWGSYMKLAIPSTLMTCFEWWIYEVGGFLAGMLSEVDLAAQHVVIMLAYINYMIPLGMQGAACVRVGNALGAGETAAAILTSKVSLISAAVIAIIQGFVLGSTKTVIGYIFTSDESITELVSQLLNIYCPLQF----FNGILCVGMGVLLGTGQQKIAAIANLFGYYCIGLPSSIVLMFTAGLQVAGFWLGLLIAVFLLAIFFTVAIFKLNWKKMTEEAIARTGKSANG------AANGTMTTEFCSNHR----NSFYQVVLNAENGNGYMVVSSQDQDERLNSTAVPEEPNVTGVEEKPPVLLSTTQLVLRRGLTTVAALLILAVGIIIHLTVPLPQVSYGAGANYTVDSNFTT 597          
BLAST of slc47a-5 vs. Ensembl Zebrafish
Match: slc47a3 (solute carrier family 47 member 3 [Source:ZFIN;Acc:ZDB-GENE-130530-755])

HSP 1 Score: 191.815 bits (486), Expect = 9.032e-55
Identity = 116/383 (30.29%), Postives = 200/383 (52.22%), Query Frame = 3
Query:  252 IHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPXXXXXXXXXXXXXXFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVTCPLYVAIGICANVKIGQYLGAGQHERAKKIAQISIVAXXXXXXXXXXXXXXXREYWPLIFTTDKIVNEQVSKLIAFYPIYFVPESVNGVLSGIMRGCAKHSLTMYLAFGCMYLMGLPVAAMLGFLAQLQVFGLWIGNTVGLSTLMIGYVISVWFFNWE 1400
            I++ G  +G+GL+ ACDTL SQ YG+ + ++ G   QK++ I LL   P  A+L+N + +LLL GQ P +  +S +Y++ +LP  P  Y + +  +YLQNQ   WP ++  ++ NI N    Y+ L+  N   + SA    I+   +A     Y+     YK TW GW++  L  WD F+ LAIP +     E   +E    +AG++  V +   SV+     +     +   I  +V++G  +GAG   +AK  A++SI+  V +++ + ++I   +     IFT DK + ++V+ ++  Y  + + ++     S I++G  K  L         Y +G P+   L F A++ +FGLWIG  V +    I +++ +   NW+
Sbjct:    1 INVLGVGIGFGLSAACDTLISQTYGAGNLQQVGVITQKAIIILLLTCLPCCAILINTESILLLAGQSPEVARVSQLYVNVFLPGLPAVYMFIVQVKYLQNQGIFWPLVITGVVANILNALINYILLFVLNMGVEGSAAANTISQYSLATILFIYIRWKGLYKETWKGWSMDCLQEWDSFIYLAIPSMLMMCGEWWTYEIGGLLAGLISEVELGAQSVMYGLANIAYMFPIGFSIAGSVRVGNAMGAGDVAQAKLSAKVSIMCAVSVAVVLATVIGCSKNVIARIFTNDKDIIQRVATVMVLYTPFHIFDATTVAGSSIVKGLGKQKLGAICNLLGYYGIGCPIGIPLMFAAKMGIFGLWIGLLVSVFLQSIFFIVLLVKLNWK 383          
BLAST of slc47a-5 vs. Ensembl Xenopus
Match: tmed6 (transmembrane p24 trafficking protein 6 [Source:Xenbase;Acc:XB-GENE-967876])

HSP 1 Score: 221.09 bits (562), Expect = 7.004e-64
Identity = 160/547 (29.25%), Postives = 265/547 (48.45%), Query Frame = 3
Query:  117 RALIILFGPLFPTTFLQFLINVTPIM----FVGQLDKIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPXXXXXXXXXXXXXXFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVTCPLYVAIGICANVKIGQYLGAGQHERAKKIAQISIVAXXXXXXXXXXXXXXXREYWPLIFTTDKIVNEQVSKLIAFYPIYFVPESVNGVLSGIMRGCAKHSLTMYLAFGCMYLMGLPVAAMLGFLAQLQVFGLWIGNTVGLSTLMIGYVISVWFFNWETLALDAAHRLTRGQYEDQNEIFEKNPLLITKPKENEKVNYPNGPYQLKHNRLPSQGITSSYDLIRTKKIIVFENLRL-KSKLNKNHKSIIIKRSVTLFVCLLMLFIGIIGRLSIR 1742
            + L+ + GPL     L +L++V PI+    F G L K +LD  A G S++ + G S+G G+  ACDT FSQ YG  + K  G  LQ+ + I  L  FP  A  +N  ++LLL GQDP +  ++ +Y+ T +PA     F+ +  RYLQNQ   WP +V   L  I N    Y+ L+        +AI + ++ +   I    Y+   K +  TWPGWT   L +W  F  LA+P +   + +   +E  I ++G++ +V +   S++ Q   +   + +A+ + + +++G YLGAG+ E+AK+ A++S V           ++  +R     IFT D  +   VS ++    ++ +  S   +  GI+RG     +  ++  G   L+  P+A  L F A+L V G W G   GL+ + I +VI +W  NW+ +   A  R          E+ EK P  +            NG     H  L      ++YD + +  I      RL K +  ++ K ++I+R+      + +L IG+I R +I 
Sbjct:   29 KILVSISGPLV----LTYLLDVAPILITTVFCGHLGKSELDAFALGNSIVILAGQSIGLGICSACDTFFSQIYGGKNLKLIGVVLQRGILILSLSCFPCWAFFVNTKNILLLLGQDPSVARLAELYVLTCIPALVGINFFNLEIRYLQNQGIIWPQVVVSFLACIINGILNYVLLFVLKIGVIGAAIAVTVSIVSKVIILFFYIWIRKIHVDTWPGWTKECLKDWGSFFALALPTMIMLSLKWWTFEIAIILSGLINLVELGGQSIMHQIMNLLNKISLALSLASCIRVGTYLGAGETEQAKRSARLSFVISAFPVFLGVGLLIGLRREIASIFTNDSSILFLVSDIMPLCAVFQIVGSACNLFYGILRGIGMQKVGAFVTVGGYLLIVFPMAVPLMFPAKLGVKGFWTGINAGLAVMDIVFVIYLWKANWKLITEKALER------AGLKELKEKGPTALE----------ANGIASSDHFEL------NNYDTMNSAFIGEQHLERLFKHEEKQSMKKLMIRRTFEALAIVSVLGIGLIIRFTIN 549          
BLAST of slc47a-5 vs. Ensembl Xenopus
Match: slc47a2 (solute carrier family 47 (multidrug and toxin extrusion), member 2 [Source:NCBI gene;Acc:100125051])

HSP 1 Score: 195.282 bits (495), Expect = 3.661e-54
Identity = 149/557 (26.75%), Postives = 268/557 (48.11%), Query Frame = 3
Query:   90 LKSEYPKLCRALIILFGPLFPTTFLQFLINVTPIMFVGQLDKIQLDGVAFGVSVIHIFGTS-VGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPXXXXXXXXXXXXXXFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVTCPLYVAIGICANVKIGQYLGAGQHERAKKIAQISIVAXXXXXXXXXXXXXXXREYWPLIFTTDKIVNEQVSKLIAFYPIYFVPESVNGVLSGIMRGCAKHSLTMYLAFGCMYLMGLPVAAMLGFLAQLQVFGLWIGNTVGLSTLMIGYVISVWFFNWETLALDAAHRLTR-----GQYEDQNEIFEKNPLLITKPKENEKVNYPN-GPYQLKHNRLPSQGITSSYDLIRTKKIIVFENLRLKSKLNKNHKSIIIKRSVTLFVCLLMLFIGIIGRLSI 1739
            L  E  +  + L+ L  P   T    FLI + P M    L KI+LD + + + +  I G   VG  L+ A D L  Q +G ++ K  G  LQ+ + I LLF FP  A+L+N + +LLLF QDP + +++ IY+  +LPA P  + Y +L++YLQNQ   +P ++   + NIFN    Y+ LY        SA    ++  I  I    Y++  + Y  TW GW+ +    W  F+RLA+  +     E   +E  +F+AG++G+V +A  +++ Q   V   + + + I  ++++G  LGAG  E+AK+ A + +    + +L  G +++ +++    IFT+D  +   VS ++  Y    + ++      GI+RG  K  +         Y++GLP+   L F A+L + G W G         I  +I V+  +W+  + +A  R +       + +++  ++++       P E   V+  N    +   +   S+G + +                  +   ++ +++I+ R + L   +  L IGI+ RLS+
Sbjct:   41 LPMEVWQEAQKLLALAAPAPYTENQTFLIEICPDMGSEHLGKIRLDFLTWPIDIWPISGQIWVGQVLSMAGDFLVLQTFGGSNLKLVGIILQRGILILLLFCFPCWALLINTESILLLFRQDPEVSKLTQIYVLIFLPALPAAFLYQLLAKYLQNQGIIYPQVLTGFIANIFNALFNYILLYVLGLGVMGSACANTVSQFIQMILLFLYIVWRRLYADTWGGWSQACFEEWGAFIRLAVASMLMLCIEWWAFEISMFLAGVLGMVDLAAQAIIYQVAIVVYLIPLGLCIAGSIRVGHGLGAGNTEQAKRSALVVLCMTELCALLSGILLATLKDVVAYIFTSDPNIVALVSYVLPVYSACLLFDACVAACGGILRGSGKLKVGAISHTVGYYVIGLPLGISLMFAAKLGIIGFWFGILACGIAQSIFLIIFVFKIDWKRASEEAQTRASERVEIPQKIDNKPSVYQEG-----CPTEQGDVDPGNVESIEFSQSSTSSEGTSPT-----------------PAGAAQHTRTLILTRGLALGCAVGTLIIGIVIRLSV 575          
BLAST of slc47a-5 vs. Ensembl Xenopus
Match: ccdc85a (coiled-coil domain containing 85A [Source:Xenbase;Acc:XB-GENE-954470])

HSP 1 Score: 155.606 bits (392), Expect = 2.640e-40
Identity = 118/399 (29.57%), Postives = 185/399 (46.37%), Query Frame = 3
Query:  132 LFGPLFPTTFLQFLINVTPIMFVGQLDKIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPXXXXXXXXXXXXXXFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVTCPLYVAIGICANVKIGQYLGAGQHERAKKIAQISIVAXX----XXXXXXXXXXXXXREYWPLIFTTDKIVNEQVSKLIAFYPIYFVPESVNGVLSGIMRGCAKHSLTMYLAFGCMYLMGLPVAAMLGFLAQLQV 1316
            +FG      FL FLINV   +F G L K++LD V    +VI + G SVG GL+ ACDTL SQ +G  + K  G  LQ+ + I  L  FP  A+ +N +++LLLF QDP++   S    S  L    + Y  F        Q   +  ++   + NI N    Y+ L+        SA    I      +    Y+   + +  TW GW+I  L +W  F+ LAIP +     E   +E    M+G++G+V +   SV+ Q  T    +   IG+  +V++G  LGAG  E+AK    ++ +        +      +++  +  +  IFT D+ V    + L+ +    F       V  GI+RG  +  +   +     YL+GLP+AA L F   + +
Sbjct:   56 IFGAEKLAQFLCFLINVVSAIFCGHLGKVELDAVTLANAVIAVTGLSVGLGLSSACDTLISQIFGGKNLKLIGIILQRGILILFLACFPCWALFINTENILLLFKQDPKVASSSRQCKSVSLNQTKMSYVIF--------QGIVYVQIIVSFVSNIINCIVNYVFLFVLRLGVIGSAWANTIAQFSQCLLIFLYIRVKRLHVNTWGGWSIECLQDWSSFISLAIPSMLMVCIEWWTYEIGNLMSGLLGVVELGAQSVIYQVVTTAYMIPFGIGMATSVRVGNALGAGNIEQAKTSTTVAFLVTGASLPAVIFVDILMLASFKNQFAYIFTNDRWV---FTFLLLYLSFSFC------VAGGILRGTGRQKIGAIINMVGYYLIGLPLAAALMFAVNIGI 437          
BLAST of slc47a-5 vs. Ensembl Xenopus
Match: ccdc85a (coiled-coil domain containing 85A [Source:Xenbase;Acc:XB-GENE-954470])

HSP 1 Score: 151.754 bits (382), Expect = 2.851e-39
Identity = 116/394 (29.44%), Postives = 185/394 (46.95%), Query Frame = 3
Query:  159 FLQFLINVTPIMFVGQLDKIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPXXXXXXXXXXXXXXFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVTCPLYVAIGICANVKIGQYLGAGQHERAKKIAQISIVAXX----XXXXXXXXXXXXXREYWPLIFTTDKIVNEQVSKLIAFYPIYFVPESVNGVLSGIMRGCAKHSLTMYLAFGCMYLMGLPVAAMLGFLAQLQVFGLW 1328
            FL FLINV   +F G L K++LD V    +VI + G SVG GL+ ACDTL SQ +G  + K  G  LQ+ + I  L  FP  A+ +N +++LLLF QDP++   S    S  L    + Y  F        Q   +  ++   + NI N    Y+ L+        SA    I      +    Y+   + +  TW GW+I  L +W  F+ LAIP +     E   +E    M+G++G+V +   SV+ Q  T T  +  +  +  +V++G  LGAG  E+AK    ++ +        +      +++  +  +  IFT D+ V    + L+ +    F       V  GI+RG  +  +   +     YL+GLP+AA L F   + + G++
Sbjct:   37 FLCFLINVVSAIFCGHLGKVELDAVTLANAVIAVTGLSVGLGLSSACDTLISQIFGGKNLKLIGIILQRGILILFLACFPCWALFINTENILLLFKQDPKVASSSRQCKSVSLNQTKMSYVIF--------QGIVYVQIIVSFVSNIINCIVNYVFLFVLRLGVIGSAWANTIAQFSQCLLIFLYIRVKRLHVNTWGGWSIECLQDWSSFISLAIPSMLMVCIEWWTYEIGNLMSGLLGVVELGAQSVIYQVVT-TAYMVRSASMATSVRVGNALGAGNIEQAKTSTTVAFLVTGASLPAVIFVDILMLASFKNQFAYIFTNDRWV---FTFLLLYLSFSFC------VAGGILRGTGRQKIGAIINMVGYYLIGLPLAAALMFAVNIGIKGIY 412          
BLAST of slc47a-5 vs. Ensembl Xenopus
Match: tysnd1 (trypsin domain containing 1 [Source:Xenbase;Acc:XB-GENE-972865])

HSP 1 Score: 104.375 bits (259), Expect = 2.851e-25
Identity = 54/132 (40.91%), Postives = 86/132 (65.15%), Query Frame = 3
Query:  117 RALIILFGPLFPTTFLQFLINVTPIMFVGQLDKIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPXXXXXXXXXXXXXXFGQDPRICEISSIYISTYLPAFPV 512
            + L ++ GP+F +  + F++NV   +F G L KI+LD V   V+VI++ G SVG GL+ ACDTL SQ +G  + K+ G  LQ+++ I LLF FP  A+ +N + +LLL  Q+P +   + +Y++ ++PA PV
Sbjct:   47 KDLCVIAGPVFLSQIMVFMVNVVSSIFCGHLGKIELDSVTLAVAVINVTGVSVGSGLSSACDTLISQTFGGRNLKRVGTILQRAILIVLLFCFPCWAIFINTEQILLLCKQNPDVARFTQMYVTIFMPALPV 178          
BLAST of slc47a-5 vs. Ensembl Mouse
Match: Slc47a1 (solute carrier family 47, member 1 [Source:MGI Symbol;Acc:MGI:1914723])

