Dihydroorotate dehydrogenase (Quinone), mitochondrial

Overview
NameDihydroorotate dehydrogenase (Quinone), mitochondrial
Smed IDSMED30022035
Length (bp)1371
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dihydroorotate dehydrogenase (Quinone), mitochondrial (SMED30022035) t-SNE clustered cells

Violin plots show distribution of expression levels for Dihydroorotate dehydrogenase (Quinone), mitochondrial (SMED30022035) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dihydroorotate dehydrogenase (Quinone), mitochondrial (SMED30022035) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dihydroorotate dehydrogenase (Quinone), mitochondrial (SMED30022035) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022035

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30022035SMESG000065729.1 SmedASXL_009893SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30022035SMESG000065729.1 SmedASXL_009893SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30022035SMESG000065729.1 dd_Smed_v4_4266_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30022035SMESG000065729.1 dd_Smed_v4_4266_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30022035SMESG000065729.1 dd_Smed_v4_4266_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dihydroorotate dehydrogenase (Quinone), mitochondrial vs. Ensembl Human
Match: DHODH (dihydroorotate dehydrogenase (quinone) [Source:HGNC Symbol;Acc:HGNC:2867])

HSP 1 Score: 328.176 bits (840), Expect = 1.459e-108
Identity = 188/380 (49.47%), Postives = 246/380 (64.74%), Query Frame = 3
Query:  192 KNSLSMIGMSFCMFSGYCIYEGNEKFYYKILLPTSHLILSPEIAHKFAVFMGKHNLFPKFSNSSYPDLSVKLFGLQFSHPVGIAAGFDKQGEAILGLLNAGFSHVEVGSVTPEPQAGNICPRVFRLVNDEAVINRYGFNSDGHRVVRDRLSNIDWKGKGV------VGVNLGINKHTNDPAGDYVTGVERFGEICDYLVINVSSPNTEGLRLLQKENQLRETLNRVMKARDALPR--KTPILLKISPDETDEDVKNIVKVSLEQNIDGFIVCNTSNSRDGLLSSAELVAETGGLSGKPLRDKSTELISRISTLTNGRVPXXXXXXXXXXKDAWLKLMAGASLIQLYTSMVFYGPPIVKKVTRELDEEMRNSEFSNLHEFL 1307
            ++++ ++G    +F+ Y +  G+E+FY + L+PT   +L PE AH+ AV      L P+        L V++ G +F +PVGIAAGFDK GEA+ GL   GF  VE+GSVTP+PQ GN  PRVFRL  D+AVINRYGFNS G  VV  RL     K   +      +GVNLG NK + D A DY  GV   G + DYLV+NVSSPNT GLR LQ + +LR  L +V++ RD L R  +  +L+KI+PD T +D ++I  V  E  IDG IV NT+ SR   L  A L +ETGGLSGKPLRD ST+ I  +  LT GRVPIIGVGGVSSG+DA  K+ AGASL+QLYT++ F+GPP+V KV REL+  ++   F  + + +
Sbjct:   11 QDAVIILGGGGLLFASYLMATGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGA-LRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAI 389          
BLAST of Dihydroorotate dehydrogenase (Quinone), mitochondrial vs. Ensembl Human
Match: DHODH (dihydroorotate dehydrogenase (quinone) [Source:HGNC Symbol;Acc:HGNC:2867])

HSP 1 Score: 318.546 bits (815), Expect = 6.940e-105
Identity = 186/380 (48.95%), Postives = 245/380 (64.47%), Query Frame = 3
Query:  192 KNSLSMIGMSFCMFSGYCIYEGNEKFYYKILLPTSHLILSPEIAHKFAVFMGKHNLFPKFSNSSYPDLSVKLFGLQFSHPVGIAAGFDKQGEAILGLLNAGFSHVEVGSVTPEPQAGNICPRVFRLVNDEAVINRYGFNSDGHRVVRDRLSNIDWKGKGV------VGVNLGINKHTNDPAGDYVTGVERFGEICDYLVINVSSPNTEGLRLLQKENQLRETLNRVMKARDALPR--KTPILLKISPDETDEDVKNIVKVSLEQNIDGFIVCNTSNSRDGLLSSAELVAETGGLSGKPLRDKSTELISRISTLTNGRVPXXXXXXXXXXKDAWLKLMAGASLIQLYTSMVFYGPPIVKKVTRELDEEMRNSEFSNLHEFL 1307
            ++++ ++G    +F+ Y +  G+E+FY + L+PT   +L PE AH+ AV      L P+        L V++ G +F +PVGIAAGFDK GEA+ GL   GF  VE+GSVTP+PQ GN  PRVFRL  D+AVINRYGFNS G  VV  RL     K   +      +GVNLG NK + D A DY  GV   G + DYLV+NVSSPNT GLR LQ + +LR  L +V++ RD L R  +  +L+KI+PD T +D ++I  V  E  IDG IV NT+ SR   L  A L +ETGGLSGKPLRD ST+ I  +  LT  +VPIIGVGGVSSG+DA  K+ AGASL+QLYT++ F+GPP+V KV REL+  ++   F  + + +
Sbjct:   11 QDAVIILGGGGLLFASYLMATGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGA-LRSETGGLSGKPLRDLSTQTIREMYALT--QVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAI 387          
BLAST of Dihydroorotate dehydrogenase (Quinone), mitochondrial vs. Ensembl Human
Match: DHODH (dihydroorotate dehydrogenase (quinone) [Source:HGNC Symbol;Acc:HGNC:2867])

HSP 1 Score: 145.591 bits (366), Expect = 9.711e-41
Identity = 74/156 (47.44%), Postives = 98/156 (62.82%), Query Frame = 3
Query:  192 KNSLSMIGMSFCMFSGYCIYEGNEKFYYKILLPTSHLILSPEIAHKFAVFMGKHNLFPKFSNSSYPDLSVKLFGLQFSHPVGIAAGFDKQGEAILGLLNAGFSHVEVGSVTPEPQAGNICPRVFRLVNDEAVINRYGFNSDGHRVVRDRLSNIDWK 659
            ++++ ++G    +F+ Y +  G+E+FY + L+PT   +L PE AH+ AV      L P+        L V++ G +F +PVGIAAGFDK GEA+ GL   GF  VE+GSVTP+PQ GN  PRVFRL  D+AVINRYGFNS G  VV  RL     K
Sbjct:   10 QDAVIILGGGGLLFASYLMATGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQK 165          
BLAST of Dihydroorotate dehydrogenase (Quinone), mitochondrial vs. Ensembl Human
Match: DHODH (dihydroorotate dehydrogenase (quinone) [Source:HGNC Symbol;Acc:HGNC:2867])

HSP 1 Score: 137.117 bits (344), Expect = 3.369e-38
Identity = 71/135 (52.59%), Postives = 86/135 (63.70%), Query Frame = 3
Query:  255 GNEKFYYKILLPTSHLILSPEIAHKFAVFMGKHNLFPKFSNSSYPDLSVKLFGLQFSHPVGIAAGFDKQGEAILGLLNAGFSHVEVGSVTPEPQAGNICPRVFRLVNDEAVINRYGFNSDGHRVVRDRLSNIDWK 659
            G+E+FY + L+PT   +L PE AH+ AV      L P+        L V++ G +F +PVGIAAGFDK GEA+ GL   GF  VE+GSVTP+PQ GN  PRVFRL  D+AVINRYGFNS G  VV  RL     K
Sbjct:    4 GDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQK 138          
BLAST of Dihydroorotate dehydrogenase (Quinone), mitochondrial vs. Ensembl Celegans
Match: dhod-1 (Dihydroorotate dehydrogenase (quinone), mitochondrial [Source:UniProtKB/TrEMBL;Acc:O01815])