HSP 1 Score: 240.736 bits (613), Expect = 3.321e-71
Identity = 144/443 (32.51%), Postives = 237/443 (53.50%), Query Frame = 3
Query:   72 GLKEKLLKSEYPKLCRALIILFGPLFPTTFLQFLINVTPIMFVGQLDKIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPXXXXXXXXXXXXXXFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVTCPLYVAIGICANVKIGQYLGAGQHERAKKIAQISIVAXXXXXXXXXXXXXXXREYWPLIFTTDKIVNEQVSKLIAFYPIYFVPESVNGVLSGIMRGCAKHSLTMYLAFGCMYLMGLPVAAMLGFLAQLQVFGLWIGNTVGLSTLMIGYVISVWFFNWE 1400
            GL+  LL     +L RAL++L GP F    + FLI+    +F G L K++LD V   ++VI++ G SVG+GL+ ACDTL SQ YGS + K  G  LQ+   I LL  FP  A+ +N + +LLLF QDP +  ++  Y+  ++PA P  + Y +  +YL NQ    P ++  +  N+ N  A Y+ LY  +     SA+   I+   +AIF   Y++  + ++ TW GW+   L +W  FLRLAIP +     E   +E   F++GI+G+V +   S+  +   +   +     + ANV++G  LGAG  ++AKK + IS++   + ++T   ++   ++    IFTTD+ +   V+++I  Y +  + E +     GI+RG     +   +     Y++GLP+   L F A+L V GLW G  +  +     ++  +   NW+
Sbjct:   22 GLRCLLLPGFLEEL-RALLVLAGPAFLAQLMMFLISFISSVFCGHLGKLELDAVTLAIAVINVTGISVGHGLSSACDTLISQTYGSQNLKHVGVILQRGTLILLLCCFPCWALFINTEQILLLFRQDPDVSRLTQTYVMIFIPALPAAFLYTLQVKYLLNQGIVLPQIMTGIAANLVNALANYVFLYHLHLGVMGSALANTISQFALAIFLFLYILWRRLHQATWGGWSWECLQDWASFLRLAIPSMLMLCIEWWAYEVGSFLSGILGMVELGAQSITYELAIIVYMIPSGFSVAANVRVGNALGAGNIDQAKKSSAISLIVTELFAVTFCVLLLGCKDLVGYIFTTDRDIVALVAQVIPIYAVSHLFEGLACTCGGILRGTGNQKVGAIVNAIGYYVIGLPIGIALMFAAKLGVIGLWSGIIICTTCQTTCFLAFIARLNWK 463          
BLAST of slc47a-5 vs. Ensembl Mouse
Match: Slc47a2 (solute carrier family 47, member 2 [Source:MGI Symbol;Acc:MGI:3588190])

HSP 1 Score: 213.386 bits (542), Expect = 6.544e-61
Identity = 133/446 (29.82%), Postives = 226/446 (50.67%), Query Frame = 3
Query:   90 LKSEYPKLCRALIILFGPLFPTTFLQFLINVTPIMFVGQLDKIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPXXXXXXXXXXXXXXFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVTCPLYVAIGICANVKIGQYLGAGQHERAKKIAQISIVAXXXXXXXXXXXXXXXREYWPLIFTTDKIVNEQVSKLIAFYPIYFVPESVNGVLSGIMRGCAKHSLTMYLAFGCMYLMGLPVAAMLGFLAQLQVFGLWIGNTVGLSTLMIGYVISVWFFNWETLALDAAHR 1427
            L  +  +   AL+ L GP+F    + FLI++   +F G L K++LD V   VSV+++ G SVG GL  ACDTL SQ++G  + K+ G  LQ+ + I LL  FP  A+ LN + LLLL  QDP +  ++ +Y+   +PA P  + + + +RYLQ+Q    P ++  +  N+ N       LY  +     SA     +   ++     Y+   + +  TW GWT      W  + RLAIP +     E   +E   F+AG++ +  +   +V+ +  +V   +    G+ A+V++G  LGAG  ++A+      ++   V +L +G +++ +++    IFT DK +   VS+++  +  + + +++ G   G++RG  K  +   L     Y  G P+   L F A+L + GLW G  V +S     Y+I +   NW  +A  A  R
Sbjct:   36 LSPDVRREAAALVALAGPVFLAQLMIFLISIVSSIFCGHLGKVELDAVTLAVSVVNVTGISVGTGLASACDTLMSQSFGGKNLKRVGVILQRGILILLLCCFPCWAIFLNTERLLLLLRQDPDVARLAQVYVMICIPALPAAFLFQLQTRYLQSQGIIMPQVIVGIAANVVNVGMNAFLLYALDLGVVGSAWANTTSQFFLSALLFLYVWWKRIHIHTWGGWTRECFQEWSSYTRLAIPSMFMVCIEWWTFEIGTFLAGLVNVTELGAQAVIYELASVAYMVPFGFGVAASVRVGNALGAGNADQARCSCTTVLLCAGVCALLVGILLAALKDVVAYIFTNDKDIISLVSQVMPIFAPFHLFDALAGTCGGVLRGTGKQKIGAVLNTIGYYGFGFPIGVSLMFAAKLGIIGLWAGLIVCVSFQAFSYLIYILRTNWSRVAEQAQVR 481          
BLAST of slc47a-5 vs. Ensembl Mouse
Match: Slc47a2 (solute carrier family 47, member 2 [Source:MGI Symbol;Acc:MGI:3588190])

HSP 1 Score: 210.69 bits (535), Expect = 9.953e-61
Identity = 131/440 (29.77%), Postives = 224/440 (50.91%), Query Frame = 3
Query:   90 LKSEYPKLCRALIILFGPLFPTTFLQFLINVTPIMFVGQLDKIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPXXXXXXXXXXXXXXFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVTCPLYVAIGICANVKIGQYLGAGQHERAKKIAQISIVAXXXXXXXXXXXXXXXREYWPLIFTTDKIVNEQVSKLIAFYPIYFVPESVNGVLSGIMRGCAKHSLTMYLAFGCMYLMGLPVAAMLGFLAQLQVFGLWIGNTVGLSTLMIGYVISVWFFNWETLA 1409
            L  +  +   AL+ L GP+F    + FLI++   +F G L K++LD V   VSV+++ G SVG GL  ACDTL SQ++G  + K+ G  LQ+ + I LL  FP  A+ LN + LLLL  QDP +  ++ +Y+   +PA P  + + + +RYLQ+Q    P ++  +  N+ N       LY  +     SA     +   ++     Y+   + +  TW GWT      W  + RLAIP +     E   +E   F+AG++ +  +   +V+ +  +V   +    G+ A+V++G  LGAG  ++A+      ++   V +L +G +++ +++    IFT DK +   VS+++  +  + + +++ G   G++RG  K  +   L     Y  G P+   L F A+L + GLW G  V +S     Y+I +   NW  +A
Sbjct:   36 LSPDVRREAAALVALAGPVFLAQLMIFLISIVSSIFCGHLGKVELDAVTLAVSVVNVTGISVGTGLASACDTLMSQSFGGKNLKRVGVILQRGILILLLCCFPCWAIFLNTERLLLLLRQDPDVARLAQVYVMICIPALPAAFLFQLQTRYLQSQGIIMPQVIVGIAANVVNVGMNAFLLYALDLGVVGSAWANTTSQFFLSALLFLYVWWKRIHIHTWGGWTRECFQEWSSYTRLAIPSMFMVCIEWWTFEIGTFLAGLVNVTELGAQAVIYELASVAYMVPFGFGVAASVRVGNALGAGNADQARCSCTTVLLCAGVCALLVGILLAALKDVVAYIFTNDKDIISLVSQVMPIFAPFHLFDALAGTCGGVLRGTGKQKIGAVLNTIGYYGFGFPIGVSLMFAAKLGIIGLWAGLIVCVSFQAFSYLIYILRTNWSRVA 475          
BLAST of slc47a-5 vs. Ensembl Mouse
Match: Slc47a1 (solute carrier family 47, member 1 [Source:MGI Symbol;Acc:MGI:1914723])

HSP 1 Score: 149.443 bits (376), Expect = 4.440e-41
Identity = 81/214 (37.85%), Postives = 123/214 (57.48%), Query Frame = 3
Query:  162 LQFLINVTPIMFVGQLDKIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPXXXXXXXXXXXXXXFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAI 803
            + FLI+    +F G L K++LD V   ++VI++ G SVG+GL+ ACDTL SQ YGS + K  G  LQ+   I LL  FP  A+ +N + +LLLF QDP +  ++  Y+  ++PA P  + Y +  +YL NQ    P ++  +  N+ N  A Y+ LY  +     SA+   I+   +AIF   Y++  + ++ TW GW+   L +W  FLRLAI
Sbjct:    1 MMFLISFISSVFCGHLGKLELDAVTLAIAVINVTGISVGHGLSSACDTLISQTYGSQNLKHVGVILQRGTLILLLCCFPCWALFINTEQILLLFRQDPDVSRLTQTYVMIFIPALPAAFLYTLQVKYLLNQGIVLPQIMTGIAANLVNALANYVFLYHLHLGVMGSALANTISQFALAIFLFLYILWRRLHQATWGGWSWECLQDWASFLRLAI 214          
BLAST of slc47a-5 vs. Ensembl Mouse
Match: Slc47a1 (solute carrier family 47, member 1 [Source:MGI Symbol;Acc:MGI:1914723])

HSP 1 Score: 114.39 bits (285), Expect = 8.053e-29
Identity = 67/161 (41.61%), Postives = 97/161 (60.25%), Query Frame = 3
Query:   72 GLKEKLLKSEYPKLCRALIILFGPLFPTTFLQFLINVTPIMFVGQLDKIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPXXXXXXXXXXXXXXFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQ 554
            GL+  LL     +L RAL++L GP F    + FLI+    +F G L K++LD V   ++VI++ G SVG+GL+ ACDTL SQ YGS + K  G  LQ+   I LL  FP  A+ +N + +LLLF QDP +  ++  Y+  ++PA P  + Y +  +YL NQ
Sbjct:   22 GLRCLLLPGFLEEL-RALLVLAGPAFLAQLMMFLISFISSVFCGHLGKLELDAVTLAIAVINVTGISVGHGLSSACDTLISQTYGSQNLKHVGVILQRGTLILLLCCFPCWALFINTEQILLLFRQDPDVSRLTQTYVMIFIPALPAAFLYTLQVKYLLNQ 181          
BLAST of slc47a-5 vs. UniProt/SwissProt
Match: sp|Q5RFD2|S47A1_PONAB (Multidrug and toxin extrusion protein 1 OS=Pongo abelii OX=9601 GN=SLC47A1 PE=2 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 1.388e-70
Identity = 147/479 (30.69%), Postives = 253/479 (52.82%), Query Frame = 3
Query:   96 SEYPKLCRALIILFGPLFPTTFLQFLINVTPIMFVGQLDKIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPXXXXXXXXXXXXXXFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVTCPLYVAIGICANVKIGQYLGAGQHERAKKIAQISIVAXXXXXXXXXXXXXXXREYWPLIFTTDKIVNEQVSKLIAFYPIYFVPESVNGVLSGIMRGCAKHSLTMYLAFGCMYLMGLPVAAMLGFLAQLQVFGLWIG---NTVGLSTLMIGYVISVWFFNWETLALDA---AHRLTRGQYEDQNEIFEKNPLLITKPKENEKV 1514
            S + +  RAL++L GP F    + FLI+    +F G L K++LD V   ++VI++ G SVG+GL+ ACDTL SQ YGS + K  G  LQ+S  I LL  FP  A+ LN  H+LLLF QDP +  ++  Y++ ++PA P  + Y +  +YL NQ    P +V  +  N+ N  A YL L++ +     SA+  +I+   +A+    Y++  K ++ TW GW++  L +W  FL LA+P +     E   +E   F++GI+G+V +   S++ +   +   +     + A+V++G  LGAG  E+A+K + +S++  V+ ++    ++   +++   IFTTD+ +   V++++  Y +  + E++     G++RG     +   +     Y++GLP+   L F  +L V GLW G    TV  +   +G++I     NW+     A   A+          N    ++PL    P+  E +
Sbjct:   29 SAFREELRALLVLAGPAFLVQLMVFLISFISSVFCGHLGKLELDAVTLAIAVINVTGVSVGFGLSSACDTLISQTYGSQNLKHVGVILQRSALILLLCCFPCWALFLNTQHILLLFRQDPDVSRLTQTYVTIFIPALPATFLYMLQVKYLLNQGIVLPQIVTGVAANLVNALANYLFLHQLHLGAIGSALANLISQYTLALLLFFYILGKKLHQATWGGWSLECLQDWASFLHLAVPSMLMLCMEWWAYEVGSFLSGILGMVELGAQSIVYELAIIVYMVPAGFSVAASVRVGNALGAGDMEQARKSSTVSLLITVLFAVAFSVLLLSCKDHVGYIFTTDRDIINLVAQVVPIYAVSHLFEALACTSGGVLRGSGNQKVGAIVNTIGYYVVGLPIGIALMFATKLGVMGLWSGIIICTVFQAVCFLGFIIQ---LNWKKACQQAQVHANLKVNNVPRSGNSALPQDPLHPGCPENLEGI 504          
BLAST of slc47a-5 vs. UniProt/SwissProt
Match: sp|Q8K0H1|S47A1_MOUSE (Multidrug and toxin extrusion protein 1 OS=Mus musculus OX=10090 GN=Slc47a1 PE=1 SV=2)

HSP 1 Score: 240.736 bits (613), Expect = 2.323e-70
Identity = 144/443 (32.51%), Postives = 237/443 (53.50%), Query Frame = 3
Query:   72 GLKEKLLKSEYPKLCRALIILFGPLFPTTFLQFLINVTPIMFVGQLDKIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPXXXXXXXXXXXXXXFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVTCPLYVAIGICANVKIGQYLGAGQHERAKKIAQISIVAXXXXXXXXXXXXXXXREYWPLIFTTDKIVNEQVSKLIAFYPIYFVPESVNGVLSGIMRGCAKHSLTMYLAFGCMYLMGLPVAAMLGFLAQLQVFGLWIGNTVGLSTLMIGYVISVWFFNWE 1400
            GL+  LL     +L RAL++L GP F    + FLI+    +F G L K++LD V   ++VI++ G SVG+GL+ ACDTL SQ YGS + K  G  LQ+   I LL  FP  A+ +N + +LLLF QDP +  ++  Y+  ++PA P  + Y +  +YL NQ    P ++  +  N+ N  A Y+ LY  +     SA+   I+   +AIF   Y++  + ++ TW GW+   L +W  FLRLAIP +     E   +E   F++GI+G+V +   S+  +   +   +     + ANV++G  LGAG  ++AKK + IS++   + ++T   ++   ++    IFTTD+ +   V+++I  Y +  + E +     GI+RG     +   +     Y++GLP+   L F A+L V GLW G  +  +     ++  +   NW+
Sbjct:   22 GLRCLLLPGFLEEL-RALLVLAGPAFLAQLMMFLISFISSVFCGHLGKLELDAVTLAIAVINVTGISVGHGLSSACDTLISQTYGSQNLKHVGVILQRGTLILLLCCFPCWALFINTEQILLLFRQDPDVSRLTQTYVMIFIPALPAAFLYTLQVKYLLNQGIVLPQIMTGIAANLVNALANYVFLYHLHLGVMGSALANTISQFALAIFLFLYILWRRLHQATWGGWSWECLQDWASFLRLAIPSMLMLCIEWWAYEVGSFLSGILGMVELGAQSITYELAIIVYMIPSGFSVAANVRVGNALGAGNIDQAKKSSAISLIVTELFAVTFCVLLLGCKDLVGYIFTTDRDIVALVAQVIPIYAVSHLFEGLACTCGGILRGTGNQKVGAIVNAIGYYVIGLPIGIALMFAAKLGVIGLWSGIIICTTCQTTCFLAFIARLNWK 463          
BLAST of slc47a-5 vs. UniProt/SwissProt
Match: sp|A1L1P9|S47A1_DANRE (Multidrug and toxin extrusion protein 1 OS=Danio rerio OX=7955 GN=slc47a1 PE=2 SV=1)

HSP 1 Score: 238.424 bits (607), Expect = 3.138e-69
Identity = 161/554 (29.06%), Postives = 273/554 (49.28%), Query Frame = 3
Query:   81 EKLLKSEYPKLCRALIILFGPLFPTTFLQFLINVTPIMFVGQLDKIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPXXXXXXXXXXXXXXFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVTCPLYVAIGICANVKIGQYLGAGQHERAKKIAQISIVAXXXXXXXXXXXXXXXREYWPLIFTTDKIVNEQVSKLIAFYPIYFVPESVNGVLSGIMRGCAKHSLTMYLAFGCMYLMGLPVAAMLGFLAQLQVFGLWIG--NTVGLSTLMIGYVISVWFFNWETLALDAAHRLTRGQYEDQNEIFEKNPLLITKPKENEKVNYPNGPYQLKHNRLPSQGITSS----YDLIRTKKIIVFENLRLKSKLNKNHKSIIIKRSVTLFVCLLMLFIGII 1724
              LL   Y      L+ L GP+F +  + FLI+    +F G L K +L GVA  ++VI++ G S+G GL  ACDTL SQ +GS + K+ G  LQ+ + I LL  FP  A+L+N + +LL   Q P +  +S +Y+  ++PA P  + Y +  RYLQNQ   WP ++    GNI N    Y+ L+        SA    I+   +A+F   Y+     +K TW GW+   L  W  F+RLA+P +     E   +E   F+AG++    +   SV+ +  T+     +   + A+V++G  LGAG  ERAK  A++++V  V++S  + ++I   ++    IFTT++ +  +VS+++  Y  + + +++ G+  GI+RG  K  L         Y +G P    L F   + + GLWIG    V L +L   ++I ++  +W+    +A  R      E ++E F           EN+           K +++  +G+T +      L +  + I     +         K +I++R + + + +L+L  GI+
Sbjct:   42 RSLLPVNYKTEIVELLKLAGPVFISQLMIFLISFVSTVFCGHLGKTELAGVALAIAVINVTGISIGSGLASACDTLISQTFGSNNLKRVGVILQRGILILLLACFPCWALLINTEPILLAVRQSPNVASLSQLYVKIFMPALPAAFMYQLQGRYLQNQGIIWPQVITGAAGNILNALINYVFLHLLELGVAGSAAANTISQYSLAVFLYVYIRWKNLHKATWDGWSRDCLQEWGAFIRLALPSMLMLCVEWWTYEIGGFLAGLISETELGAQSVVYELATIAYMFPLGFAVAASVRVGNALGAGNTERAKLSAKVALVCGVLVSCVVATLIGCTKDVIAYIFTTEEEIVSRVSQVMIMYGFFHLFDAIAGITGGIVRGAGKQLLGALCNIVGYYFVGFPTGVSLMFALSMGIIGLWIGFFGCVFLQSLF--FIILIYKLDWKKATQEALIRAGVQLTETKDESF---------GLENKGCTEEAA----KESQITEEGLTDANTDLEGLSKGGEGISEAGAKTTVGAVLTTKQLIVRRGLAVLLMVLILAGGIV 580          
BLAST of slc47a-5 vs. UniProt/SwissProt
Match: sp|Q5I0E9|S47A1_RAT (Multidrug and toxin extrusion protein 1 OS=Rattus norvegicus OX=10116 GN=Slc47a1 PE=1 SV=1)

HSP 1 Score: 237.269 bits (604), Expect = 5.512e-69
Identity = 136/413 (32.93%), Postives = 226/413 (54.72%), Query Frame = 3
Query:   96 SEYPKLCRALIILFGPLFPTTFLQFLINVTPIMFVGQLDKIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPXXXXXXXXXXXXXXFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVTCPLYVAIGICANVKIGQYLGAGQHERAKKIAQISIVAXXXXXXXXXXXXXXXREYWPLIFTTDKIVNEQVSKLIAFYPIYFVPESVNGVLSGIMRGCAKHSLTMYLAFGCMYLMGLPVAAMLGFLAQLQVFGLWIG 1334
            S + +  RAL++L GP F    + FLI+    +F G L K++LD V   ++VI++ G SVG+GL+ ACDTL SQ YGS + K  G  LQ+   I LL  FP  A+ +N + +LLLF QDP +  ++  Y+  ++PA P  + Y +  +YL NQ    P ++  +  N+ N  A YL L++ +     SA+   I+   +AIF   Y++  K +  TW GW+   L +W  FL+LAIP +     E   +E   F++GI+G+V +   S+  +   +   +     + ANV++G  LGAG  ++AKK + IS++   + ++T   ++   ++    IFTTD  +   V++++  Y +  + E++     G++RG     +   +     Y++GLP+   L F+A+L V GLW G
Sbjct:   28 SGFQEELRALLVLAGPAFLAQLMMFLISFISSVFCGHLGKLELDAVTLAIAVINVTGISVGHGLSSACDTLISQTYGSQNLKHVGVILQRGTLILLLCCFPCWALFINTEQILLLFRQDPDVSRLTQTYVMVFIPALPAAFLYTLQVKYLLNQGIVLPQVITGIAANLVNALANYLFLHQLHLGVMGSALANTISQFALAIFLFLYILWRKLHHATWGGWSWECLQDWASFLQLAIPSMLMLCIEWWAYEVGSFLSGILGMVELGAQSITYELAIIVYMIPAGFSVAANVRVGNALGAGNIDQAKKSSAISLIVTELFAVTFCVLLLGCKDLVGYIFTTDWDIVALVAQVVPIYAVSHLFEALACTCGGVLRGTGNQKVGAIVNAIGYYVIGLPIGISLMFVAKLGVIGLWSG 440          
BLAST of slc47a-5 vs. UniProt/SwissProt
Match: sp|Q96FL8|S47A1_HUMAN (Multidrug and toxin extrusion protein 1 OS=Homo sapiens OX=9606 GN=SLC47A1 PE=1 SV=1)

HSP 1 Score: 236.498 bits (602), Expect = 1.170e-68
Identity = 151/500 (30.20%), Postives = 257/500 (51.40%), Query Frame = 3
Query:   96 SEYPKLCRALIILFGPLFPTTFLQFLINVTPIMFVGQLDKIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPXXXXXXXXXXXXXXFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVTCPLYVAIGICANVKIGQYLGAGQHERAKKIAQISIVAXXXXXXXXXXXXXXXREYWPLIFTTDKIVNEQVSKLIAFYPIYFVPESVNGVLSGIMRGCAKHSLTMYLAFGCMYLMGLPVAAMLGFLAQLQVFGLWIG---NTVGLSTLMIGYVISVWFFNWETLALDA---AHRLTRGQYEDQNEIFEKNPLLITKPKENE--------KVNYPNGPYQLKHNR 1553
            S + +  RAL++L GP F    + FLI+    +F G L K++LD V   ++VI++ G SVG+GL+ ACDTL SQ YGS + K  G  LQ+S  + LL  FP  A+ LN  H+LLLF QDP +  ++  Y++ ++PA P  + Y +  +YL NQ    P +V  +  N+ N  A YL L++ +     SA+  +I+   +A+    Y++  K ++ TW GW++  L +W  FLRLAIP +     E   +E   F++GI+G+V +   S++ +   +   +     + A+V++G  LGAG  E+A+K + +S++  V+ ++    ++   +++   IFTTD+ +   V++++  Y +  + E++     G++RG     +   +     Y++GLP+   L F   L V GLW G    TV  +   +G++I     NW+     A   A+          N    ++PL    P+  E        K   P    Q++   
Sbjct:   29 SAFREELRALLVLAGPAFLVQLMVFLISFISSVFCGHLGKLELDAVTLAIAVINVTGVSVGFGLSSACDTLISQTYGSQNLKHVGVILQRSALVLLLCCFPCWALFLNTQHILLLFRQDPDVSRLTQTYVTIFIPALPATFLYMLQVKYLLNQGIVLPQIVTGVAANLVNALANYLFLHQLHLGVIGSALANLISQYTLALLLFLYILGKKLHQATWGGWSLECLQDWASFLRLAIPSMLMLCMEWWAYEVGSFLSGILGMVELGAQSIVYELAIIVYMVPAGFSVAASVRVGNALGAGDMEQARKSSTVSLLITVLFAVAFSVLLLSCKDHVGYIFTTDRDIINLVAQVVPIYAVSHLFEALACTSGGVLRGSGNQKVGAIVNTIGYYVVGLPIGIALMFATTLGVMGLWSGIIICTVFQAVCFLGFIIQ---LNWKKACQQAQVHANLKVNNVPRSGNSALPQDPLHPGCPENLEGILTNDVGKTGEPQSDQQMRQEE 525          
BLAST of slc47a-5 vs. TrEMBL
Match: A0A0H3YFP0 (Multidrug and toxin extrusion protein OS=Schmidtea mediterranea OX=79327 GN=slc47a-5 PE=2 SV=1)

HSP 1 Score: 1129.78 bits (2921), Expect = 0.000e+0
Identity = 582/582 (100.00%), Postives = 582/582 (100.00%), Query Frame = 3
Query:   72 GLKEKLLKSEYPKLCRALIILFGPLFPTTFLQFLINVTPIMFVGQLDKIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPXXXXXXXXXXXXXXFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVTCPLYVAIGICANVKIGQYLGAGQHERAKKIAQISIVAXXXXXXXXXXXXXXXREYWPLIFTTDKIVNEQVSKLIAFYPIYFVPESVNGVLSGIMRGCAKHSLTMYLAFGCMYLMGLPVAAMLGFLAQLQVFGLWIGNTVGLSTLMIGYVISVWFFNWETLALDAAHRLTRGQYEDQNEIFEKNPLLITKPKENEKVNYPNGPYQLKHNRLPSQGITSSYDLIRTKKIIVFENLRLKSKLNKNHKSIIIKRSVTLFVCLLMLFIGIIGRLSIRPDYNRYKAFVTDSKFNSTTESMFVK 1817
            GLKEKLLKSEYPKLCRALIILFGPLFPTTFLQFLINVTPIMFVGQLDKIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPVAAVLLNVDHLLLLFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVTCPLYVAIGICANVKIGQYLGAGQHERAKKIAQISIVAVVVLSLTIGSIISIIREYWPLIFTTDKIVNEQVSKLIAFYPIYFVPESVNGVLSGIMRGCAKHSLTMYLAFGCMYLMGLPVAAMLGFLAQLQVFGLWIGNTVGLSTLMIGYVISVWFFNWETLALDAAHRLTRGQYEDQNEIFEKNPLLITKPKENEKVNYPNGPYQLKHNRLPSQGITSSYDLIRTKKIIVFENLRLKSKLNKNHKSIIIKRSVTLFVCLLMLFIGIIGRLSIRPDYNRYKAFVTDSKFNSTTESMFVK
Sbjct:    4 GLKEKLLKSEYPKLCRALIILFGPLFPTTFLQFLINVTPIMFVGQLDKIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPVAAVLLNVDHLLLLFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVTCPLYVAIGICANVKIGQYLGAGQHERAKKIAQISIVAVVVLSLTIGSIISIIREYWPLIFTTDKIVNEQVSKLIAFYPIYFVPESVNGVLSGIMRGCAKHSLTMYLAFGCMYLMGLPVAAMLGFLAQLQVFGLWIGNTVGLSTLMIGYVISVWFFNWETLALDAAHRLTRGQYEDQNEIFEKNPLLITKPKENEKVNYPNGPYQLKHNRLPSQGITSSYDLIRTKKIIVFENLRLKSKLNKNHKSIIIKRSVTLFVCLLMLFIGIIGRLSIRPDYNRYKAFVTDSKFNSTTESMFVK 585          
BLAST of slc47a-5 vs. TrEMBL
Match: A0A267DC31 (Multidrug and toxin extrusion protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig015591g3 PE=3 SV=1)

HSP 1 Score: 283.108 bits (723), Expect = 1.672e-83
Identity = 182/593 (30.69%), Postives = 295/593 (49.75%), Query Frame = 3
Query:   81 EKLLKSEYPKLCRALIILFGPLFPTTFLQFLINVTPIMFVGQLDKIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPXXXXXXXXXXXXXXFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVTCPLYVAIGICANVKIGQYLGAGQHERAKKIAQISIVAXXXXXXXXXXXXXXXREYWPLIFTTDKIVNEQVSKLIAFYPIYFVPESVNGVLSGIMRGCAKHSLTMYLAFGCMYLMGLPVAAMLGFLAQLQVFGLWIGNTVGLSTLMIGYVISVWFFNWETLALDAAHRL----------------TRGQYEDQNEIFEKNPLLITKPKENEKVNYPNGPY-QLKHNRLPSQGITSSYDL---IRTKKIIVFENLRLKSKLNKNHKSIIIKRSVTLFVCLLMLFIGIIGRLSIRPDYNRYKAFVTDSKFNSTT 1799
             +   ++  +  + L+ +  P+  T FL F+I    I+  G+L K++LDG A   S+I+ FG S G GL  ACDTLFSQ YGSA KK+ G YLQ+S+ I  L PF +     N++ +L+  GQD  +  +S+ Y+  + P     Y Y I +RYLQNQDK   P++  L+ N FN  +QYL +Y +NF +  S +C  +TY +MA   L Y++ S+ Y+ TW GW++  L+NW  FLRLA+PG+     E I +E   F+AGI+G   +   S+L QT T+     +  G+  N+++GQ LGA     A+      I  ++ ++  + ++  + +++ P ++TTD  V    +++      +   + +  V +G +RGC +    +   F   Y +G+ +   L     L V GLW+G  +G+S +   Y+  +   +W   A  A  R+                 R Q ED     E   LL  +     + N  + P  Q +H R PS    ++ D    IRT   I        S  N   + II  R  T    + +  IG+I RL+I  + ++  +   +S +++ T
Sbjct:    9 RRFFNNDLKQEIKKLLTIAWPVVATYFLNFVILSESIIMCGRLGKLELDGAALANSIINGFGLSFGSGLVAACDTLFSQCYGSAYKKRVGLYLQQSILIIGLAPFLIWPFYFNIEPILIALGQDAEVSRMSANYVLYFSPGIFFYYMYLIQARYLQNQDKVIVPMIVALIANAFNILSQYLGIYVWNFGFLCSPVCQCLTYALMAGTMLAYILISRVYRETWNGWSLQCLFNWWQFLRLALPGMGMVCLEIICYEIGTFIAGIIGTSELGAQSILFQTETLAYTCVLGFGVAVNIRVGQNLGANNGPGARLAWIAGICCLLCVASVLCAVFVVGKDFIPGLYTTDPDVLTITAQIFPLLGFFIFLDGLQSVCAGALRGCGRQLTGVIFVFLSYYGLGMTIGLPLALATDLHVIGLWVGLLIGVSLICPAYIAVLARQDWRGQARQAQRRVRAASEKQLRYDTDCEEERQQGEDDQLANETTGLLTDRNHRPYEQNQESSPEKQQQHRRYPSNPAYTTADQLVPIRTPSEIP------SSLSNAATRRIIYIRLATGIAVIGIFSIGLIIRLTINSNNDQPPSPGGNSSWSNVT 595          
BLAST of slc47a-5 vs. TrEMBL
Match: A0A267ETL6 (Multidrug and toxin extrusion protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig015591g1 PE=3 SV=1)