HSP 1 Score: 295.049 bits (754), Expect = 6.334e-96
Identity = 177/394 (44.92%), Postives = 247/394 (62.69%), Query Frame = 3
Query:  180 GAQLKNSLSMIGMSFCMFSGYCIYEGNEKFYYKILLPTSHLILSPEIAHKFAVFMGKHNLFPKF--SNSSYPDLSVKLFGLQFSHPVGIAAGFDKQGEAILGLL-NAGFSHVEVGSVTPEPQAGNICPRVFRLVNDEAVINRYGFNSDG----HRVVRDRLSNIDWKGKGVVGVNLGINKHTNDPAGDYVTGVERFGEICDYLVINVSSPNTEGLRLLQKENQLRETLNRVMKARD--ALPRKTPILLKISPDETDEDVKNIVKVSLEQN--IDGFIVCNTSNSRDGLLSSAELVAETGGLSGKPLRDKSTELISRISTLTNGRVPXXXXXXXXXXKDAWLKLMAGASLIQLYTSMVFYGPPIVKKVTRELDEEMRNSEFSNLHEFLWKRNLEK 1328
            GA  K+++ ++      ++   +  G+E FY K ++P  H  +  E +H++AV      L P+F  +   YP+L  +LFG +F +P+G+AAGFDK G+AI  L  N+GF  +E+GSVTP PQ GN  PRVFRL+ DE VINRYGFNSDG    H+ VR    +   +     GVNLG NK T D   DY  GV  F   CDYLV+NVSSPNT GLR +QK++ L + L  V +A +   L ++  + LKI+PD  + ++K+I +V   +   IDG IV NT+ +R   L S E   ETGGLSG P+R+ STE + +I  LTNG++PIIG GGV SG DA+ K+ AGASL+QLY++ V+ G P++ K+ REL E +R   FS++ E +   + EK
Sbjct:   17 GAISKSTVIVLATGIASYTALELLYGSETFYKKAVMPMVHKFVDGEDSHRWAVRAASWGLLPRFGWNRKEYPELKCELFGREFKNPIGLAAGFDKDGQAITQLAKNSGFGLIEIGSVTPIPQPGNNRPRVFRLLEDEGVINRYGFNSDGVGRVHQRVRSARDSWVPESYAYFGVNLGKNKLTEDAKLDYEIGVNYFAPHCDYLVLNVSSPNTPGLRSMQKKSDLEKLLAYVHQALEMHKLEKQPQVFLKIAPDLIESELKDIAQVVTNKKFAIDGIIVSNTTIARPDYLRS-ENKTETGGLSGAPVREISTECVRKIYKLTNGQIPIIGCGGVFSGADAYEKIRAGASLVQLYSAFVYEGFPVIGKIKRELVELLRKDGFSHVSEAIGADHREK 409          
BLAST of Dihydroorotate dehydrogenase (Quinone), mitochondrial vs. Ensembl Celegans
Match: dhod-1 (Dihydroorotate dehydrogenase (quinone), mitochondrial [Source:UniProtKB/TrEMBL;Acc:O01815])

HSP 1 Score: 295.049 bits (754), Expect = 6.334e-96
Identity = 177/394 (44.92%), Postives = 247/394 (62.69%), Query Frame = 3
Query:  180 GAQLKNSLSMIGMSFCMFSGYCIYEGNEKFYYKILLPTSHLILSPEIAHKFAVFMGKHNLFPKF--SNSSYPDLSVKLFGLQFSHPVGIAAGFDKQGEAILGLL-NAGFSHVEVGSVTPEPQAGNICPRVFRLVNDEAVINRYGFNSDG----HRVVRDRLSNIDWKGKGVVGVNLGINKHTNDPAGDYVTGVERFGEICDYLVINVSSPNTEGLRLLQKENQLRETLNRVMKARD--ALPRKTPILLKISPDETDEDVKNIVKVSLEQN--IDGFIVCNTSNSRDGLLSSAELVAETGGLSGKPLRDKSTELISRISTLTNGRVPXXXXXXXXXXKDAWLKLMAGASLIQLYTSMVFYGPPIVKKVTRELDEEMRNSEFSNLHEFLWKRNLEK 1328
            GA  K+++ ++      ++   +  G+E FY K ++P  H  +  E +H++AV      L P+F  +   YP+L  +LFG +F +P+G+AAGFDK G+AI  L  N+GF  +E+GSVTP PQ GN  PRVFRL+ DE VINRYGFNSDG    H+ VR    +   +     GVNLG NK T D   DY  GV  F   CDYLV+NVSSPNT GLR +QK++ L + L  V +A +   L ++  + LKI+PD  + ++K+I +V   +   IDG IV NT+ +R   L S E   ETGGLSG P+R+ STE + +I  LTNG++PIIG GGV SG DA+ K+ AGASL+QLY++ V+ G P++ K+ REL E +R   FS++ E +   + EK
Sbjct:   17 GAISKSTVIVLATGIASYTALELLYGSETFYKKAVMPMVHKFVDGEDSHRWAVRAASWGLLPRFGWNRKEYPELKCELFGREFKNPIGLAAGFDKDGQAITQLAKNSGFGLIEIGSVTPIPQPGNNRPRVFRLLEDEGVINRYGFNSDGVGRVHQRVRSARDSWVPESYAYFGVNLGKNKLTEDAKLDYEIGVNYFAPHCDYLVLNVSSPNTPGLRSMQKKSDLEKLLAYVHQALEMHKLEKQPQVFLKIAPDLIESELKDIAQVVTNKKFAIDGIIVSNTTIARPDYLRS-ENKTETGGLSGAPVREISTECVRKIYKLTNGQIPIIGCGGVFSGADAYEKIRAGASLVQLYSAFVYEGFPVIGKIKRELVELLRKDGFSHVSEAIGADHREK 409          
BLAST of Dihydroorotate dehydrogenase (Quinone), mitochondrial vs. Ensembl Fly
Match: Dhod (gene:FBgn0000447 transcript:FBtr0300442)

HSP 1 Score: 293.123 bits (749), Expect = 4.011e-95
Identity = 168/351 (47.86%), Postives = 230/351 (65.53%), Query Frame = 3
Query:  225 CMFSGYCIYEGNEKFYYKILLPTSHLILSPEIAHKFAVFMGKHNLFPKFSNSSYPDLSVKLFGLQFSHPVGIAAGFDKQGEAILGLLNAGFSHVEVGSVTPEPQAGNICPRVFRLVNDEAVINRYGFNSDGHRVVRDRLSNIDWKG--KGVVGVNLGINKHTNDPAGDYVTGVERFGEICDYLVINVSSPNTEGLRLLQKENQLRETLNRVMKARDALP--RKTPILLKISPDETDEDVKNIVKV--SLEQNIDGFIVCNTSNSRDGLLSSAELVAETGGLSGKPLRDKSTELISRISTLTNGRVPXXXXXXXXXXKDAWLKLMAGASLIQLYTSMVFYGPPIVKKVTREL 1259
             + +G   Y+  ++ +   ++P   L L  E +H+ AV   K+ L P        +L    FG   S+P+GIAAGFDK  EA+ GL + GF  +EVG+VTP  Q GN  PRVFRL  D+A+INRYGFNSDGH+ V  RL  +  K    GVVGVNLG NK T  P  DYV GV  FG + DYLVINVSSPNT+GLR +Q + +LRE L +V   + +L   +  PILLK+SPD + +D+K+IV V    +  +DG IV NT+ SR+  +   +L  ETGGLSG PL+ +STE+I+++  LT+G++PIIGVGGV+SG DA+ K+ AGAS +Q+YT++V+ GP +V+ +  EL
Sbjct:   31 ALVAGITAYKNQDQLFRTFVMPAVRL-LPAEASHQLAVLACKYRLCPVSQYHDDQNLHTSFFGRMLSNPIGIAAGFDKNAEAVDGLQDLGFGFIEVGTVTPAAQEGNPKPRVFRLTEDKAIINRYGFNSDGHQAVLQRLRLLRKKENFNGVVGVNLGRNKTTMSPIADYVQGVRVFGPVADYLVINVSSPNTKGLRDMQSKEKLRELLEQVNDTKSSLDKNKNVPILLKLSPDLSLDDMKDIVWVIKRKKSRVDGLIVSNTTVSREN-IEKNKLAEETGGLSGPPLKARSTEMIAQMYQLTDGKIPIIGVGGVASGYDAYEKIEAGASYVQIYTALVYEGPALVEDIKAEL 379          
BLAST of Dihydroorotate dehydrogenase (Quinone), mitochondrial vs. Ensembl Fly
Match: Dhod (gene:FBgn0000447 transcript:FBtr0081890)

HSP 1 Score: 293.123 bits (749), Expect = 4.011e-95
Identity = 168/351 (47.86%), Postives = 230/351 (65.53%), Query Frame = 3
Query:  225 CMFSGYCIYEGNEKFYYKILLPTSHLILSPEIAHKFAVFMGKHNLFPKFSNSSYPDLSVKLFGLQFSHPVGIAAGFDKQGEAILGLLNAGFSHVEVGSVTPEPQAGNICPRVFRLVNDEAVINRYGFNSDGHRVVRDRLSNIDWKG--KGVVGVNLGINKHTNDPAGDYVTGVERFGEICDYLVINVSSPNTEGLRLLQKENQLRETLNRVMKARDALP--RKTPILLKISPDETDEDVKNIVKV--SLEQNIDGFIVCNTSNSRDGLLSSAELVAETGGLSGKPLRDKSTELISRISTLTNGRVPXXXXXXXXXXKDAWLKLMAGASLIQLYTSMVFYGPPIVKKVTREL 1259
             + +G   Y+  ++ +   ++P   L L  E +H+ AV   K+ L P        +L    FG   S+P+GIAAGFDK  EA+ GL + GF  +EVG+VTP  Q GN  PRVFRL  D+A+INRYGFNSDGH+ V  RL  +  K    GVVGVNLG NK T  P  DYV GV  FG + DYLVINVSSPNT+GLR +Q + +LRE L +V   + +L   +  PILLK+SPD + +D+K+IV V    +  +DG IV NT+ SR+  +   +L  ETGGLSG PL+ +STE+I+++  LT+G++PIIGVGGV+SG DA+ K+ AGAS +Q+YT++V+ GP +V+ +  EL
Sbjct:   31 ALVAGITAYKNQDQLFRTFVMPAVRL-LPAEASHQLAVLACKYRLCPVSQYHDDQNLHTSFFGRMLSNPIGIAAGFDKNAEAVDGLQDLGFGFIEVGTVTPAAQEGNPKPRVFRLTEDKAIINRYGFNSDGHQAVLQRLRLLRKKENFNGVVGVNLGRNKTTMSPIADYVQGVRVFGPVADYLVINVSSPNTKGLRDMQSKEKLRELLEQVNDTKSSLDKNKNVPILLKLSPDLSLDDMKDIVWVIKRKKSRVDGLIVSNTTVSREN-IEKNKLAEETGGLSGPPLKARSTEMIAQMYQLTDGKIPIIGVGGVASGYDAYEKIEAGASYVQIYTALVYEGPALVEDIKAEL 379          
BLAST of Dihydroorotate dehydrogenase (Quinone), mitochondrial vs. Ensembl Zebrafish
Match: dhodh (dihydroorotate dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-030131-3157])

HSP 1 Score: 314.694 bits (805), Expect = 2.409e-103
Identity = 179/381 (46.98%), Postives = 248/381 (65.09%), Query Frame = 3
Query:  186 QLKNSLSMIGMSFCMFSGYCIYEGNEKFYYKILLPTSHLILSPEIAHKFAVFMGKHNLFPKFSNSSYPDLSVKLFGLQFSHPVGIAAGFDKQGEAILGLLNAGFSHVEVGSVTPEPQAGNICPRVFRLVNDEAVINRYGFNSDGHRVVRDRL-------SNIDWKGKGVVGVNLGINKHTNDPAGDYVTGVERFGEICDYLVINVSSPNTEGLRLLQKENQLRETLNRVMKARDAL--PRKTPILLKISPDETDEDVKNIVKVSLEQNIDGFIVCNTSNSRDGLLSSAELVAETGGLSGKPLRDKSTELISRISTLTNGRVPXXXXXXXXXXKDAWLKLMAGASLIQLYTSMVFYGPPIVKKVTRELDEEMRNSEFSNLHE 1301
            Q K+++ +IG    +F GY    G+E FY   L+P     +  E AH  AV +    L P+ +      L V + G +F +PVG+AAGFDK GEA+ GL   GF  VEVG+VTP+PQ GN  PRVFRL +D+A+INRYGFNS G   V +RL       S +   GK  +G+NLG NK + D   DYV GV   G + DYLV+NVSSPNT GLR LQ + +LR  L++V+K RD+L    + P+L+KI+PD T +D ++I +V +E  +DG +V NT+ SR   L     V ETGGLSG+PL++ ST+ +  + TLT G++PI+GVGGV+SG+DA  K+ AGASL+QLYT++V+ GPP+V K+ RELD+ ++   F+ + E
Sbjct:    8 QAKDAVKIIGCGSALFLGYLTASGDECFYASALMPVLQRFVGGETAHLMAVRLIGLGLVPRNNYKDPTSLEVHVMGRKFQNPVGMAAGFDKHGEAVDGLYRLGFGFVEVGTVTPKPQDGNPKPRVFRLESDQAIINRYGFNSCGLSAVHERLKAREHVQSELTKAGK-PLGINLGKNKLSPDAVSDYVEGVRTLGPLADYLVVNVSSPNTPGLRDLQGKEELRHLLDKVVKERDSLRIENRPPVLVKIAPDLTIQDKQDIAEVIMEVGVDGVMVSNTTVSRPDTLKDPNRV-ETGGLSGQPLKELSTQTVREMYTLTQGKLPIVGVGGVASGQDAMDKIRAGASLVQLYTALVYQGPPVVNKIKRELDDLLKAQGFTCVAE 386          
BLAST of Dihydroorotate dehydrogenase (Quinone), mitochondrial vs. Ensembl Xenopus
Match: piezo1 (piezo-type mechanosensitive ion channel component 1 [Source:Xenbase;Acc:XB-GENE-6050252])

HSP 1 Score: 306.22 bits (783), Expect = 2.809e-100
Identity = 178/366 (48.63%), Postives = 236/366 (64.48%), Query Frame = 3
Query:  216 MSFCMFSGYCIYEGNEKFYYKILLPTSHLILSPEIAHKFAVFMGKHNLFPKFSNSSYPDLSVKLFGLQFSHPVGIAAGFDKQGEAILGLLNAGFSHVEVGSVTPEPQAGNICPRVFRLVNDEAVINRYGFNSDGHRVVRDRLSNIDWKGKGV------VGVNLGINKHTNDPAGDYVTGVERFGEICDYLVINVSSPNTEGLRLLQKENQLRETLNRVMKARDALP--RKTPILLKISPDETDEDVKNIVKVSLEQNIDGFIVCNTSNSRDGLLSSAELVAETGGLSGKPLRDKSTELISRISTLTNGRVPXXXXXXXXXXKDAWLKLMAGASLIQLYTSMVFYGPPIVKKVTRELDEEMRNSEFS 1289
            +S  +FS +   +G+E FY + L+P    +++PE+AH  +V      L P   + +   L VK+ G  F +PVG+AAGFDK GEA+ GL   GF  VEVGS+TP+PQ GN  PRVFRL  D AVINRYGFNS G  VVR RL     K K +      +G+NLG NK + D A DY  G+++ G + DYLVINVSSPNT GLR LQ  +QLR+ L  V+K+R+AL    K  +L+KI+PD + +D ++I  V  E  IDG I+ NT+ SR   L   +  +E GGLSG PLRD +TE +  +  LT G++PIIGVGGV SG DA  K+ AGASL+QLYT++ + GPP+V KVT ELD+ +    F+
Sbjct:    1 LSGLLFSSFLTIKGDEHFYAQCLMPIMQRLVNPELAHILSVKCVSLGLVPFCKHHNSERLEVKVLGHTFRNPVGLAAGFDKHGEAVDGLFKIGFGFVEVGSITPKPQDGNPKPRVFRLPQDGAVINRYGFNSHGVEVVRQRLLERREKQKMLTAAGMPLGINLGKNKTSEDAAADYTQGLQQLGSLADYLVINVSSPNTPGLRNLQGRDQLRKLLTEVVKSRNALQCDPKPALLVKIAPDLSMQDKEDIASVVTEVGIDGLIISNTTISRPSSLQDPQ-KSEVGGLSGIPLRDLATETVREMYALTAGKIPIIGVGGVFSGLDALHKIRAGASLVQLYTALTYQGPPVVGKVTTELDQLLVEQGFA 365          
BLAST of Dihydroorotate dehydrogenase (Quinone), mitochondrial vs. Ensembl Xenopus
Match: piezo1 (piezo-type mechanosensitive ion channel component 1 [Source:Xenbase;Acc:XB-GENE-6050252])