HSP 1 Score: 283.108 bits (723), Expect = 1.781e-83
Identity = 182/593 (30.69%), Postives = 295/593 (49.75%), Query Frame = 3
Query:   81 EKLLKSEYPKLCRALIILFGPLFPTTFLQFLINVTPIMFVGQLDKIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPXXXXXXXXXXXXXXFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVTCPLYVAIGICANVKIGQYLGAGQHERAKKIAQISIVAXXXXXXXXXXXXXXXREYWPLIFTTDKIVNEQVSKLIAFYPIYFVPESVNGVLSGIMRGCAKHSLTMYLAFGCMYLMGLPVAAMLGFLAQLQVFGLWIGNTVGLSTLMIGYVISVWFFNWETLALDAAHRL----------------TRGQYEDQNEIFEKNPLLITKPKENEKVNYPNGPY-QLKHNRLPSQGITSSYDL---IRTKKIIVFENLRLKSKLNKNHKSIIIKRSVTLFVCLLMLFIGIIGRLSIRPDYNRYKAFVTDSKFNSTT 1799
             +   ++  +  + L+ +  P+  T FL F+I    I+  G+L K++LDG A   S+I+ FG S G GL  ACDTLFSQ YGSA KK+ G YLQ+S+ I  L PF +     N++ +L+  GQD  +  +S+ Y+  + P     Y Y I +RYLQNQDK   P++  L+ N FN  +QYL +Y +NF +  S +C  +TY +MA   L Y++ S+ Y+ TW GW++  L+NW  FLRLA+PG+     E I +E   F+AGI+G   +   S+L QT T+     +  G+  N+++GQ LGA     A+      I  ++ ++  + ++  + +++ P ++TTD  V    +++      +   + +  V +G +RGC +    +   F   Y +G+ +   L     L V GLW+G  +G+S +   Y+  +   +W   A  A  R+                 R Q ED     E   LL  +     + N  + P  Q +H R PS    ++ D    IRT   I        S  N   + II  R  T    + +  IG+I RL+I  + ++  +   +S +++ T
Sbjct:    9 RRFFNNDLKQEIKKLLTIAWPVVATYFLNFVILSESIIMCGRLGKLELDGAALANSIINGFGLSFGSGLVAACDTLFSQCYGSAYKKRVGLYLQQSILIIGLAPFLIWPFYFNIEPILIALGQDAEVSRMSANYVLYFSPGIFFYYMYLIQARYLQNQDKVIVPMIVALIANAFNILSQYLGIYVWNFGFLCSPVCQCLTYALMAGTMLAYILISRVYRATWNGWSLQCLFNWWQFLRLALPGMGMVCLEIICYEIGTFIAGIIGTSELGAQSILFQTETLAYTCVLGFGVAVNIRVGQNLGANNGPGARLAWIAGICCLLCVASVLCAVFVVGKDFIPGLYTTDPDVLTITAQIFPLLGFFIFLDGLQSVCAGALRGCGRQLTGVIFVFLSYYGLGMTIGLPLALATDLHVIGLWVGLLIGVSLICPAYIAVLARQDWRGQARQAQRRVRAASEKQLRYDTDCEEERQQGEDDQLANETTGLLTDRNHRPYEQNQESSPEKQQQHRRYPSNPAYTTADQLVPIRTPSEIP------SSLSNAATRRIIYIRLATGIAVIGIFSIGLIIRLTINSNNDQPPSPGGNSSWSNVT 595          
BLAST of slc47a-5 vs. TrEMBL
Match: A0A0H3YJN6 (Multidrug and toxin extrusion protein OS=Schmidtea mediterranea OX=79327 GN=slc47a-7 PE=2 SV=1)

HSP 1 Score: 280.411 bits (716), Expect = 1.259e-82
Identity = 177/559 (31.66%), Postives = 298/559 (53.31%), Query Frame = 3
Query:   75 LKEKLLKSEYPKLCRALIILFG---PLFPTTFLQFLINVTPIMFVGQLDKIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPXXXXXXXXXXXXXXFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVTCPLYVAIGICANVKIGQYLGAGQHERAKKIAQISIVAXXXXXXXXXXXXXXXREYWPLIFTTDKIVNEQVSKLIAFYPIYFVPESVNGVLSGIMRGCAKHSLTMYLAFGCMYLMGLPVAAMLGFLAQLQVFGLWIGNTVGLSTLM-IGYVISVWFFNWETLALDAAHRLTRGQYEDQNEIFEKNPLLITKPKENEKVNYPNGPYQLKHNRLPSQGITSSY--DLIRTKKIIVFENLRLKSKLNKNHKSIIIKRSVTLFVCLLMLFIGIIGRL 1733
            L+ +  K  + ++ + L++L     P+  T    FLI    I+  G + K +LD  A   SVI++ G +V  GL  ACDTLFSQ YGS  +K  G  L KS  I  +FP  + A+ +N++ L +L GQD  + + ++ Y+  + P     +++ IL+RY+QNQ+K  PP++  ++ NIFN  +QYL +Y F   +  SAIC  IT+L+     L Y++ +K Y+ TW GWT      W  F +LAIPG A    E   +E    ++G+MG + MA  SVL Q  T+T  +   +GI  N+++GQYLG+G+ ++A K+ +  ++ ++   +   S+I   ++Y PL+FT D    +  S+L+         ++   V  G +RGC +  + + L F   YL+G P+   L F+AQL+V GLWIG  V L+  + I  + + +  +W+  A     R+   +++ +NE F KN  + ++    +++ Y    ++  H R  S+  + S   +++ TK + V E         K +    I + +  F  L +L +GI+ +L
Sbjct:   19 LEHEHEKFSFKQMRKELLLLVKIAIPIILTNLCGFLILTESIIIAGHISKYELDACALANSVINVAGIAVATGLCTACDTLFSQMYGSKHRKAIGAMLIKSTMIITIFPILLIALHINMEPLFILMGQDKIVAKDAARYMVIFSPGLLFGFYFLILTRYMQNQNKVLPPMIIGIIVNIFNVVSQYLTVYYFKLGFDFSAICQAITFLLFWALELAYILIAKLYEETWDGWTRDVFLEWGLFTKLAIPGAAMVIMECFCFEIGTLLSGVMGPLEMAAQSVLFQLETITFMISFGVGISVNIRVGQYLGSGKPQQALKVYRYGLLVMMSSFVLTSSLILGFKDYLPLVFTNDGEAQKLSSELLPILVGVQFFDAFGTVTMGALRGCGRQKICVLLIFCSFYLLGQPIGISLAFVAQLKVQGLWIGLLVSLAICVPIAVIYTNFIQDWQHQANLCQKRIAEARHQQENEEF-KNETIESRRNSFQQLEY----FKASHRRSISKSFSVSVPGNIMVTKYVEVTE---------KTYTKAYITKFIIFFSTLCVLIMGILVKL 563          
BLAST of slc47a-5 vs. TrEMBL
Match: A0A267DNE9 (Multidrug and toxin extrusion protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026979g1 PE=3 SV=1)

HSP 1 Score: 281.952 bits (720), Expect = 1.398e-82
Identity = 172/551 (31.22%), Postives = 280/551 (50.82%), Query Frame = 3
Query:  141 PLFPTTFLQFLINVTPIMFVGQLDKIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPXXXXXXXXXXXXXXFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVTCPLYVAIGICANVKIGQYLGAGQHERAKKIAQISIVAXXXXXXXXXXXXXXXREYWPLIFTTDKIVNEQVSKLIAFYPIYFVPESVNGVLSGIMRGCAKHSLTMYLAFGCMYLMGLPVAAMLGFLAQLQVFGLWIGNTVGLSTLMIGYVISVWFFNWETLALDAAHRLTRGQ-----YEDQNEIFE--KNPLLITKPKENEKVNYPNGPYQLKHNRLPSQGITSSYDLIRTKKIIVFENLRLKSKLNKNHKS-------IIIKRSVTLFVCLLMLFIGIIGRLSIRPDY 1751
            P+  T FL F+I    +M  G L K +LDG A   S+I+  G S+G GL   CDTLFSQ+YGS +K++ G YL +SL I  LFPF + AV +N+  +LL  GQ P +  +++ Y+  + P     +FY IL+RYLQNQD+ + P++  + GN+FN  +QYLC+Y +NF + SSA+C  +T++IM +  + Y++ S  Y  TW GW + +L+NW  FL+LA+PG+   + E   WE   F+AG MG   +   S+L QT T T  + + + I  N+++GQ LGA    RAK +       ++  +     I    R   P +FT D  +    + +     ++   + ++ + +G +RGC + +    L     Y++GLPV   +     L+VFGLW+G  +G+      Y+  +   +W   A  A  R+   +     Y+ + E+ +  ++P    K   +E     +     +     S G    +            ++R+     K H S       + + R      CL +L IG+IGR++ +  Y
Sbjct:   57 PVIVTNFLNFVILSESVMMCGHLTKDELDGAALANSLINALGLSIGVGLCTGCDTLFSQSYGSVNKRRMGTYLLQSLMIIGLFPFLIWAVHINILPILLALGQLPNVSLLAAEYMLWFSPGVIFNFFYLILARYLQNQDRVYAPMLCAVAGNVFNLISQYLCIYVWNFGFVSSAVCQALTFVIMFVLLIGYIVFSHVYVETWNGWDVESLFNWWQFLKLALPGMGMVSLETFCWEVGTFVAGYMGEEELGAQSILFQTETWTFMIALGLSIAVNIRVGQSLGALNGSRAKLVWLAGCCCLLCSATVTTIIFITCRSLLPYMFTNDANIAAIAAGIFPVLGLFQFIDGISCISAGALRGCGRQATGALLVITAYYIIGLPVGIPVALTTSLRVFGLWLGLLIGICITAPTYIFLLCRQDWNRQAELAQERIQVAEERQQVYDTEAELEDSGRSPSTKAKRAASEATALLDDSPGARRLSTASAGGGRRHRRRMPSNPAFVSSIRVVPLRVKPHASDPKKIWRMALTRLAIGLACLGILLIGVIGRVATQNVY 607          
BLAST of slc47a-5 vs. Ensembl Cavefish
Match: slc47a2.1 (solute carrier family 47 member 1 [Source:NCBI gene;Acc:103046628])

HSP 1 Score: 236.498 bits (602), Expect = 2.113e-69
Identity = 153/541 (28.28%), Postives = 271/541 (50.09%), Query Frame = 3
Query:  123 LIILFGPLFPTTFLQFLINVTPIMFVGQLDKIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPXXXXXXXXXXXXXXFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVTCPLYVAIGICANVKIGQYLGAGQHERAKKIAQISIVAXXXXXXXXXXXXXXXREYWPLIFTTDKIVNEQVSKLIAFYPIYFVPESVNGVLSGIMRGCAKHSLTMYLAFGCMYLMGLPVAAMLGFLAQLQVFGLWIGNTVGLSTLMIGYVISVWFFNWETLALDAAHRLTRGQYEDQNEIF-------EKNPLLITKPKENEKVNYPNGPYQLKHNRLPSQGITSSYDLIRTKKIIVFENLRLKSKLNKNHKSIIIKRSVTLFVCLLMLFIGII 1724
            L+ L GP+F +  + FLI+    +F G L   +L GVA  ++VI++ G S+G GL  ACDTL SQ +GS + K+ G  LQ+ + I LL  FP  A+L+N + +LL   Q PR+  +S +Y+  Y+P+ P  + Y +  RYLQNQ   WP ++    GNI N    Y+ L+  +     SA    I+   +A+F   Y+     +K TW GW+   L  W  F+RLA P +     E   +E   F+AG++G   +   SV+ +  T+     +   + A+V++G  LGAG  E+AK   +++++  +++S  + ++IS +++     FTT++ +  +VS+++A Y  + + ++   +  GI+RG  K  +         Y +G P+   L F   + + GLW G  V +    + ++I +   +W+    +A  R    Q E ++E +       E +    TKP + +        +  K+  +  Q           K++ V   +        + K ++I+R + +F+ +L+L  GI+
Sbjct:   53 LLKLAGPVFISQLMIFLISFVSTVFCGHLGNTELAGVALAIAVINVTGLSIGSGLASACDTLISQTFGSNNLKRVGVILQRGVLILLLACFPCWAILINTEPILLAVRQSPRVASLSQLYVKIYMPSLPAAFMYQLQGRYLQNQGIIWPQVITGAAGNILNALINYIFLHLLHLGVAGSAAANSISQCSLAVFLYVYIRWKGLHKATWDGWSRDCLQEWGAFIRLAFPSMLMLCVEWWTYEIGGFLAGLIGETELGAQSVIYELATIAYMFPLGFAVAASVRVGNALGAGNTEQAKLSGKVALICGLLVSCGVAALISGLKDVIAYTFTTEQEIIVRVSEVMAMYGFFHLFDATAAITGGIVRGAGKQLVGAMCNIVGFYFVGFPIGVSLMFALSMGIVGLWAGFFVCVFLQSVFFLILICKLDWKKATKEAQVRAGICQTEMKDESYAMENKSCEADEYQGTKPSKED--------HTYKNPDIEGQNKCEETQTAEEKRVAVIGEML-------STKQLVIRRGLAVFLMVLILAGGIV 578          
BLAST of slc47a-5 vs. Ensembl Cavefish
Match: slc47a4 (multidrug and toxin extrusion protein 1-like [Source:NCBI gene;Acc:103045605])