HSP 1 Score: 300.442 bits (768), Expect = 1.093e-97
Identity = 181/376 (48.14%), Postives = 243/376 (64.63%), Query Frame = 3
Query:  186 QLKNSLSMIGMSFCMFSGYCIYEGNEKFYYKILLPTSHLILSPEIAHKFAVFMGKHNLFPKFSNSSYPDLSVKLFGLQFSHPVGIAAGFDKQGEAILGLLNAGFSHVEVGSVTPEPQAGNICPRVFRLVNDEAVINRYGFNSDGHRVVRDRLSNIDWKGKGV------VGVNLGINKHTNDPAGDYVTGVERFGEICDYLVINVSSPNTEGLRLLQKENQLRETLNRVMKARDALP--RKTPILLKISPDETDEDVKNIVKVSLEQNIDGFIVCNTSNSRDGLLSSAELVAETGGLSGKPLRDKSTELISRISTLTNGRVPXXXXXXXXXXKDAWLKLMAGASLIQLYTSMVFYGPPIVKKVTRELDEEMRNSEFS 1289
            +LK++L ++G    +FS +   +G+E FY + L+P    +++PE+AH  +V      L P   + +   L VK+ G  F +PVG+AAGFDK GEA+ GL   GF  VEVGS+TP+PQ GN  PRVFRL  D AVINRYGFNS G  VVR RL     K K +      +G+NLG NK + D A DY  G+++ G + DYLVINVSSPNT GLR LQ  +QLR+ L  V+K+R+AL    K  +L+KI+PD + +D ++I  V  E  IDG I+ NT+ SR   L   +  +E GGLSG PLRD +TE +  +  LT G++PIIGVGGV SG DA  K+ AGASL+QLYT++ + GPP+V KVT ELD+ +    F+
Sbjct:    9 RLKDALIVLGGGGLLFSSFLTIKGDEHFYAQCLMPIMQRLVNPELAHILSVKCVSLGLVPFCKHHNSERLEVKVLGHTFRNPVGLAAGFDKHGEAVDGLFKIGFGFVEVGSITPKPQDGNPKPRVFRLPQDGAVINRYGFNSHGVEVVRQRLLERREKQKMLTAAGMPLGINLGKNKTSEDAAADYTQGLQQLGSLADYLVINVSSPNTPGLRNLQGRDQLRKLLTEVVKSRNALQCDPKPALLVKIAPDLSMQDKEDIASVVTEVGIDGLIISNTTISRPSSLQDPQ-KSEVGGLSGIPLRDLATETVREMYALTAGKIPIIGVGGVFSGLDALHKIRAGASLVQLYTALTYQGPPVVGKVTTELDQLLVEQGFA 383          
BLAST of Dihydroorotate dehydrogenase (Quinone), mitochondrial vs. Ensembl Xenopus
Match: piezo1 (piezo-type mechanosensitive ion channel component 1 [Source:Xenbase;Acc:XB-GENE-6050252])

HSP 1 Score: 292.352 bits (747), Expect = 2.135e-94
Identity = 182/378 (48.15%), Postives = 241/378 (63.76%), Query Frame = 3
Query:  186 QLKNSLSMIGMSFCMFSGYCIYEGNEKFYYKILLPTSHLILSPEIAHKFAVFMGKHNLFP--KFSNSSYPDLSVKLFGLQFSHPVGIAAGFDKQGEAILGLLNAGFSHVEVGSVTPEPQAGNICPRVFRLVNDEAVINRYGFNSDGHRVVRDRLSNIDWKGKGV------VGVNLGINKHTNDPAGDYVTGVERFGEICDYLVINVSSPNTEGLRLLQKENQLRETLNRVMKARDALP--RKTPILLKISPDETDEDVKNIVKVSLEQNIDGFIVCNTSNSRDGLLSSAELVAETGGLSGKPLRDKSTELISRISTLTNGRVPXXXXXXXXXXKDAWLKLMAGASLIQLYTSMVFYGPPIVKKVTRELDEEMRNSEFS 1289
            +LK++L ++G    +FS +   +G+E FY + L+P    +++PE+AH  +V      L P  K  NS     S    G  F +PVG+AAGFDK GEA+ GL   GF  VEVGS+TP+PQ GN  PRVFRL  D AVINRYGFNS G  VVR RL     K K +      +G+NLG NK + D A DY  G+++ G + DYLVINVSSPNT GLR LQ  +QLR+ L  V+K+R+AL    K  +L+KI+PD + +D ++I  V  E  IDG I+ NT+ SR   L   +  +E GGLSG PLRD +TE +  +  LT G++PIIGVGGV SG DA  K+ AGASL+QLYT++ + GPP+V KVT ELD+ +    F+
Sbjct:   18 RLKDALIVLGGGGLLFSSFLTIKGDEHFYAQCLMPIMQRLVNPELAHILSVKCVSLGLVPFCKHHNSERLKYS-HFLGHTFRNPVGLAAGFDKHGEAVDGLFKIGFGFVEVGSITPKPQDGNPKPRVFRLPQDGAVINRYGFNSHGVEVVRQRLLERREKQKMLTAAGMPLGINLGKNKTSEDAAADYTQGLQQLGSLADYLVINVSSPNTPGLRNLQGRDQLRKLLTEVVKSRNALQCDPKPALLVKIAPDLSMQDKEDIASVVTEVGIDGLIISNTTISRPSSLQDPQ-KSEVGGLSGIPLRDLATETVREMYALTAGKIPIIGVGGVFSGLDALHKIRAGASLVQLYTALTYQGPPVVGKVTTELDQLLVEQGFA 393          
BLAST of Dihydroorotate dehydrogenase (Quinone), mitochondrial vs. Ensembl Mouse
Match: Dhodh (dihydroorotate dehydrogenase [Source:MGI Symbol;Acc:MGI:1928378])

HSP 1 Score: 323.553 bits (828), Expect = 5.810e-107
Identity = 184/375 (49.07%), Postives = 244/375 (65.07%), Query Frame = 3
Query:  207 MIGMSFCMFSGYCIYEGNEKFYYKILLPTSHLILSPEIAHKFAVFMGKHNLFPKFSNSSYPDLSVKLFGLQFSHPVGIAAGFDKQGEAILGLLNAGFSHVEVGSVTPEPQAGNICPRVFRLVNDEAVINRYGFNSDGHRVVRDRLSNIDWKGKGV------VGVNLGINKHTNDPAGDYVTGVERFGEICDYLVINVSSPNTEGLRLLQKENQLRETLNRVMKARDAL--PRKTPILLKISPDETDEDVKNIVKVSLEQNIDGFIVCNTSNSRDGLLSSAELVAETGGLSGKPLRDKSTELISRISTLTNGRVPXXXXXXXXXXKDAWLKLMAGASLIQLYTSMVFYGPPIVKKVTRELDEEMRNSEFSNLHEFL 1307
            ++G    +F+ Y    G++ FY + L+P    +L PE AH+ AV +    L P+ +      L V++ G +F +PVGIAAGFDK GEA+ GL   GF  VEVGSVTP+PQ GN  PRVFRL  D+AVINRYGFNS G   V  RL     K   +      +G+NLG NK + D A DYV GV   G + DYLV+NVSSPNT GLR LQ + +LR  L++V++ RDAL  P+K  +L+KI+PD T +D ++I  V+ E  IDG I+ NT+ SR   L  A L +ETGGLSGKPLRD ST+ I  +  LT G +PIIGVGGVSSG+DA  K+ AGASL+QLYT++ F GPP+V +V REL+  ++   F+ + + +
Sbjct:   16 ILGGGGLLFTSYLTATGDDHFYAEYLMPALQRLLDPESAHRLAVRVISLGLLPRATFQDSNMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKLGFGFVEVGSVTPQPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSAVEHRLRARQQKQTQLTTDGLPLGINLGKNKTSVDAAADYVEGVRILGPLADYLVVNVSSPNTAGLRSLQGKTELRRLLSKVLQERDALKGPQKPAVLVKIAPDLTAQDKEDIASVARELGIDGLIITNTTVSRPVGLQGA-LRSETGGLSGKPLRDLSTQTIREMYALTQGTIPIIGVGGVSSGQDALEKIQAGASLVQLYTALTFLGPPVVARVKRELEALLKERGFNTVTDAI 389          
BLAST of Dihydroorotate dehydrogenase (Quinone), mitochondrial vs. Ensembl Mouse
Match: Dhodh (dihydroorotate dehydrogenase [Source:MGI Symbol;Acc:MGI:1928378])

HSP 1 Score: 229.565 bits (584), Expect = 6.642e-72
Identity = 122/260 (46.92%), Postives = 163/260 (62.69%), Query Frame = 3
Query:  207 MIGMSFCMFSGYCIYEGNEKFYYKILLPTSHLILSPEIAHKFAVFMGKHNLFPKFSNSSYPDLSVKLFGLQFSHPVGIAAGFDKQGEAILGLLNAGFSHVEVGSVTPEPQAGNICPRVFRLVNDEAVINRYGFNSDGHRVVRDRLSNIDWKGKGV------VGVNLGINKHTNDPAGDYVTGVERFGEICDYLVINVSSPNTEGLRLLQKENQLRETLNRVMKARDAL--PRKTPILLKISPDETDEDVKNIVKVSLEQN 962
            ++G    +F+ Y    G++ FY + L+P    +L PE AH+ AV +    L P+ +      L V++ G +F +PVGIAAGFDK GEA+ GL   GF  VEVGSVTP+PQ GN  PRVFRL  D+AVINRYGFNS G   V  RL     K   +      +G+NLG NK + D A DYV GV   G + DYLV+NVSSPNT GLR LQ + +LR  L++V++ RDAL  P+K  +L+KI+PD T +D ++I  V+ E+ 
Sbjct:   16 ILGGGGLLFTSYLTATGDDHFYAEYLMPALQRLLDPESAHRLAVRVISLGLLPRATFQDSNMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKLGFGFVEVGSVTPQPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSAVEHRLRARQQKQTQLTTDGLPLGINLGKNKTSVDAAADYVEGVRILGPLADYLVVNVSSPNTAGLRSLQGKTELRRLLSKVLQERDALKGPQKPAVLVKIAPDLTAQDKEDIASVARERT 275          
BLAST of Dihydroorotate dehydrogenase (Quinone), mitochondrial vs. Ensembl Mouse
Match: Dhodh (dihydroorotate dehydrogenase [Source:MGI Symbol;Acc:MGI:1928378])

HSP 1 Score: 127.872 bits (320), Expect = 1.367e-34
Identity = 69/150 (46.00%), Postives = 90/150 (60.00%), Query Frame = 3
Query:  207 MIGMSFCMFSGYCIYEGNEKFYYKILLPTSHLILSPEIAHKFAVFMGKHNLFPKFSNSSYPDLSVKLFGLQFSHPVGIAAGFDKQGEAILGLLNAGFSHVEVGSVTPEPQAGNICPRVFRLVNDEAVINRYGFNSDGHRVVRDRLSNIDW 656
            ++G    +F+ Y    G++ FY + L+P    +L PE AH+ AV +    L P+ +      L V++ G +F +PVGIAAGFDK GEA+ GL   GF  VEVGSVTP+PQ GN  PRVFRL  D+AVINR G  S G  +VR      DW
Sbjct:   14 ILGGGGLLFTSYLTATGDDHFYAEYLMPALQRLLDPESAHRLAVRVISLGLLPRATFQDSNMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKLGFGFVEVGSVTPQPQEGNPRPRVFRLPEDQAVINRQGPMSLG--MVRQHTCVSDW 161          
BLAST of Dihydroorotate dehydrogenase (Quinone), mitochondrial vs. Ensembl Mouse
Match: Dhodh (dihydroorotate dehydrogenase [Source:MGI Symbol;Acc:MGI:1928378])

HSP 1 Score: 106.301 bits (264), Expect = 1.844e-27
Identity = 54/103 (52.43%), Postives = 67/103 (65.05%), Query Frame = 3
Query:  285 LPTSHLILSPEIAHKFAVFMGKHNLFPKFSNSSYPDLSVKLFGLQFSHPVGIAAGFDKQGEAILGLLNAGFSHVEVGSVTPEPQAGNICPRVFRLVNDEAVIN 593
            +P    +L PE AH+ AV +    L P+ +      L V++ G +F +PVGIAAGFDK GEA+ GL   GF  VEVGSVTP+PQ GN  PRVFRL  D+AVIN
Sbjct:    1 MPALQRLLDPESAHRLAVRVISLGLLPRATFQDSNMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKLGFGFVEVGSVTPQPQEGNPRPRVFRLPEDQAVIN 103          
BLAST of Dihydroorotate dehydrogenase (Quinone), mitochondrial vs. Ensembl Mouse
Match: Dhodh (dihydroorotate dehydrogenase [Source:MGI Symbol;Acc:MGI:1928378])

HSP 1 Score: 95.1301 bits (235), Expect = 1.820e-23
Identity = 45/70 (64.29%), Postives = 52/70 (74.29%), Query Frame = 3
Query:  393 LSVKLFGLQFSHPVGIAAGFDKQGEAILGLLNAGFSHVEVGSVTPEPQAGNICPRVFRLVNDEAVINRYG 602
            L V++ G +F +PVGIAAGFDK GEA+ GL   GF  VEVGSVTP+PQ GN  PRVFRL  D+AVIN  G
Sbjct:    9 LEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKLGFGFVEVGSVTPQPQEGNPRPRVFRLPEDQAVINSLG 78          
BLAST of Dihydroorotate dehydrogenase (Quinone), mitochondrial vs. UniProt/SwissProt
Match: sp|Q63707|PYRD_RAT (Dihydroorotate dehydrogenase (quinone), mitochondrial OS=Rattus norvegicus OX=10116 GN=Dhodh PE=1 SV=1)

HSP 1 Score: 329.717 bits (844), Expect = 1.537e-108
Identity = 187/379 (49.34%), Postives = 248/379 (65.44%), Query Frame = 3
Query:  195 NSLSMIGMSFCMFSGYCIYEGNEKFYYKILLPTSHLILSPEIAHKFAVFMGKHNLFPKFSNSSYPDLSVKLFGLQFSHPVGIAAGFDKQGEAILGLLNAGFSHVEVGSVTPEPQAGNICPRVFRLVNDEAVINRYGFNSDGHRVVRDRLSNIDWKGKGV------VGVNLGINKHTNDPAGDYVTGVERFGEICDYLVINVSSPNTEGLRLLQKENQLRETLNRVMKARDALP--RKTPILLKISPDETDEDVKNIVKVSLEQNIDGFIVCNTSNSRDGLLSSAELVAETGGLSGKPLRDKSTELISRISTLTNGRVPXXXXXXXXXXKDAWLKLMAGASLIQLYTSMVFYGPPIVKKVTRELDEEMRNSEFSNLHEFL 1307
            +++ ++G    +F+ Y    G++ FY + L+P    +L PE AH+ AV +    L P+ +      L VK+ G +F +PVGIAAGFDK GEA+ GL   GF  VEVGSVTP+PQ GN  PRVFRL  D+AVINRYGFNS G  VV  RL     K   +      +G+NLG NK + D A DY  GV   G + DYLV+NVSSPNT GLR LQ + +LR  L++V++ RDAL   RK  +L+KI+PD T +D ++I  V+ E  IDG IV NT+ SR   L  A L +ETGGLSGKPLRD ST+ I  +  LT GR+PIIGVGGVSSG+DA  K+ AGASL+QLYT+++F GPP+V +V REL+  ++   F+ + + +
Sbjct:   12 DAVIILGGGGLLFTSYLTATGDDHFYAEYLMPGLQRLLDPESAHRLAVRVTSLGLLPRATFQDSDMLEVKVLGHKFRNPVGIAAGFDKNGEAVDGLYKLGFGFVEVGSVTPQPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAQLTADGLPLGINLGKNKTSEDAAADYAEGVRTLGPLADYLVVNVSSPNTAGLRSLQGKTELRHLLSKVLQERDALKGTRKPAVLVKIAPDLTAQDKEDIASVARELGIDGLIVTNTTVSRPVGLQGA-LRSETGGLSGKPLRDLSTQTIREMYALTQGRIPIIGVGGVSSGQDALEKIQAGASLVQLYTALIFLGPPVVVRVKRELEALLKERGFTTVTDAI 389          
BLAST of Dihydroorotate dehydrogenase (Quinone), mitochondrial vs. UniProt/SwissProt
Match: sp|Q02127|PYRD_HUMAN (Dihydroorotate dehydrogenase (quinone), mitochondrial OS=Homo sapiens OX=9606 GN=DHODH PE=1 SV=3)

HSP 1 Score: 328.176 bits (840), Expect = 7.005e-108
Identity = 188/380 (49.47%), Postives = 246/380 (64.74%), Query Frame = 3
Query:  192 KNSLSMIGMSFCMFSGYCIYEGNEKFYYKILLPTSHLILSPEIAHKFAVFMGKHNLFPKFSNSSYPDLSVKLFGLQFSHPVGIAAGFDKQGEAILGLLNAGFSHVEVGSVTPEPQAGNICPRVFRLVNDEAVINRYGFNSDGHRVVRDRLSNIDWKGKGV------VGVNLGINKHTNDPAGDYVTGVERFGEICDYLVINVSSPNTEGLRLLQKENQLRETLNRVMKARDALPR--KTPILLKISPDETDEDVKNIVKVSLEQNIDGFIVCNTSNSRDGLLSSAELVAETGGLSGKPLRDKSTELISRISTLTNGRVPXXXXXXXXXXKDAWLKLMAGASLIQLYTSMVFYGPPIVKKVTRELDEEMRNSEFSNLHEFL 1307
            ++++ ++G    +F+ Y +  G+E+FY + L+PT   +L PE AH+ AV      L P+        L V++ G +F +PVGIAAGFDK GEA+ GL   GF  VE+GSVTP+PQ GN  PRVFRL  D+AVINRYGFNS G  VV  RL     K   +      +GVNLG NK + D A DY  GV   G + DYLV+NVSSPNT GLR LQ + +LR  L +V++ RD L R  +  +L+KI+PD T +D ++I  V  E  IDG IV NT+ SR   L  A L +ETGGLSGKPLRD ST+ I  +  LT GRVPIIGVGGVSSG+DA  K+ AGASL+QLYT++ F+GPP+V KV REL+  ++   F  + + +
Sbjct:   11 QDAVIILGGGGLLFASYLMATGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDGLRRVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGA-LRSETGGLSGKPLRDLSTQTIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFGGVTDAI 389          
BLAST of Dihydroorotate dehydrogenase (Quinone), mitochondrial vs. UniProt/SwissProt
Match: sp|O35435|PYRD_MOUSE (Dihydroorotate dehydrogenase (quinone), mitochondrial OS=Mus musculus OX=10090 GN=Dhodh PE=1 SV=2)