HSP 1 Score: 225.328 bits (573), Expect = 3.520e-65
Identity = 164/559 (29.34%), Postives = 278/559 (49.73%), Query Frame = 3
Query:  138 GPLFPTTFLQFLINVTPIMFVGQLDKIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPXXXXXXXXXXXXXXFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVTCPLYVAIGICANVKIGQYLGAGQHERAKKIAQISIVAXXXXXXXXXXXXXXXREYWPLIFTTDKIVNEQVSKLIAF-YPIYFVPESVNGVLS---GIMRGCAKHSLTMYLAFGCMYLMGLPVAAMLGFLAQLQVFGLWIGNTVGLSTLMIGYVISVWFFNWETLALDAAHRLTRGQ---YEDQNEIFEKNPLLITKPKENEKVNYPNGPYQLKHNRLPSQGITSSYDLIRTKKIIVFENLRLKSKLNKNHKSIIIKRSVTLFVCLLMLFIGIIGRLSI-RPDYNRYKAFVTDSKFN 1790
            GPL    FL FL+     MF G+L   +L G     + IH+  T+ GYGLT ACDTL SQ +GS +    G  LQ+ + I LLF  P  A+L+N   LLLL GQDP +  I+ IY+  Y+PA P  + Y +   YLQNQ    P + A ++ NI N  A Y+ L+  +     SA       +   I   TY+   K +  TW GW+  +L +W  +++LAIP    A F+   +E   F+AG++G V +A   V+     +   + + +   A V++G  LGAG    A   +++S++   +L++ +G +I+  +     IFT+D+ + E VS+L+    P+ F     NG+L    GI+ G  +  +         YL+GLP++ +L + A+LQ+ G W+G  V +  L I +V+ ++  NW+ +  +A  R   G+   + D+      +          E  N     YQ+  +R   Q    S  + + ++ +  E  +  +    +   ++++R +T    +L+L +G +  L++  P+     AF+T++  +
Sbjct:   46 GPLLVCRFLNFLLFFVVTMFCGRLGNTELAGYGMASATIHVTATATGYGLTLACDTLVSQTFGSKNLLHVGVILQRGVLILLLFCLPCWALLINTQPLLLLVGQDPEVARIAQIYVVAYIPAVPAMFLYQLQRSYLQNQGVIMPQMYASVVVNIVNVLANYVLLFWLDLGVHGSAAANSFAPIFSCIALFTYIRIKKLHVKTWGGWSSESLQDWGAYMKLAIPSTLMACFDWWIYEIGGFLAGMLGEVDLAAQHVVIMLAYIVYMIPLGLQGAACVRVGNALGAGNTAGAIHTSKVSLILAAILAILLGVVIASTKTVIAFIFTSDESIAELVSELMGICCPLQF----FNGILCVGMGILLGTGQQKIAAIANLLGYYLIGLPLSIILTYPAKLQIAGFWLGLLVAVFLLAIYFVVIIFRLNWKKMTEEAIERAGMGKTVIHSDRRSSHRLSDSFFLAVTNGENGN----SYQIVSSR--DQTEERSPPVAQERQEVGQEEEKSSAASMLSTSQLMVRRGLTTLAAVLILAVGTVVHLTVPLPEV----AFITNNTMD 590          
BLAST of slc47a-5 vs. Ensembl Cavefish
Match: slc47a4 (multidrug and toxin extrusion protein 1-like [Source:NCBI gene;Acc:103046413])

HSP 1 Score: 223.402 bits (568), Expect = 2.120e-64
Identity = 165/561 (29.41%), Postives = 278/561 (49.55%), Query Frame = 3
Query:  138 GPLFPTTFLQFLINVTPIMFVGQLDKIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPXXXXXXXXXXXXXXFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVTCPLYVAIGICANVKIGQYLGAGQHERAKKIAQISIVAXXXXXXXXXXXXXXXREYWPLIFTTDKIVNEQVSKLIAFY-PIYFVPESVNGVLS---GIMRGCAKHSLTMYLAFGCMYLMGLPVAAMLGFLAQLQVFGLWIGNTVGLSTLMIGYVISVWFFNWETLALDAAHRLTRGQYEDQNEIFEKNPL-----LITKPKENEKVNYPNGPYQLKHNRLPSQGITSSYDLIRTKKIIVFENLRLKSKLNKNHKSIIIKRSVTLFVCLLMLFIGIIGRLSI-RPDYNRYKAFVTDSKFN 1790
            GPL    FL FL+     MF G+L   +L G     + I++   + G+GL  ACDTL SQ +GS +    G  LQ+ + I LLF  P  A+L+N   LLLL GQDP +  I+ IY+  Y+PA P  + Y +   YLQNQ    P + A ++ NI N  A Y+ L+ ++     SA       +       TY+   K +  TW GW+  +L +W  +++LAIP    A FE   +E   F+AG++G V +A   V+     +   + + +   A V++G  LGAG    A   +++S++   +L++  G +++  +     IFT+D+ + E VS+L+  Y P+ F     NG+L    GI+ G  +  +         YL+GLP++ +L F A+LQV G W+G  V +  L I +++ ++  NW+ +  +A  R   G+    ++    + L     L     EN  V      YQ+  +R   Q    S  + + ++ +  E  +  +    +   ++I+R +T    +L+L +G +  L++  P+     AF+T+S  +
Sbjct:   46 GPLLVCRFLNFLLFFVVTMFCGRLGNTELAGYGMASATINVTTAATGFGLALACDTLVSQTFGSKNLLHVGVILQRGVLILLLFCLPCWALLINTQPLLLLVGQDPEVARIAQIYVVAYIPAVPAMFLYQLQLSYLQNQGVIIPQMYASVVANIVNALANYVLLFWWDLGVHGSAAANSFAQVFSCFALFTYIRIKKLHVKTWGGWSSESLQDWGAYMKLAIPSTLMACFEWWIYEVGGFLAGMLGEVDLAAQHVVIMLAYINYMIPLGLQGAACVRVGNALGAGNTAGAIHTSKVSLILAAILAILQGIVLASTKTVIAFIFTSDESIAELVSELMGIYCPLQF----FNGILCVGMGILLGTGQQKIAAIANLLGYYLIGLPLSIILTFPAKLQVAGFWLGLLVAVFLLAIYFIVIIFRLNWKKMTEEAIKRAGMGKTVIHSDFRSSHRLSDSFFLAVTNGENGNV------YQIVSSR--DQTEERSPPVAQERQGVRQEEEKSSAAPKLSTSQLMIRRGLTTLAAVLILAVGTVVHLTVPLPEV----AFITNSTMD 590          
BLAST of slc47a-5 vs. Ensembl Cavefish
Match: slc47a3 (multidrug and toxin extrusion protein 1-like [Source:NCBI gene;Acc:103046114])

HSP 1 Score: 216.083 bits (549), Expect = 2.856e-62
Identity = 136/501 (27.15%), Postives = 248/501 (49.50%), Query Frame = 3
Query:   78 KEKLLKSEYPKLCRALIILFGPLFPTTFLQFLINVTPIMFVGQLDKIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPXXXXXXXXXXXXXXFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVTCPLYVAIGICANVKIGQYLGAGQHERAKKIAQISIVAXXXXXXXXXXXXXXXREYWPLIFTTDKIVNEQVSKLIAFYPIYFVPESVNGVLSGIMRGCAKHSLTMYLAFGCMYLMGLPVAAMLGFLAQLQVFGLWIGNTVGLSTLMIGYVISVWFFNWETLALDAAHRLTRGQYEDQNEIFEKNPLLITKPKEN----EKVNYPNGPYQLKHNRLPSQG 1568
            K  L   E  K  + L  L  P+  +  + +LI+    +F G L   +LDGVA  ++++++   +VGYGL  ACDTL SQ +GS + ++ G  +Q+ L I LL  FP  A+L+N + +LLL  Q+P + ++S +Y+  ++PA P  + + I S YLQNQ   WP ++   + N+ N  + Y+ L+  +     SA    ++  +MAI    Y+     +K TW GW++  L  WD F  LAIPG+     E   +E   F+AG++  V +   S++ +   V     +   +   V++G  +GAG   +AK  A++++   V +++ +  I+   ++    IF+ D+ +  +V+ ++  Y  + + ++       I+RG  K  L         Y +G P+   L F A++ +FGLW G  + +    + ++  +   NWE    +A       Q      + EK+ +   +  E+    E+  YP+    ++ + + + G
Sbjct:   16 KRCLFPEEVKKEVKELSALALPVLLSYIMVYLISFVSTVFCGHLGSTELDGVALAIAILNVSSVAVGYGLASACDTLISQTFGSGNLQRVGVIVQRGLIILLLACFPCWAILINTESILLLVKQNPDVAKLSQMYVKIFMPALPALFVFIIESTYLQNQGIIWPLVITGAIANVLNALSNYVFLFVLDLGVPGSAAANTVSQYLMAIVLFIYIRCRGLHKDTWYGWSMECLQEWDTFFHLAIPGLLMLCAEWWTYELGAFLAGLISPVELGAQSIIYELANVAYMFPIGFSVAGCVRVGNAMGAGDTAQAKLSAKLAMACAVSVAVCLAIIVGFTKDVISYIFSNDEQIRARVATVMVLYAPFHLLDATAAAAGSIVRGLGKQKLGAVGNVFGYYAVGFPIGVSLMFAAKMGIFGLWTGLLICVFFQSVFFITLLSKLNWEKATEEA-------QIRAGVHMNEKDDVDAVQQYEDVGSYEEGTYPDTQSLIQKSSVCTVG 509          
BLAST of slc47a-5 vs. Ensembl Cavefish
Match: slc47a3 (multidrug and toxin extrusion protein 1-like [Source:NCBI gene;Acc:103046114])

HSP 1 Score: 216.468 bits (550), Expect = 3.507e-62
Identity = 129/450 (28.67%), Postives = 229/450 (50.89%), Query Frame = 3
Query:   78 KEKLLKSEYPKLCRALIILFGPLFPTTFLQFLINVTPIMFVGQLDKIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPXXXXXXXXXXXXXXFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVTCPLYVAIGICANVKIGQYLGAGQHERAKKIAQISIVAXXXXXXXXXXXXXXXREYWPLIFTTDKIVNEQVSKLIAFYPIYFVPESVNGVLSGIMRGCAKHSLTMYLAFGCMYLMGLPVAAMLGFLAQLQVFGLWIGNTVGLSTLMIGYVISVWFFNWETLALDAAHR 1427
            K  L   E  K  + L  L  P+  +  + +LI+    +F G L   +LDGVA  ++++++   +VGYGL  ACDTL SQ +GS + ++ G  +Q+ L I LL  FP  A+L+N + +LLL  Q+P + ++S +Y+  ++PA P  + + I S YLQNQ   WP ++   + N+ N  + Y+ L+  +     SA    ++  +MAI    Y+     +K TW GW++  L  WD F  LAIPG+     E   +E   F+AG++  V +   S++ +   V     +   +   V++G  +GAG   +AK  A++++   V +++ +  I+   ++    IF+ D+ +  +V+ ++  Y  + + ++       I+RG  K  L         Y +G P+   L F A++ +FGLW G  + +    + ++  +   NWE    +A  R
Sbjct:   16 KRCLFPEEVKKEVKELSALALPVLLSYIMVYLISFVSTVFCGHLGSTELDGVALAIAILNVSSVAVGYGLASACDTLISQTFGSGNLQRVGVIVQRGLIILLLACFPCWAILINTESILLLVKQNPDVAKLSQMYVKIFMPALPALFVFIIESTYLQNQGIIWPLVITGAIANVLNALSNYVFLFVLDLGVPGSAAANTVSQYLMAIVLFIYIRCRGLHKDTWYGWSMECLQEWDTFFHLAIPGLLMLCAEWWTYELGAFLAGLISPVELGAQSIIYELANVAYMFPIGFSVAGCVRVGNAMGAGDTAQAKLSAKLAMACAVSVAVCLAIIVGFTKDVISYIFSNDEQIRARVATVMVLYAPFHLLDATAAAAGSIVRGLGKQKLGAVGNVFGYYAVGFPIGVSLMFAAKMGIFGLWTGLLICVFFQSVFFITLLSKLNWEKATEEAQIR 465          
BLAST of slc47a-5 vs. Ensembl Yeast
Match: YDR338C_mRNA (Putative protein of unknown function; member of the multi-drug and toxin extrusion (MATE) family of the multidrug/oligosaccharidyl-lipid/polysaccharide (MOP) exporter superfamily [Source:SGD;Acc:S000002746])

HSP 1 Score: 97.4413 bits (241), Expect = 1.170e-21
Identity = 107/457 (23.41%), Postives = 200/457 (43.76%), Query Frame = 3
Query:  147 FPTTFLQFLINVTPI---MFVGQLDKIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPXXXXXXXXXXXXXXFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYK--FNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVTCPLYVAIGICANVKIGQYLGAGQHERAKKIAQISIVAXXXXXXXXXXXXXXXREYWPLIFTTDKIVNEQVSKLIAFYPIYFVPESVNGVLSGIMRGCAKHSLTMYLAFGCMYLMGLPVAAMLGFLAQLQVFGLWIGNTVGLSTLMIGYVIS--VWFFNWETL-------------ALDAAHRLTRGQYEDQN 1457
            FP  F   L  + P+   + VG L K +L  V+   S+      ++  G+  + DTL  QAYGS      G +LQ+ +  SL+   P A +    + LL     +  +  ++S ++   +   P   F+  L R+LQ Q      +  + +    N    Y  ++       +  +AI +++ + +M    L Y +     K  W G++  A  +W+D   LA  GI     E++++E     +   G+  +A  S +S    +   +  AIGI  + +I  ++GA + + A   +Q+ +    +       I+   R     I++ D  V + +++++    I    +S+N V    +RG    SL   +     YL G+P+A +L +   ++++GLWIG  +G + L+IG V +  V F +W+ +              +D+   LT     D+N
Sbjct:  237 FPLIFTFLLEQIFPMVCSLTVGHLGKNELAAVSLA-SMTSNITLAIFEGIATSLDTLCPQAYGSGRFYSVGVHLQRCIAFSLVIYIPFAVMWWYSEPLLSYIIPEKELINLTSRFLRVLILGAPAYIFFENLKRFLQAQGIFDAGIYVLTICAPLNVLVSYTLVWNKYIGVGFIGAAIAVVLNFWLMFFLLLFYALYIDGRK-CWGGFSRKAFTHWNDLGHLAFSGIIMLEAEELSYELLTLFSAYYGVSYLAAQSAVSTMAALLYMIPFAIGISTSTRIANFIGAKRTDFAHISSQVGLSFSFIAGFINCCILVFGRNLIANIYSKDPEVIKLIAQVLPLVGIVQNFDSLNAVAGSCLRGQGMQSLGSIVNLMAYYLFGIPLALILSWFFDMKLYGLWIG--IGSAMLLIGLVEAYYVLFPDWDKIMTYAEILKETEDDEVDSDEYLTDSDDPDEN 689          
BLAST of slc47a-5 vs. Ensembl Yeast
Match: ERC1 (Member of the multi-drug and toxin extrusion (MATE) family; the MATE family is part of the multidrug/oligosaccharidyl-lipid/polysaccharide (MOP) exporter superfamily; overproduction confers ethionine resistance and accumulation of S-adenosylmethionine [Source:SGD;Acc:S000001074])

HSP 1 Score: 84.3445 bits (207), Expect = 1.396e-17
Identity = 83/373 (22.25%), Postives = 158/373 (42.36%), Query Frame = 3
Query:  141 PLFPTTFLQFLINVTPIMFVGQLDKIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPXXXXXXXXXXXXXXFGQDPR-ICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLY--KFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWT-----ISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVTCPLYVAIGICANVKIGQYLGAGQHERAKKIAQISIVAXXXXXXXXXXXXXXXREYWPLIFTTDKIVNEQVSK---LIAFYPIYFVPESVNGVLSGIMRGCAKH 1226
            PL  T  LQ  +++  I  V  L   +L GV  G    +I G +   GL    DTL +QAYG+ +    G  +Q+   I++L   P+  V       +L      R +C +++ Y+       P    +    R+LQ Q       + + +    N    YL ++  K    Y  + + ++I Y +M +  L Y +T+K  +     W        A  NW   + LAIPG+     E + +E     A  +G   +   S+++   ++   +  +I +  + ++  ++GA  ++      ++S++   V S     +I   +E    +F+T+  V + V     L+AF  ++   ++ N   +G +RG  + 
Sbjct:  174 PLIFTFILQNSLSLASIFSVSHLGTKELGGVTLGSMTANITGLAAIQGLCTCLDTLCAQAYGAKNYHLVGVLVQRCAVITILAFLPMMYVWFVWSEKILALMIPERELCALAANYLRVTAFGVPGFILFECGKRFLQCQGIFHASTIVLFVCAPLNALMNYLLVWNDKIGIGYLGAPLSVVINYWLMTLGLLIYAMTTKHKERPLKCWNGIIPKEQAFKNWRKMINLAIPGVVMVEAEFLGFEVLTIFASHLGTDALGAQSIVATIASLAYQVPFSISVSTSTRVANFIGASLYDSCMITCRVSLLLSFVCSSMNMFVICRYKEQIASLFSTESAVVKMVVDTLPLLAFMQLF---DAFNASTAGCLRGQGRQ 543          
BLAST of slc47a-5 vs. Ensembl Nematostella
Match: EDO46474 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ02])