HSP 1 Score: 323.553 bits (828), Expect = 4.064e-106
Identity = 184/375 (49.07%), Postives = 244/375 (65.07%), Query Frame = 3
Query:  207 MIGMSFCMFSGYCIYEGNEKFYYKILLPTSHLILSPEIAHKFAVFMGKHNLFPKFSNSSYPDLSVKLFGLQFSHPVGIAAGFDKQGEAILGLLNAGFSHVEVGSVTPEPQAGNICPRVFRLVNDEAVINRYGFNSDGHRVVRDRLSNIDWKGKGV------VGVNLGINKHTNDPAGDYVTGVERFGEICDYLVINVSSPNTEGLRLLQKENQLRETLNRVMKARDAL--PRKTPILLKISPDETDEDVKNIVKVSLEQNIDGFIVCNTSNSRDGLLSSAELVAETGGLSGKPLRDKSTELISRISTLTNGRVPXXXXXXXXXXKDAWLKLMAGASLIQLYTSMVFYGPPIVKKVTRELDEEMRNSEFSNLHEFL 1307
            ++G    +F+ Y    G++ FY + L+P    +L PE AH+ AV +    L P+ +      L V++ G +F +PVGIAAGFDK GEA+ GL   GF  VEVGSVTP+PQ GN  PRVFRL  D+AVINRYGFNS G   V  RL     K   +      +G+NLG NK + D A DYV GV   G + DYLV+NVSSPNT GLR LQ + +LR  L++V++ RDAL  P+K  +L+KI+PD T +D ++I  V+ E  IDG I+ NT+ SR   L  A L +ETGGLSGKPLRD ST+ I  +  LT G +PIIGVGGVSSG+DA  K+ AGASL+QLYT++ F GPP+V +V REL+  ++   F+ + + +
Sbjct:   16 ILGGGGLLFTSYLTATGDDHFYAEYLMPALQRLLDPESAHRLAVRVISLGLLPRATFQDSNMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKLGFGFVEVGSVTPQPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSAVEHRLRARQQKQTQLTTDGLPLGINLGKNKTSVDAAADYVEGVRILGPLADYLVVNVSSPNTAGLRSLQGKTELRRLLSKVLQERDALKGPQKPAVLVKIAPDLTAQDKEDIASVARELGIDGLIITNTTVSRPVGLQGA-LRSETGGLSGKPLRDLSTQTIREMYALTQGTIPIIGVGGVSSGQDALEKIQAGASLVQLYTALTFLGPPVVARVKRELEALLKERGFNTVTDAI 389          
BLAST of Dihydroorotate dehydrogenase (Quinone), mitochondrial vs. UniProt/SwissProt
Match: sp|Q5E9W3|PYRD_BOVIN (Dihydroorotate dehydrogenase (quinone), mitochondrial OS=Bos taurus OX=9913 GN=DHODH PE=1 SV=1)

HSP 1 Score: 321.627 bits (823), Expect = 2.153e-105
Identity = 182/380 (47.89%), Postives = 245/380 (64.47%), Query Frame = 3
Query:  192 KNSLSMIGMSFCMFSGYCIYEGNEKFYYKILLPTSHLILSPEIAHKFAVFMGKHNLFPKFSNSSYPDLSVKLFGLQFSHPVGIAAGFDKQGEAILGLLNAGFSHVEVGSVTPEPQAGNICPRVFRLVNDEAVINRYGFNSDGHRVVRDRL-----SNIDWKGKGV-VGVNLGINKHTNDPAGDYVTGVERFGEICDYLVINVSSPNTEGLRLLQKENQLRETLNRVMKARDAL--PRKTPILLKISPDETDEDVKNIVKVSLEQNIDGFIVCNTSNSRDGLLSSAELVAETGGLSGKPLRDKSTELISRISTLTNGRVPXXXXXXXXXXKDAWLKLMAGASLIQLYTSMVFYGPPIVKKVTRELDEEMRNSEFSNLHEFL 1307
            ++++ ++G    +F+ Y    G+E FY ++L+P+   +L PE AH+ AV      L P+ +      L V++ G +F +PVGIAAGFDK GEA+ GL   GF  VE+GSVTPEPQ GN  PRVFRL  D+A+INRYGFNS G  VV  RL     +       G+ +G+NLG NK + D A DY  GV   G + DYLV+NVSSPNT GLR LQ + +LR  L +V++ RDAL    K  +L+KI+PD T +D ++I  V  E  IDG IV N++ SR   L  A L +E GGLSGKPLRD ST+ I  +  LT GRVPI+GVGGVSSG+DA  K+ AGASL+QLYT++ + GPP+V  V REL+  ++   F+ + + +
Sbjct:   11 QDAMVILGGGGLLFASYLTATGDEHFYAELLMPSLQRLLDPETAHRLAVRFTSLGLLPRTTFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPEPQEGNPRPRVFRLPEDQAIINRYGFNSHGLSVVEHRLRARQQTQARLTEDGLPLGINLGKNKTSVDAASDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQERDALKVAHKPAVLVKIAPDLTAQDKEDIASVVRELGIDGLIVTNSTVSRPASLQGA-LRSEPGGLSGKPLRDLSTQTIREMYALTQGRVPIVGVGGVSSGQDALEKIRAGASLVQLYTALTYRGPPVVGGVKRELEALLKEQGFARVTDAI 389          
BLAST of Dihydroorotate dehydrogenase (Quinone), mitochondrial vs. UniProt/SwissProt
Match: sp|Q5R6X6|PYRD_PONAB (Dihydroorotate dehydrogenase (quinone), mitochondrial OS=Pongo abelii OX=9601 GN=DHODH PE=2 SV=1)

HSP 1 Score: 318.931 bits (816), Expect = 2.799e-104
Identity = 186/380 (48.95%), Postives = 243/380 (63.95%), Query Frame = 3
Query:  192 KNSLSMIGMSFCMFSGYCIYEGNEKFYYKILLPTSHLILSPEIAHKFAVFMGKHNLFPKFSNSSYPDLSVKLFGLQFSHPVGIAAGFDKQGEAILGLLNAGFSHVEVGSVTPEPQAGNICPRVFRLVNDEAVINRYGFNSDGHRVVRDRLSNIDWKGKGV------VGVNLGINKHTNDPAGDYVTGVERFGEICDYLVINVSSPNTEGLRLLQKENQLRETLNRVMKARDALP--RKTPILLKISPDETDEDVKNIVKVSLEQNIDGFIVCNTSNSRDGLLSSAELVAETGGLSGKPLRDKSTELISRISTLTNGRVPXXXXXXXXXXKDAWLKLMAGASLIQLYTSMVFYGPPIVKKVTRELDEEMRNSEFSNLHEFL 1307
            ++++ ++G    +F+ Y +  G+E+FY + L+PT   +L PE AH+ AV      L P+        L V++ G +F +PVGIAAGFDK GEA+ GL   GF  VE+GSVTP+PQ GN  PRVFRL  D+AVINRYGFNS G  VV  RL     K   +      +GVNLG NK + D A DY  GV   G + D LV+NVSSPNT GLR LQ + +LR  L +V++ RD L    +  +L+KI+PD T +D ++I  V  E  IDG IV NT+ SR   L  A L +ETGGLSGKP RD STE I  +  LT GRVPIIGVGGVSSG+DA  K+ AGASL+QLYT++ F+GPP+V KV REL+  ++   F  + + +
Sbjct:   11 QDAVVILGGGGLLFASYLMATGDERFYAEHLMPTLQGLLDPESAHRLAVRFTSLGLLPRARFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTEDGLPLGVNLGKNKTSVDAAEDYAEGVRVLGPLADCLVVNVSSPNTAGLRNLQGKAELRRLLTKVLQERDGLRGVHRPAVLVKIAPDLTSQDKEDIASVVKELGIDGLIVTNTTVSRPAGLQGA-LRSETGGLSGKPPRDLSTETIREMYALTQGRVPIIGVGGVSSGQDALEKIRAGASLVQLYTALTFWGPPVVGKVKRELEALLKEQGFCRVTDAI 389          
BLAST of Dihydroorotate dehydrogenase (Quinone), mitochondrial vs. TrEMBL
Match: A0A183LA78 (DHO_dh domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS703 PE=4 SV=1)

HSP 1 Score: 379.407 bits (973), Expect = 1.039e-125
Identity = 196/378 (51.85%), Postives = 262/378 (69.31%), Query Frame = 3
Query:  183 AQLKNSLSMIGMSFCMFSGYCIYEGNEKFYYKILLPTSHLILSP-EIAHKFAVFMGKHNLFPKFSNSSYPDLSVKLFGLQFSHPVGIAAGFDKQGEAILGLLNAGFSHVEVGSVTPEPQAGNICPRVFRLVNDEAVINRYGFNSDGHRVVRDRLSNIDWKGKGVVGVNLGINKHTNDPAGDYVTGVERFGEICDYLVINVSSPNTEGLRLLQKENQLRETLNRVMKARDALPRKTPILLKISPDETDEDVKNIVKVSLEQN--IDGFIVCNTSNSRDGLLSSAELVA--------------ETGGLSGKPLRDKSTELISRISTLTNGRVPXXXXXXXXXXKDAWLKLMAGASLIQLYTSMVFYGPPIVKKVTRELDE 1265
            ++++ SL ++ + F +F+   +Y GNE FY    LPT+ L++   E AH  +V++  H   P    +S+P L  K+FGL+F HP+G+AAGFDK GEA +GLLNAGFSH+EVG+VTP+PQ GN  PR+FR    +AVINR GFNSDGH  V +RL N  W+G+GV+GVNLG NK + DP  DYV GV +FGE+ DYLVINVSSPNT GLR LQ   +LR+ L++V+ AR+ L +KTPILLKISPDE D+ +K+IV V+L+    IDG I+ NT+     L +  E VA                GGLSG+PL +KST+ + ++S LT G +P+IGVGG+S G+DA  KL AGASL+QLYTS V+ GPP+  KV RE+++
Sbjct:    2 SRIRTSLGVLSLGFGLFTAEALYSGNEHFYKDWFLPTARLLVRDGETAHNLSVYLASHGFIPHKPRNSFPQLKCKVFGLEFDHPIGLAAGFDKNGEAFMGLLNAGFSHIEVGTVTPDPQPGNARPRIFRWTKKQAVINRCGFNSDGHDAVYERLKNRPWEGRGVIGVNLGCNKTSTDPTADYVAGVRKFGEVADYLVINVSSPNTPGLRSLQNREKLRDLLSKVLTARNQLLKKTPILLKISPDENDQSLKDIVDVALDSKTRIDGMIISNTT-----LATYEEAVACGAAPIPGNNEQNVVYGGLSGRPLFEKSTDCLRKVSALTKGAIPLIGVGGISCGEDALSKLNAGASLVQLYTSFVYQGPPVAHKVAREINK 374          
BLAST of Dihydroorotate dehydrogenase (Quinone), mitochondrial vs. TrEMBL
Match: G4VFD7 (Dihydroorotate dehydrogenase OS=Schistosoma mansoni OX=6183 GN=Smp_078730 PE=4 SV=1)

HSP 1 Score: 375.941 bits (964), Expect = 2.424e-124
Identity = 193/378 (51.06%), Postives = 264/378 (69.84%), Query Frame = 3
Query:  183 AQLKNSLSMIGMSFCMFSGYCIYEGNEKFYYKILLPTSHLILSP-EIAHKFAVFMGKHNLFPKFSNSSYPDLSVKLFGLQFSHPVGIAAGFDKQGEAILGLLNAGFSHVEVGSVTPEPQAGNICPRVFRLVNDEAVINRYGFNSDGHRVVRDRLSNIDWKGKGVVGVNLGINKHTNDPAGDYVTGVERFGEICDYLVINVSSPNTEGLRLLQKENQLRETLNRVMKARDALPRKTPILLKISPDETDEDVKNIVKVSLEQN--IDGFIVCNTSNSRDGLLSSAELVA--------------ETGGLSGKPLRDKSTELISRISTLTNGRVPXXXXXXXXXXKDAWLKLMAGASLIQLYTSMVFYGPPIVKKVTRELDE 1265
            ++++ SL ++ + F +F+   +Y GNE FY    LPT+ L++   E AH  +V++  +   P    +S+P L  K+FGL+F HP+G+AAGFDK G+A +GLLNAGFSH+EVG+VTP PQ GN  PR+FR    EAV+NR GFNSDGH  V +RL +  W+G+GV+GVNLG NK + DP  DYV GV +FGE+ DYLVINVSSPNT GLR LQ + +LR+ L++V+ AR+ L +KTPILLKISPDE D+++K+IV+V+L+    IDG I+ NT+     L +  E VA                GGLSG+PL +KST+ + ++S LT G +P+IGVGG+S G+DA  KL AGASL+QLYTS V+ GPP+  KV RE+++
Sbjct:    2 SRIRTSLEVLSLGFGLFTAEALYSGNEHFYKDWFLPTARLLVRDGETAHNLSVYLASYGFIPHKQRNSFPQLKCKVFGLEFDHPIGLAAGFDKDGKAFMGLLNAGFSHIEVGTVTPNPQLGNARPRIFRWTEKEAVVNRCGFNSDGHDAVYERLKDRPWEGRGVIGVNLGCNKTSADPTADYVAGVRKFGEVADYLVINVSSPNTPGLRSLQTKEKLRDLLSKVLAARNQLSKKTPILLKISPDENDQNLKDIVEVALDSKTRIDGMIISNTT-----LTTYEEAVACGAAPIPGNNKQNVVYGGLSGRPLFEKSTDCLRKVSALTKGAIPLIGVGGISCGEDALSKLNAGASLVQLYTSFVYQGPPVAHKVAREINK 374          
BLAST of Dihydroorotate dehydrogenase (Quinone), mitochondrial vs. TrEMBL
Match: A0A094ZN75 (Dihydroorotate dehydrogenase (Quinone), mitochondrial OS=Schistosoma haematobium OX=6185 GN=MS3_04413 PE=4 SV=1)

HSP 1 Score: 379.793 bits (974), Expect = 4.229e-124
Identity = 197/381 (51.71%), Postives = 264/381 (69.29%), Query Frame = 3
Query:  174 NIGAQLKNSLSMIGMSFCMFSGYCIYEGNEKFYYKILLPTSH-LILSPEIAHKFAVFMGKHNLFPKFSNSSYPDLSVKLFGLQFSHPVGIAAGFDKQGEAILGLLNAGFSHVEVGSVTPEPQAGNICPRVFRLVNDEAVINRYGFNSDGHRVVRDRLSNIDWKGKGVVGVNLGINKHTNDPAGDYVTGVERFGEICDYLVINVSSPNTEGLRLLQKENQLRETLNRVMKARDALPRKTPILLKISPDETDEDVKNIVKVSLEQN--IDGFIVCNTSNSRDGLLSSAELVA--------------ETGGLSGKPLRDKSTELISRISTLTNGRVPXXXXXXXXXXKDAWLKLMAGASLIQLYTSMVFYGPPIVKKVTRELDE 1265
            +I ++++ SL ++ + F +F+   +Y GNE FY    LPT+  L+   E AH  +V++  H   P    +S+P L  K+FGL+F HP+G+AAGFDK GEA +GLLNAGFSH+EVG+VTP+PQ GN  PR+FR    EAVINR GFNSDGH  V +RL +  W+G+GV+GVNLG NK + DP  DYV GV +FGE+ DYLVINVSSPNT GLR LQ   +LR+ L++V+ AR+ L +KTPILLKISPDE D+ +K+IV+V+L+    IDG I+ NT+     L +  E VA                GGLSG+PL +KST+ + ++S LT G +P+IGVGG+S G+DA  KL AGASL+QLYTS V+ GPP+  KV RE+++
Sbjct:  122 SIMSRIRTSLGVLSLGFGLFTAEALYSGNEHFYKDWFLPTARILVRDGETAHNLSVYLASHGFIPHKPRNSFPHLKCKVFGLEFDHPIGLAAGFDKNGEAFMGLLNAGFSHIEVGTVTPDPQPGNTRPRIFRWTKKEAVINRCGFNSDGHDAVYERLKDRPWEGRGVIGVNLGCNKTSTDPTADYVAGVRKFGEVADYLVINVSSPNTPGLRSLQTREKLRDLLSKVLSARNQLLKKTPILLKISPDENDQSLKDIVEVALDSKTRIDGMIISNTT-----LATYEEAVACGAAPIPGNNEQNVVYGGLSGRPLFEKSTDCLRKVSALTKGAIPLIGVGGISCGEDALSKLNAGASLVQLYTSFVYQGPPVAHKVAREINK 497          
BLAST of Dihydroorotate dehydrogenase (Quinone), mitochondrial vs. TrEMBL
Match: G7Y8A2 (Dihydroorotate dehydrogenase (quinone), mitochondrial OS=Clonorchis sinensis OX=79923 GN=CLF_102644 PE=3 SV=1)