HSP 1 Score: 164.851 bits (416), Expect = 3.329e-45
Identity = 113/405 (27.90%), Postives = 195/405 (48.15%), Query Frame = 3
Query:  108 KLCRALIILFGPLFPTTFLQFLINVTPIMFVGQLDKIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPXXXXXXXXXXXXXXFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVTCPLYVAIGICANVKIGQYLGAGQHERAKKIAQISIVAXXXXXXXXXXXXXXXREYWPLIFTTDKIVNEQVSKLIAFYPIYFVPESVNGVLSGIMRGCAKHSLTMYLAFGCMYLMGLPVAAMLGFLAQLQVFG 1322
            K C  ++ L  P   +    F ++   ++F G L +++L  V+   S I++ G SV  GL  A +TL SQAYG+      G YLQ+ +CI  +      +  +  +H LL  G + +I  ++  YI   LP  P  +   +L RYLQ Q    P L   ++         YL +   +      AI   + Y + ++  L Y+   K +  TW GW+ S L +W  F+ LA+PG+     E  ++E   F+ G +    +A H +L Q  T++  L +  G+ A V +G  LG+ Q +RAK + ++S++  +  S  +   +   R+Y  L FT D+ V     + +     + V ++  GV++GI+RG  +  + + L     +++ LP+   L F+A L + G
Sbjct:    2 KECIQILKLAWPTVISQVFTFGLSTQSVIFAGHLGELELATVSLASSFINVTGYSVAVGLCTALETLCSQAYGAKKYGMVGTYLQRGICILSVAMLLTYSFWMQTEHFLLGIGVEQQISRMTDKYIMMSLPILPGIFGQTLLQRYLQVQGIMQPVLYIGMVVFCCAIGINYLLVLTLHLGISGIAISFYVNYYLFSVLLLVYIYIRKIHHLTWKGWSFSCLDDWRQFIGLAVPGMMMICVEWWSFEIGSFLLGRIDDSNVAAHGILFQLATISFMLPIGTGLAATVSVGMALGSNQPDRAKLVTKVSLIITIAFSALVAICVVCARKYIVLAFTDDREVINLTIQTLPIVGTFLVFDASQGVMAGIIRGSGRQKIGLVLNVITYFIIALPLGITLTFIAHLDLLG 406          
BLAST of slc47a-5 vs. Ensembl Medaka
Match: ENSORLT00000002449.2 (multidrug and toxin extrusion protein 1 [Source:NCBI gene;Acc:101156384])

HSP 1 Score: 248.44 bits (633), Expect = 5.773e-74
Identity = 152/490 (31.02%), Postives = 257/490 (52.45%), Query Frame = 3
Query:   90 LKSEYPKLCRALIILFGPLFPTTFLQFLINVTPIMFVGQLDKIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPXXXXXXXXXXXXXXFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVTCPLYVAIGICANVKIGQYLGAGQHERAKKIAQISIVAXXXXXXXXXXXXXXXREYWPLIFTTDKIVNEQVSKLIAFYPIYFVPESVNGVLSGIMRGCAKHSLTMYLAFGCMYLMGLPVAAMLGFLAQLQVFGLWIGNTVGLSTLMIGYVISVWFFNWETLALDAAHRL-TRGQYEDQNEIFEKN----PLLITKPKEN------EKVNYPN 1526
            +  EY    + L  L GP+  +  + F+I+   ++F G L K +L GV+  +++I++ G S+G GL+  CDTL SQ +GS + K+ G  LQ+ + I LL  FP  AVL+N + LLL F Q+P +  +S +Y++ ++P+ P  + Y + SRYLQNQ   WP ++   +GNIFN    Y+ LY  +     SA    I+  ++A+    Y+     +K TW GW++  L  W  F++LAIP +     E   +E   F+AG++G   +  HSV  Q   +   L + I   A+V++G  LGAG+ E+AK   ++ I+   +++  +G+I+   ++    IFT+D+ + ++   ++         + + G+  GI+RG  K  +         Y+ G+P+   L F A + V GLW G T+ +      ++I +W  NW+  A +A  R   + + E + EI + N     + +T P  +      EKVN P 
Sbjct:   43 IPEEYRNELKHLFRLAGPVVISQLMVFMISFVSMVFCGHLGKTELAGVSLSIAIINVTGISIGTGLSLTCDTLISQTFGSGNLKRVGVILQRGVLILLLACFPCWAVLINTEPLLLAFKQNPEVSRLSQLYVNIFMPSLPASFMYQLQSRYLQNQGIIWPQVITGAIGNIFNAIINYVLLYPLDLGVAGSAAANAISQFLLAVLLFVYICLKGLHKATWDGWSLDCLQEWGPFVKLAIPSMLMLCLEWWIFEVGGFLAGMIGEAELGAHSVAYQLAVIAYMLPLGISAAASVRVGNALGAGKVEQAKLSCKVPIICGFIVAFMMGTILGSTKDVIGYIFTSDQEILDKAPGVVFVLGFTHFFDCIAGITGGILRGAGKQMVGALCNLVGYYVFGVPIGVSLMFAAHMNVVGLWTGLTICVFMQSSFFLIYLWKLNWKKAAEEAQVRAGVQIKDEKEMEITDCNRIHSQVSVTAPSCDGEDHTYEKVNIPE 532          
BLAST of slc47a-5 vs. Ensembl Medaka
Match: slc47a3 (multidrug and toxin extrusion protein 1 [Source:NCBI gene;Acc:101163594])

HSP 1 Score: 244.588 bits (623), Expect = 7.549e-73
Identity = 159/549 (28.96%), Postives = 275/549 (50.09%), Query Frame = 3
Query:   93 KSEYPKLCRALIILFGPLFPTTFLQFLINVTPIMFVGQLDKIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPXXXXXXXXXXXXXXFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVTCPLYVAIGICANVKIGQYLGAGQHERAKKIAQISIVAXXXXXXXXXXXXXXXREYWPLIFTTDKIVNEQVSKLIAFYPIYFVPESVNGVLSGIMRGCAKHSLTMYLAFGCMYLMGLPVAAMLGFLAQLQVFGLWIGNTVGLSTLMIGYVISVWFFNWETLALDAAHRLTRGQYEDQNEIFEKNPLLITKPKENEKVNYPNGPYQLKHNRLPSQGITSSYDLIRTKKIIVFENLRLKSKLNKNHKSIIIKRSVTLFVCLLMLFIGIIGRLSI 1739
            KSE  ++ +    L GP+     + F ++    +F G L + +L GV+  ++V ++ G S+G GL  ACDTL SQ YGS + +K G  LQ+++ I LL  FP  A+L+N   +LL F Q+P +  ++ +Y+  ++PA P  + + +LSRYLQNQ   WP ++   L N+ N    Y+ L+        SA+    +   MA     Y++    +K TW GW+   L++W  ++RLAIP +     E   +E   F+AG++  V +   S++ +   V     +   +  NV++G  LGAG+ E+ K  A++++    ++S+ +  +I  ++++   +FT D+ + E+VS +I+FY  + + ++++   SGI+RG  K  +         Y +G PV   L F A+L + GLW G    +S   +  +  +   NW+ + ++A  R   G  E   E         T P+  +  NY          R PS   T+  D I T   +        SK     ++++++R + L + L +L  GII  L I
Sbjct:   36 KSEIKEMSK----LAGPVMIAQLMSFAVSFVSTVFCGHLGRTELAGVSLAIAVSNVTGVSIGVGLASACDTLISQTYGSGNLQKVGVILQRAILILLLACFPCWAILINTRPILLAFRQEPEVASLAQLYVKIFMPALPAAFMFSLLSRYLQNQGIIWPQVITGFLVNLLNALINYIFLFVLKMGVAGSALANTFSQFSMAGILFGYIVCRGLHKATWGGWSKECLHDWGSYIRLAIPSMVMMCVEWWTYEIGGFLAGLISEVELGAQSIVYELANVAYMFPLGFSVAGNVRVGNALGAGETEQGKLSAKLTLFCAGLVSVGMALLIGGLKDHISYVFTYDEKIRERVSDVISFYAPFLLLDAISAACSGIIRGAGKQRVGAICNIVGYYGIGFPVGVPLMFAAKLGIKGLWTGLFTCVSLQCVFLIFYLIRMNWKDVTIEAQIR--AGACETYTE---------TSPEPEDAENY----------RCPSD--TTQLDDIDTLPAV--------SKDELAFRNLVLRRGLALALMLFILAAGIILNLLI 549          
BLAST of slc47a-5 vs. Ensembl Medaka
Match: slc47a4 (multidrug and toxin extrusion protein 1 [Source:NCBI gene;Acc:101165411])

HSP 1 Score: 207.994 bits (528), Expect = 1.124e-58
Identity = 150/554 (27.08%), Postives = 254/554 (45.85%), Query Frame = 3
Query:  138 GPLFPTTFLQFLINVTPIMFVGQLDKIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPXXXXXXXXXXXXXXFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVTCPLYVAIGICANVKIGQYLGAGQHERAKKIAQISIVAXXXXXXXXXXXXXXXREYWPLIFTTDKIVNEQVSKLIAFYPIYFVPESVNGVLSGIMRGCAKHSLTMYLAFGCMYLMGLPVAAMLGFLAQLQVFGLWIGNTVGLSTLMIGYVISVWFFNWETLALDAAHRLTRGQYEDQNEIFEKNPLLITKPKENEKVNYPNGPYQLKHNRLPSQGITSSYDLIRTKKIIVFENLRLKSKLNKNHKSIIIKRSVTLFVCLLMLFIGIIGRLSI-RPDYNRYKAFVTDSKFNST 1796
            GPL     L +L+     MF G+L    + G     + +++   + G+GL  ACDTL SQ +G  +  + G  LQ+ + I LLF  P   +L+N   +LL  GQDP +  I+ +YI+ YLPA P  Y + +   YLQNQ    P + A  L NI N    Y+ +Y        SA    ++ + + +F   Y+   K +  TW GW++ +L  W  +++LAIP      FE   +E   F AG++    +A    +     +T    + I   A  ++G  LGAG   RA   ++IS+      ++  G ++   +     IFT+D+ +   VS LI  Y      + +  V +GI  G  K  +         Y +GLP+   L F+A+L+V G WIG  + +      Y++ ++  NW+ +  +A   + R Q   +  + + + LL      N      N  + ++   +P     +   L   ++ +V +  R     N +   +I++R +T+   L +L +GII    +  P+    KA  T+   N+T
Sbjct:   54 GPLLLARILHYLLPFVVTMFCGRLGNNVMAGYGLASATLNVTSAATGFGLALACDTLVSQTFGGRNLLRVGIILQRGIIILLLFCLPCWGLLINAQAVLLCLGQDPVVARIAQLYITAYLPAVPAMYLHHLQVSYLQNQGIIMPQMYAAALANIANVATNYIFIYWLQLGVVGSAAANTLSQVYICVFLFGYIWWKKLHTTTWGGWSVESLQEWGSYMKLAIPSTLMTCFEWWVYEFGGFFAGMLSEEELAAQHAVIMVAFLTYMFPLGIQAAACARVGNALGAGDTARAILSSKISLALAGCFAIVEGIVLGSTKTVIGFIFTSDERIVGLVSHLINAYCFLQFFDGLVCVCTGIFLGTGKQKIPAVAHLIGYYCIGLPLCVTLMFVAKLRVLGFWIGLLICVILQSTFYIVVIFKLNWKKMTEEA---VKRAQKNTRMALVDADALL--DNTGNNASQASNNGHSVE-GYVPVTTENNDGKLEEPERHVVLKQRR----DNLSTSQLILRRGITVIAALGLLSVGIIVHFLVPLPETQFAKANTTEGWINTT 597          
BLAST of slc47a-5 vs. Ensembl Medaka
Match: slc47a4 (multidrug and toxin extrusion protein 1 [Source:NCBI gene;Acc:101165658])

HSP 1 Score: 194.512 bits (493), Expect = 5.338e-54
Identity = 123/430 (28.60%), Postives = 207/430 (48.14%), Query Frame = 3
Query:  138 GPLFPTTFLQFLINVTPIMFVGQLDKIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPXXXXXXXXXXXXXXFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVTCPLYVAIGICANVKIGQYLGAGQHERAKKIAQISIVAXXXXXXXXXXXXXXXREYWPLIFTTDKIVNEQVSKLIAFYPIYFVPESVNGVLSGIMRGCAKHSLTMYLAFGCMYLMGLPVAAMLGFLAQLQVFGLWIGNTVGLSTLMIGYVISVWFFNWETLALDAAHR 1427
            GPL  +  L +L+     MF G+L    + G     + I++   + GYGL  ACDTL SQ +G  +  + G  LQ+S+ I LLF  P   +L+N   +LL  GQDP +  I+ +YI+ +LPA P  + + +   YLQNQ    P +    LGN+ N    Y+ +Y  +     SA    ++ + + +F   Y+   K +  TW GW++ +L  W  +++LA+P      FE   +E   F AG+M    +A    +     +T      I   A  ++G  LGAG +  A   +++++     + +  G ++   +     IFT D+ +   VS+L+  Y      + +  V +GI  G  K  +     F   Y +GL ++  L F A+L++ G W+G  V +      Y++ ++  NWE +A +A  R
Sbjct:   34 GPLLLSRILNYLLPFVVTMFCGRLGNEVMAGYGLASATINVTTAATGYGLGLACDTLVSQTFGGKNLLRVGVILQRSIIILLLFCLPCWGLLINAHAILLCLGQDPEVARIAQLYITAFLPAVPAMFLHNLQVSYLQNQGIILPQMYTATLGNVANVVTNYILIYWLDLGVGGSAAANTLSQIYICVFLFLYIWWRKIHVKTWGGWSVESLQEWGSYMKLAVPSTLMKCFEWWVYEFGGFFAGMMSEDELAAQHAVIMVSFITYMFPFGIQAAACARVGNALGAGDNTGALLTSRVALTLAGSICVVEGLVLGSTKTVIGFIFTADERIIHLVSQLMTAYCFLQFFDGLVCVCTGIFLGAGKQKIPAVANFIGYYCLGLSLSITLMFAAKLRILGFWVGLLVCVIFQSTFYIVVIFRLNWEKIADEAVKR 463          
BLAST of slc47a-5 vs. Ensembl Medaka
Match: slc47a1 (multidrug and toxin extrusion protein 1 [Source:NCBI gene;Acc:101170536])

HSP 1 Score: 195.667 bits (496), Expect = 6.542e-54
Identity = 138/435 (31.72%), Postives = 219/435 (50.34%), Query Frame = 3
Query:  132 LFGPLFPTTFLQFLINVTPIMFVGQLDKIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPXXXXXXXXXXXXXXFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVT--CPLYVAIGICANVKIGQYLGAGQHERAKKIAQISIVAXXXXXXXXXXXXXXXREYWPLIFTTDKIVNEQVSKLIAFYPIYFVPESVNGVLSGIMRGCAKHSLTMYLAFGCMYLMGLPVAAMLGFLAQLQVFGLWIGNTVGLSTLMIGYVISVWF-FNWETLALDAAHR 1427
            L GPL  +  L F I     ++ G +  ++L G A     I++  T+ GYGL  ACDTL SQ +G  + K+ G  LQ+S  I L F  P  A+L+N ++LLLL  Q+  +  I+ +Y+  +LPA P  + + +   YLQNQ    P +    + N+FN  A YL +         SAI   ++ +++ +    Y+   K ++ TW GWT + L +W  +++LA P       E   WE   F+AG +G   +A   VL + G+++   PL ++  +C  V++G  LGAG   RA    ++++V   VLS+  G +I+  +     IFT+D  + E VS  +  Y      +S+  V SGI+ G     +         Y +GLPV A L F A L++ GLW+G  +  S +   + + V F  +W  + L A  R
Sbjct:   67 LAGPLLLSRILNFFIPFVVTIYCGHMGNVELAGYALASVTINVTTTATGYGLAVACDTLISQTFGGKNLKRVGVILQRSSLILLFFCLPCWALLINAENLLLLMKQNADVARIAQLYVMMFLPAVPAMFLHHLQVSYLQNQGIILPQMYTAGVANVFNLGANYLLISVLKLGVVGSAIANSLSQIVICLLLFGYIRWRKLHEKTWGGWTTNCLQDWGSYMKLATPSALMICLEWWVWEIGGFLAGALGEKDLAAQHVLVEIGSLSYMFPLGISAAVC--VRVGNALGAGNITRAFVACKLALVLAGVLSVVQGVVIACCKPVAGSIFTSDIDILEIVSNNLTVYIFLQFFDSILCVSSGILVGSGLQKIAALTNLVSYYCIGLPVGAALMFGAHLRILGLWLG-ILTCSCIQAAFFLVVIFKIDWNKITLKAQLR 498          
BLAST of slc47a-5 vs. Planmine SMEST
Match: SMESG000077134.1 (SMESG000077134.1)

HSP 1 Score: 1046.96 bits (2706), Expect = 0.000e+0
Identity = 540/542 (99.63%), Postives = 540/542 (99.63%), Query Frame = 3
Query:  192 MFVGQLDKIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPXXXXXXXXXXXXXXFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVTCPLYVAIGICANVKIGQYLGAGQHERAKKIAQISIVAXXXXXXXXXXXXXXXREYWPLIFTTDKIVNEQVSKLIAFYPIYFVPESVNGVLSGIMRGCAKHSLTMYLAFGCMYLMGLPVAAMLGFLAQLQVFGLWIGNTVGLSTLMIGYVISVWFFNWETLALDAAHRLTRGQYEDQNEIFEKNPLLITKPKENEKVNYPNGPYQLKHNRLPSQGITSSYDLIRTKKIIVFENLRLKSKLNKNHKSIIIKRSVTLFVCLLMLFIGIIGRLSIRPDYNRYKAFVTDSKFNSTTESMFVK 1817
            MFVGQLDKIQLDGVAF VSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPVAAVLLNVDHLLLLFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVTCPLYVAIGICANVKIGQYLGAGQHERAKKIAQISIVAVVVLSLTIGSIISIIREYWPLIFTTDKIVNEQVSKLIAFYPIYFVPESVNGVLSGIMRGCAKHSLTMYLAFGCMYLMGLPVAAMLGFLAQLQVFGLWIGNTVGLSTLMIGYVISVWFFNWETLALDAAHRLTRGQYEDQNEIFEKNPLLITKPKENEK NYPNGPYQLKHNRLPSQGITSSYDLIRTKKIIVFENLRLKSKLNKNHKSIIIKRSVTLFVCLLMLFIGIIGRLSIRPDYNRYKAFVTDSKFNSTTESMFVK
Sbjct:    1 MFVGQLDKIQLDGVAFAVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPVAAVLLNVDHLLLLFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVTCPLYVAIGICANVKIGQYLGAGQHERAKKIAQISIVAVVVLSLTIGSIISIIREYWPLIFTTDKIVNEQVSKLIAFYPIYFVPESVNGVLSGIMRGCAKHSLTMYLAFGCMYLMGLPVAAMLGFLAQLQVFGLWIGNTVGLSTLMIGYVISVWFFNWETLALDAAHRLTRGQYEDQNEIFEKNPLLITKPKENEKANYPNGPYQLKHNRLPSQGITSSYDLIRTKKIIVFENLRLKSKLNKNHKSIIIKRSVTLFVCLLMLFIGIIGRLSIRPDYNRYKAFVTDSKFNSTTESMFVK 542          
BLAST of slc47a-5 vs. Planmine SMEST
Match: SMESG000028980.1 (SMESG000028980.1)

HSP 1 Score: 280.411 bits (716), Expect = 3.503e-86
Identity = 177/559 (31.66%), Postives = 298/559 (53.31%), Query Frame = 3
Query:   75 LKEKLLKSEYPKLCRALIILFG---PLFPTTFLQFLINVTPIMFVGQLDKIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPXXXXXXXXXXXXXXFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVTCPLYVAIGICANVKIGQYLGAGQHERAKKIAQISIVAXXXXXXXXXXXXXXXREYWPLIFTTDKIVNEQVSKLIAFYPIYFVPESVNGVLSGIMRGCAKHSLTMYLAFGCMYLMGLPVAAMLGFLAQLQVFGLWIGNTVGLSTLM-IGYVISVWFFNWETLALDAAHRLTRGQYEDQNEIFEKNPLLITKPKENEKVNYPNGPYQLKHNRLPSQGITSSY--DLIRTKKIIVFENLRLKSKLNKNHKSIIIKRSVTLFVCLLMLFIGIIGRL 1733
            L+ +  K  + ++ + L++L     P+  T    FLI    I+  G + K +LD  A   SVI++ G +V  GL  ACDTLFSQ YGS  +K  G  L KS  I  +FP  + A+ +N++ L +L GQD  + + ++ Y+  + P     +++ IL+RY+QNQ+K  PP++  ++ NIFN  +QYL +Y F   +  SAIC  IT+L+     L Y++ +K Y+ TW GWT      W  F +LAIPG A    E   +E    ++G+MG + MA  SVL Q  T+T  +   +GI  N+++GQYLG+G+ ++A K+ +  ++ ++   +   S+I   ++Y PL+FT D    +  S+L+         ++   V  G +RGC +  + + L F   YL+G P+   L F+AQL+V GLWIG  V L+  + I  + + +  +W+  A     R+   +++ +NE F KN  + ++    +++ Y    ++  H R  S+  + S   +++ TK + V E         K +    I + +  F  L +L +GI+ +L
Sbjct:   19 LEHEHEKFSFKQMRKELLLLVKIAIPIILTNLCGFLILTESIIIAGHISKYELDACALANSVINVAGIAVATGLCTACDTLFSQMYGSKHRKAIGAMLIKSTMIITIFPILLIALHINMEPLFILMGQDKIVAKDAARYMVIFSPGLLFGFYFLILTRYMQNQNKVLPPMIIGIIVNIFNVVSQYLTVYYFKLGFDFSAICQAITFLLFWALELAYILIAKLYEETWDGWTRDVFLEWGLFTKLAIPGAAMVIMECFCFEIGTLLSGVMGPLEMAAQSVLFQLETITFMISFGVGISVNIRVGQYLGSGKPQQALKVYRYGLLVMMSSFVLTSSLILGFKDYLPLVFTNDGEAQKLSSELLPILVGVQFFDAFGTVTMGALRGCGRQKICVLLIFCSFYLLGQPIGISLAFVAQLKVQGLWIGLLVSLAICVPIAVIYTNFIQDWQHQANLCQKRIAEARHQQENEEF-KNETIESRRNSFQQLEY----FKASHRRSISKSFSVSVPGNIMVTKYVEVTE---------KTYTKAYITKFIIFFSTLCVLIMGILVKL 563          
BLAST of slc47a-5 vs. Planmine SMEST
Match: SMESG000045551.1 (SMESG000045551.1)

HSP 1 Score: 276.174 bits (705), Expect = 1.299e-84
Identity = 167/535 (31.21%), Postives = 283/535 (52.90%), Query Frame = 3
Query:  141 PLFPTTFLQFLINVTPIMFVGQLDKIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPXXXXXXXXXXXXXXFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVTCPLYVAIGICANVKIGQYLGAGQHERAKKIAQISIVAXXXXXXXXXXXXXXXREYWPLIFTTDKIVNEQVSKLIAFYPIYFVPESVNGVLSGIMRGCAKHSLTMYLAFGCMYLMGLPVAAMLGFLAQLQVFGLWIGNTVG--LSTLMIGYVISVWFFNWETLALDAAHRLTRGQYEDQNEIFEKNPLLITKPKENE------KVNYPNGPYQLKHNRLPSQGITSSYDLIRTKKIIVFENLRLKSKLNKNHKSIIIKRSVTLFVCLLMLFIGI 1721
            P+  T   Q+ +N+    F G+L  ++L+GV  G+S++  FG  V  G+  ACDT+FSQ++GS +KK+TG +LQ++  +  L P  + A  +N + +L+L GQDP I  ++  ++  + P       Y I++RY+Q+Q   WP ++A   GNIFN  +Q L +      ++++A C   ++ IM +    Y+  SKFY+ TWPG+ + A  +W +   L + G+ + TFE I WEA +FM G++G V +A  S++ Q  T+T  +Y   GI +N+++GQ LGA +  +AK   +   V   + ++ +G++I I+R   PL+FT  + V +++ K++ F  I    +  +GV S  +RGC +      + F   Y++ LP + +LGF+  + + G+WIGNT+G  +S   IG ++     +W+  A  A  R+             +  + ITK  E E       + + +      H R PS  +T S  ++             K K+N + +SII KR +      L L  GI
Sbjct:   47 PVLITNVFQYALNIETTSFCGRLTSMELEGVGLGLSLLSAFGWCVCSGMISACDTMFSQSFGSDNKKRTGLFLQRAFLLMNLIPVFLWAWHINAEPILILLGQDPEISRVAGEFLICFTPGLTFMVNYLIMARYMQDQGCLWPAVIAGFCGNIFNICSQLLFVSYLQLGFKAAAFCHASSFGIMVLIEAIYIFKSKFYEATWPGFQLEAFADWGNLFMLGLAGVGHVTFEVIIWEASVFMGGLIGNVELATQSIMLQILTLTFMMYYGAGIASNIRVGQCLGANRPNQAKLAYRAGTVNTAIATIVLGTLIIILRNQIPLVFTNKQDVIDEIQKVMPFMFILMYCDPFSGVFSATLRGCGRQVAGCIIVFVSFYILSLPSSIILGFVFNMSIQGIWIGNTIGSVVSVTTIGILLECQ--DWKHQAHLAQRRI-------------QGNITITKTVETEYLIKSFHLGFEHENKSPSHIRTPSHPVTCSTAIVELP----------KPKINVD-RSIIWKRIIIAGCVFLFLLCGI 555          
BLAST of slc47a-5 vs. Planmine SMEST
Match: SMESG000045551.1 (SMESG000045551.1)

HSP 1 Score: 275.404 bits (703), Expect = 1.675e-84
Identity = 169/533 (31.71%), Postives = 278/533 (52.16%), Query Frame = 3
Query:  141 PLFPTTFLQFLINVTPIMFVGQLDKIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPXXXXXXXXXXXXXXFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVTCPLYVAIGICANVKIGQYLGAGQHERAKKIAQISIVAXXXXXXXXXXXXXXXREYWPLIFTTDKIVNEQVSKLIAFYPIYFVPESVNGVLSGIMRGCAKHSLTMYLAFGCMYLMGLPVAAMLGFLAQLQVFGLWIGNTVGLSTLMIGYVISVWFFNWETLALDAAHRLTRGQYEDQNEIFEKNPLLITKPKENE------KVNYPNGPYQLKHNRLPSQGITSSYDLIRTKKIIVFENLRLKSKLNKNHKSIIIKRSVTLFVCLLMLFIGI 1721
            P+  T   Q+ +N+    F G+L  ++L+GV  G+S++  FG  V  G+  ACDT+FSQ++GS +KK+TG +LQ++  +  L P  + A  +N + +L+L GQDP I  ++  ++  + P       Y I++RY+Q+Q   WP ++A   GNIFN  +Q L +      ++++A C   ++ IM +    Y+  SKFY+ TWPG+ + A  +W +   L + G+ + TFE I WEA +FM G++G V +A  S++ Q  T+T  +Y   GI +N+++GQ LGA +  +AK   +   V   + ++ +G++I I+R   PL+FT  + V +++ K++ F  I    +  +GV S  +RGC +      + F   Y++ LP + +LGF+  + + G+WIGNT       IG V+SV          D  H+    Q   Q  I       ITK  E E       + + +      H R PS  +T S  ++             K K+N + +SII KR +      L L  GI
Sbjct:   42 PVLITNVFQYALNIETTSFCGRLTSMELEGVGLGLSLLSAFGWCVCSGMISACDTMFSQSFGSDNKKRTGLFLQRAFLLMNLIPVFLWAWHINAEPILILLGQDPEISRVAGEFLICFTPGLTFMVNYLIMARYMQDQGCLWPAVIAGFCGNIFNICSQLLFVSYLQLGFKAAAFCHASSFGIMVLIEAIYIFKSKFYEATWPGFQLEAFADWGNLFMLGLAGVGHVTFEVIIWEASVFMGGLIGNVELATQSIMLQILTLTFMMYYGAGIASNIRVGQCLGANRPNQAKLAYRAGTVNTAIATIVLGTLIIILRNQIPLVFTNKQDVIDEIQKVMPFMFILMYCDPFSGVFSATLRGCGRQVAGCIIVFVSFYILSLPSSIILGFVFNMSIQGIWIGNT-------IGSVVSVTTIGILLECQDWKHQAHLAQRRIQGNI------TITKTVETEYLIKSFHLGFEHENKSPSHIRTPSHPVTCSTAIVELP----------KPKINVD-RSIIWKRIIIAGCVFLFLLCGI 550          
BLAST of slc47a-5 vs. Planmine SMEST
Match: SMESG000033095.1 (SMESG000033095.1)

HSP 1 Score: 267.7 bits (683), Expect = 2.432e-81
Identity = 169/547 (30.90%), Postives = 290/547 (53.02%), Query Frame = 3
Query:  141 PLFPTTFLQFLINVTPIMFVGQLDKIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQKSLCISLLFPFPXXXXXXXXXXXXXXFGQDPRICEISSIYISTYLPAFPVQYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSAICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGIAYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVTCPLYVAIGICANVKIGQYLGAGQHERAKKIAQISIVAXXXXXXXXXXXXXXXREYWPLIFTTDKIVNEQVSKLIAFYPIYFVPESVNGVLSGIMRGCAKHSLTMYLAFGCMYLMGLPVAAMLGFLAQLQVFGLWIGNTVGLSTLMIGYVISVWFFNWETLALDAAHRLTRGQYEDQNEIFEKNPLLITKPKENEKVNYPNGPYQLKHNRLPSQGITSSYDLIRTKKIIVFENLRLKSKLNKNHKSIIIKRSVTLFVC-LLMLFIGIIGRLSIRPDYNRYKAFVTD 1778
            P+  T   Q+ + +    F G+L   +L+GV   +S++   G  +  G+  ACDT+F+Q++GS DKK+TG +LQ+ L ++ L P  + ++ +N++ LL+L GQD +I  ++  +++ + P       Y +L+RY+Q+Q   WPP++A + GN+FN   Q L +    F ++S+A+C   ++ IM +    Y+  SKFY  TWPG+ + A Y+W   L+L + G+ + TFE + WEA +FM G++G V +A  S++ Q   ++  LY   GI +N+++GQ LGA +  +AK+  +  I    + ++ + + I ++R   PL+FT  K V E     + +  +    +  +GV SG +RGCA+      + F   Y++ LPV+ +  F+  L V G+WIG T G    +    + +   +W+  A  A  R+     + +N+  EK  L+ +   +N   N P+      H R PS  I  S +        +F+    ++ L    KSII KR V +F C +L L  GI   L +  +  R   F  +
Sbjct:   59 PVMITNIFQYSLTIETTSFAGRLTATELEGVGLALSLVGALGWCICTGMVSACDTMFAQSFGSTDKKRTGLFLQRGLLLTNLIPIFLWSLHINLEPLLILCGQDRQISRVAGEFMTCFTPGITFMMNYLLLARYMQDQGCLWPPVIAGICGNVFNICFQLLFVTYLQFGFKSAALCHAFSFGIMTLVEALYIWKSKFYLNTWPGFQLEAFYDWFPMLKLGLAGMGHTTFEVLVWEASVFMGGLLGTVQVATQSIMIQILYISFMLYYGCGIASNIRVGQCLGANRPNQAKQAYRAGIFNTAISTIILATSIILLRYQIPLVFTNKKEVLEMTIDTMPYIFVILYCDPFSGVCSGTLRGCARQLSGCMIIFVSFYMISLPVSIVASFVYDLGVKGIWIGPTCGCIVAVSSIFLLLECQDWKNQAYLAQRRIFSKLADIENDETEK--LIYSLEIDNIAENGPD-----SHIRTPSHPIMCSTE--------IFDTSAPRTNL---EKSIIWKR-VAIFGCAILFLLCGIFIHLFVPLELYRGTNFTLN 586          
The following BLAST results are available for this feature:
BLAST of slc47a-5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC47A12.436e-6930.20solute carrier family 47 member 1 [Source:HGNC Sym... [more]
SLC47A17.124e-6930.20solute carrier family 47 member 1 [Source:HGNC Sym... [more]
SLC47A22.612e-6530.07solute carrier family 47 member 2 [Source:HGNC Sym... [more]
SLC47A22.327e-6028.94solute carrier family 47 member 2 [Source:HGNC Sym... [more]
SLC47A22.429e-5236.54solute carrier family 47 member 2 [Source:HGNC Sym... [more]
back to top
BLAST of slc47a-5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc47a-5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc47a-5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc47a2.14.157e-7029.06solute carrier family 47 member 2.1 [Source:NCBI g... [more]
BX248108.14.627e-6929.06multidrug and toxin extrusion protein 1-like [Sour... [more]
slc47a31.762e-6630.43solute carrier family 47 member 3 [Source:ZFIN;Acc... [more]
slc47a45.084e-6128.57solute carrier family 47 member 4 [Source:ZFIN;Acc... [more]
slc47a39.032e-5530.29solute carrier family 47 member 3 [Source:ZFIN;Acc... [more]
back to top
BLAST of slc47a-5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmed67.004e-6429.25transmembrane p24 trafficking protein 6 [Source:Xe... [more]
slc47a23.661e-5426.75solute carrier family 47 (multidrug and toxin extr... [more]
ccdc85a2.640e-4029.57coiled-coil domain containing 85A [Source:Xenbase;... [more]
ccdc85a2.851e-3929.44coiled-coil domain containing 85A [Source:Xenbase;... [more]
tysnd12.851e-2540.91trypsin domain containing 1 [Source:Xenbase;Acc:XB... [more]
back to top
BLAST of slc47a-5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc47a13.321e-7132.51solute carrier family 47, member 1 [Source:MGI Sym... [more]
Slc47a26.544e-6129.82solute carrier family 47, member 2 [Source:MGI Sym... [more]
Slc47a29.953e-6129.77solute carrier family 47, member 2 [Source:MGI Sym... [more]
Slc47a14.440e-4137.85solute carrier family 47, member 1 [Source:MGI Sym... [more]
Slc47a18.053e-2941.61solute carrier family 47, member 1 [Source:MGI Sym... [more]
back to top
BLAST of slc47a-5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5RFD2|S47A1_PONAB1.388e-7030.69Multidrug and toxin extrusion protein 1 OS=Pongo a... [more]
sp|Q8K0H1|S47A1_MOUSE2.323e-7032.51Multidrug and toxin extrusion protein 1 OS=Mus mus... [more]
sp|A1L1P9|S47A1_DANRE3.138e-6929.06Multidrug and toxin extrusion protein 1 OS=Danio r... [more]
sp|Q5I0E9|S47A1_RAT5.512e-6932.93Multidrug and toxin extrusion protein 1 OS=Rattus ... [more]
sp|Q96FL8|S47A1_HUMAN1.170e-6830.20Multidrug and toxin extrusion protein 1 OS=Homo sa... [more]
back to top
BLAST of slc47a-5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YFP00.000e+0100.00Multidrug and toxin extrusion protein OS=Schmidtea... [more]
A0A267DC311.672e-8330.69Multidrug and toxin extrusion protein OS=Macrostom... [more]
A0A267ETL61.781e-8330.69Multidrug and toxin extrusion protein OS=Macrostom... [more]
A0A0H3YJN61.259e-8231.66Multidrug and toxin extrusion protein OS=Schmidtea... [more]
A0A267DNE91.398e-8231.22Multidrug and toxin extrusion protein OS=Macrostom... [more]
back to top
BLAST of slc47a-5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc47a2.12.113e-6928.28solute carrier family 47 member 1 [Source:NCBI gen... [more]
slc47a43.520e-6529.34multidrug and toxin extrusion protein 1-like [Sour... [more]
slc47a42.120e-6429.41multidrug and toxin extrusion protein 1-like [Sour... [more]
slc47a32.856e-6227.15multidrug and toxin extrusion protein 1-like [Sour... [more]
slc47a33.507e-6228.67multidrug and toxin extrusion protein 1-like [Sour... [more]
back to top
BLAST of slc47a-5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc47a-5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
YDR338C_mRNA1.170e-2123.41Putative protein of unknown function; member of th... [more]
ERC11.396e-1722.25Member of the multi-drug and toxin extrusion (MATE... [more]
back to top
BLAST of slc47a-5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO464743.329e-4527.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc47a-5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000002449.25.773e-7431.02multidrug and toxin extrusion protein 1 [Source:NC... [more]
slc47a37.549e-7328.96multidrug and toxin extrusion protein 1 [Source:NC... [more]
slc47a41.124e-5827.08multidrug and toxin extrusion protein 1 [Source:NC... [more]
slc47a45.338e-5428.60multidrug and toxin extrusion protein 1 [Source:NC... [more]
slc47a16.542e-5431.72multidrug and toxin extrusion protein 1 [Source:NC... [more]
back to top
BLAST of slc47a-5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000077134.10.000e+099.63SMESG000077134.1[more]
SMESG000028980.13.503e-8631.66SMESG000028980.1[more]
SMESG000045551.11.299e-8431.21SMESG000045551.1[more]
SMESG000045551.11.675e-8431.71SMESG000045551.1[more]
SMESG000033095.12.432e-8130.90SMESG000033095.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30022038
GenBankAKN21702.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022038 ID=SMED30022038|Name=slc47a-5|organism=Schmidtea mediterranea sexual|type=transcript|length=1835bp
AGGAATATTATGAAGAAATGACTATAATTATAATCAGTGAAATTTCAATC
ATATAATTTAATATGATAATTGGATTAAAAGAAAAACTTTTGAAAAGTGA
ATATCCGAAATTATGTAGGGCTTTAATCATTTTATTTGGTCCTTTGTTTC
CCACGACGTTCCTGCAATTTTTGATTAATGTCACGCCAATTATGTTTGTT
GGACAGCTAGACAAAATCCAATTGGACGGAGTGGCTTTTGGCGTTAGCGT
CATCCATATTTTCGGTACTAGCGTTGGATACGGATTAACTTATGCTTGCG
ATACTTTATTTTCACAGGCTTATGGAAGTGCTGACAAAAAGAAAACGGGA
TTTTATTTACAGAAAAGTCTTTGCATTTCCTTATTATTTCCATTCCCCGT
CGCCGCGGTTCTTCTAAATGTCGATCATTTGCTCCTATTGTTTGGGCAAG
ATCCAAGAATATGCGAAATCAGCTCAATTTACATTTCAACATATTTGCCA
GCGTTTCCGGTGCAATATTTTTATTTCATTTTGTCTCGATATTTGCAAAA
TCAGGATAAAACATGGCCACCATTAGTTGCAGTTCTTTTGGGAAATATAT
TCAATTTCACAGCTCAATATTTATGTTTATACAAATTTAATTTCACTTAC
CAGTCTTCAGCAATTTGCATGATTATCACATATTTGATCATGGCCATTTT
CAATTTAACTTACTTAATTACAAGTAAATTTTACAAGCCGACATGGCCAG
GATGGACGATTTCAGCTTTGTACAATTGGGATGACTTCTTAAGACTAGCA
ATTCCTGGAATCGCTTATGCCACATTTGAACAAATAAATTGGGAAGCTGA
AATTTTTATGGCAGGAATCATGGGAATTGTACCAATGGCAGTTCATTCTG
TTTTATCCCAAACCGGAACTGTTACGTGTCCTCTTTATGTGGCTATTGGT
ATTTGTGCTAATGTAAAAATAGGACAATATCTTGGAGCTGGGCAGCATGA
AAGAGCCAAGAAAATAGCACAAATATCTATTGTTGCAGTCGTGGTTTTGT
CACTTACAATCGGTTCCATTATATCAATAATAAGGGAATATTGGCCTCTC
ATATTTACTACAGATAAGATTGTTAATGAACAAGTGTCCAAATTAATTGC
TTTTTATCCAATTTATTTTGTTCCGGAATCTGTAAATGGAGTTCTATCTG
GCATAATGAGAGGATGCGCGAAGCATTCGCTCACCATGTACTTGGCATTT
GGATGCATGTATTTAATGGGCCTACCCGTTGCAGCAATGCTTGGATTCCT
AGCCCAACTACAGGTTTTCGGTCTGTGGATCGGCAATACTGTCGGACTAT
CAACCCTCATGATAGGGTATGTGATTTCTGTTTGGTTTTTCAACTGGGAA
ACATTGGCTTTAGATGCTGCTCATCGTCTCACTCGTGGCCAATATGAGGA
TCAAAATGAAATTTTTGAAAAAAATCCTTTATTAATTACCAAGCCTAAGG
AGAATGAAAAGGTTAATTATCCCAACGGGCCTTACCAGTTAAAGCACAAC
AGATTGCCCAGTCAGGGAATCACGAGCAGCTACGACTTGATCCGAACAAA
AAAAATTATTGTATTTGAAAATCTGAGATTGAAATCGAAGTTAAACAAAA
ATCACAAATCCATAATAATTAAACGATCAGTTACTTTGTTTGTTTGTTTG
TTGATGTTGTTTATTGGAATTATTGGGCGTCTGTCCATTCGACCAGACTA
TAACAGGTACAAGGCTTTTGTAACTGACTCGAAATTCAATTCTACCACAG
AATCTATGTTTGTAAAATAAAGTGTTTTGATAAAA
back to top

protein sequence of SMED30022038-orf-1

>SMED30022038-orf-1 ID=SMED30022038-orf-1|Name=SMED30022038-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=586bp
MIIGLKEKLLKSEYPKLCRALIILFGPLFPTTFLQFLINVTPIMFVGQLD
KIQLDGVAFGVSVIHIFGTSVGYGLTYACDTLFSQAYGSADKKKTGFYLQ
KSLCISLLFPFPVAAVLLNVDHLLLLFGQDPRICEISSIYISTYLPAFPV
QYFYFILSRYLQNQDKTWPPLVAVLLGNIFNFTAQYLCLYKFNFTYQSSA
ICMIITYLIMAIFNLTYLITSKFYKPTWPGWTISALYNWDDFLRLAIPGI
AYATFEQINWEAEIFMAGIMGIVPMAVHSVLSQTGTVTCPLYVAIGICAN
VKIGQYLGAGQHERAKKIAQISIVAVVVLSLTIGSIISIIREYWPLIFTT
DKIVNEQVSKLIAFYPIYFVPESVNGVLSGIMRGCAKHSLTMYLAFGCMY
LMGLPVAAMLGFLAQLQVFGLWIGNTVGLSTLMIGYVISVWFFNWETLAL
DAAHRLTRGQYEDQNEIFEKNPLLITKPKENEKVNYPNGPYQLKHNRLPS
QGITSSYDLIRTKKIIVFENLRLKSKLNKNHKSIIIKRSVTLFVCLLMLF
IGIIGRLSIRPDYNRYKAFVTDSKFNSTTESMFVK*
back to top
Aliases
The feature 'slc47a-5' has the following synonyms
Synonym
slc47a-5
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0042908xenobiotic transport
GO:0055085transmembrane transport
GO:0006855drug transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0042910xenobiotic transporter activity
GO:0015238drug transmembrane transporter activity
GO:0015297antiporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000421tail
Vocabulary: INTERPRO
TermDefinition
IPR002528MATE_fam
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002528Multi antimicrobial extrusion proteinTIGRFAMTIGR00797TIGR00797coord: 28..422
e-value: 5.8E-58
score: 194.6
IPR002528Multi antimicrobial extrusion proteinPFAMPF01554MatEcoord: 264..408
e-value: 3.2E-21
score: 75.7
coord: 27..187
e-value: 2.7E-29
score: 101.9
NoneNo IPR availablePANTHERPTHR11206MULTIDRUG RESISTANCE PROTEINcoord: 9..473
NoneNo IPR availablePANTHERPTHR11206:SF81MULTIDRUG AND TOXIN EXTRUSION PROTEIN 2coord: 9..473
NoneNo IPR availableCDDcd13132MATE_eukaryoticcoord: 18..446
e-value: 2.52864E-105
score: 322.215
NoneNo IPR availableTMHMMTMhelixcoord: 21..43
NoneNo IPR availableTMHMMTMhelixcoord: 102..124
NoneNo IPR availableTMHMMTMhelixcoord: 361..382
NoneNo IPR availableTMHMMTMhelixcoord: 540..559
NoneNo IPR availableTMHMMTMhelixcoord: 139..161
NoneNo IPR availableTMHMMTMhelixcoord: 318..340
NoneNo IPR availableTMHMMTMhelixcoord: 58..77
NoneNo IPR availableTMHMMTMhelixcoord: 421..443
NoneNo IPR availableTMHMMTMhelixcoord: 392..414
NoneNo IPR availableTMHMMTMhelixcoord: 197..219
NoneNo IPR availableTMHMMTMhelixcoord: 168..187
NoneNo IPR availableTMHMMTMhelixcoord: 276..298