HSP 1 Score: 373.629 bits (958), Expect = 2.399e-123
Identity = 197/384 (51.30%), Postives = 273/384 (71.09%), Query Frame = 3
Query:  177 IGAQLKNSLSMIGMSFCMFSGYCIYEGNEKFYYKILLPTSH-LILSPEIAHKFAVFMGKHNLFPKFSNSSYPDLSVKLFGLQFSHPVGIAAGFDKQGEAILGLLNAGFSHVEVGSVTPEPQAGNICPRVFRLVNDEAVINRYGFNSDGHRVVRDRLSNIDWKGKGVVGVNLGINKHTNDPAGDYVTGVERFGEICDYLVINVSSPNTEGLRLLQKENQLRETLNRVMKARDALPRKTPILLKISPDETDEDVKNIVKVSLE--QNIDGFIVCNTS-NSRDGLLSS------AELVAET-----GGLSGKPLRDKSTELISRISTLTNGRVPXXXXXXXXXXKDAWLKLMAGASLIQLYTSMVFYGPPIVKKVTRELDEEMRNSE 1283
            + ++L+++  ++G+   +F+   IY GNE+FY +IL+P  H +I   E AH  AV   ++   P   +++ P L   +FGL F HPVG+AAGFDK GEAI+GLL+AGFSHVEVG+VTP+PQ GN  PRVFR    EAVINRYGFNS+GH  V +RL +  WKG+GVVGVNLG NK + DP  D+V GV++FGE+ DYLVIN+SSPNT GLR +Q + +L+E L +V+ AR  L ++TP+LLKISPDE+DE +K+IV+ ++     +DG IV NTS  S D  L+        EL   +     GGLSG+PL D+ST  +++++ LT G++P++GVGGVS G+DA  KL AGASL+QLYT +++ GPP+V++VTREL+E + N +
Sbjct:    1 MSSRLRSTAMVLGLGLGLFTAEAIYSGNERFYREILMPALHKVIPDGETAHLLAVKALRYGFGPHRRDAAVPSLRRNVFGLDFGHPVGVAAGFDKNGEAIIGLLDAGFSHVEVGTVTPKPQPGNPRPRVFRWPEREAVINRYGFNSEGHDAVYERLKDRVWKGRGVVGVNLGCNKQSPDPVADFVAGVKKFGEVADYLVINLSSPNTPGLRSMQNKQKLKELLGQVLSARSKLTKRTPVLLKISPDESDESLKDIVETAMNPTTKVDGLIVSNTSLASYDEALACHAAPPPDELNTPSDGIVWGGLSGRPLFDRSTVCLTKVAALTKGQLPLVGVGGVSDGEDAAKKLSAGASLVQLYTGLIYQGPPVVRRVTRELEELVTNGD 384          
BLAST of Dihydroorotate dehydrogenase (Quinone), mitochondrial vs. TrEMBL
Match: A0A4V3SCC6 (Dihydroorotate dehydrogenase (quinone), mitochondrial OS=Opisthorchis felineus OX=147828 GN=CRM22_010182 PE=3 SV=1)

HSP 1 Score: 373.629 bits (958), Expect = 3.443e-123
Identity = 195/385 (50.65%), Postives = 269/385 (69.87%), Query Frame = 3
Query:  174 NIGAQLKNSLSMIGMSFCMFSGYCIYEGNEKFYYKILLPTSH-LILSPEIAHKFAVFMGKHNLFPKFSNSSYPDLSVKLFGLQFSHPVGIAAGFDKQGEAILGLLNAGFSHVEVGSVTPEPQAGNICPRVFRLVNDEAVINRYGFNSDGHRVVRDRLSNIDWKGKGVVGVNLGINKHTNDPAGDYVTGVERFGEICDYLVINVSSPNTEGLRLLQKENQLRETLNRVMKARDALPRKTPILLKISPDETDEDVKNIVKVSLE--QNIDGFIVCNTS-NSRDGLLSSAELVAET-----------GGLSGKPLRDKSTELISRISTLTNGRVPXXXXXXXXXXKDAWLKLMAGASLIQLYTSMVFYGPPIVKKVTRELDEEMRNSE 1283
            ++ ++L+++  ++G+   +F+   IY GNE+FY ++L+P  H  I   E AH  AV   ++   P   + + P L   +FGL F HPVG+AAGFDK GEAI+GLL+AGFSHVEVG+VTP+PQ GN  PRVFR    EAVINRYGFNS+GH  V +RL +  WKG+GVVGVNLG NK + DP  D+V GV++FGE+ DYLVINVSSPNT GLR +Q + +L+E L +V+ AR  L ++TP+LLKISPDE+DE +K+IV+ ++     +DG IV NTS  S D  L+                   GGLSG+PL D+ST  +++++ LT G++P++GVGG+S G+DA  KL AGASL+QLYT M++ GPP+V++VTREL+E + N +
Sbjct:    4 SMSSRLRSTAMVLGLGLGLFTAQAIYSGNERFYRELLMPALHKAIPDGETAHFLAVKALRYGFGPHRRDVAVPSLRCNVFGLDFDHPVGVAAGFDKNGEAIIGLLDAGFSHVEVGTVTPKPQPGNPRPRVFRWPEREAVINRYGFNSEGHDAVYERLKDRVWKGRGVVGVNLGCNKQSPDPVADFVAGVKKFGEVADYLVINVSSPNTAGLRSMQNKRKLKELLGQVLSARSKLTKRTPVLLKISPDESDESLKDIVETAMNPMTKVDGLIVSNTSLASYDEALACHAAPPPDELDTLSDGVVWGGLSGRPLFDRSTVCLTKVAALTKGQLPLVGVGGISDGEDAAKKLSAGASLVQLYTGMIYQGPPVVRRVTRELEELVTNGD 388          
BLAST of Dihydroorotate dehydrogenase (Quinone), mitochondrial vs. Ensembl Cavefish
Match: dhodh (dihydroorotate dehydrogenase (quinone) [Source:NCBI gene;Acc:103040150])

HSP 1 Score: 317.775 bits (813), Expect = 2.002e-104
Identity = 178/380 (46.84%), Postives = 245/380 (64.47%), Query Frame = 3
Query:  186 QLKNSLSMIGMSFCMFSGYCIYEGNEKFYYKILLPTSHLILSPEIAHKFAVFMGKHNLFPKFSNSSYPDLSVKLFGLQFSHPVGIAAGFDKQGEAILGLLNAGFSHVEVGSVTPEPQAGNICPRVFRLVNDEAVINRYGFNSDGHRVVRDRL-----SNIDWKGKG-VVGVNLGINKHTNDPAGDYVTGVERFGEICDYLVINVSSPNTEGLRLLQKENQLRETLNRVMKARDALPRKT--PILLKISPDETDEDVKNIVKVSLEQNIDGFIVCNTSNSRDGLLSSAELVAETGGLSGKPLRDKSTELISRISTLTNGRVPXXXXXXXXXXKDAWLKLMAGASLIQLYTSMVFYGPPIVKKVTRELDEEMRNSEFSNLHE 1301
            +LK+++ ++G    +F GY    G+E+FY   L+P    ++  E+AH  AV +    L P+        L V + G +F +PVG+AAGFDK GEA+  L   GF  VEVG+VTP+PQ GN  PRVFRL  D+AVINRYGFNS G   V +RL     + ++    G  +G+NLG NK + D   DY+ GV   G + DYLVINVSSPNT GLR LQ + +LR  L +V+K RD+L  K   P+L+KI+PD + +D ++I +V  E  +DG IV NT+ SR   L   +   E GGLSG+PL+D ST ++  + TLT G+VPIIGVGG++ G+DA  K+ AGASL+QLYT++V+ GPP+V K+ RELDE +    F+N+ E
Sbjct:    8 RLKDAVKILGCGSALFLGYLTASGDERFYASTLMPVMQKLVGAEMAHVMAVRLLSLGLVPRNRYQDPASLEVTVMGQRFRNPVGMAAGFDKHGEAVDTLYQLGFGFVEVGTVTPKPQEGNPKPRVFRLEADQAVINRYGFNSCGLLAVEERLKTRAGTQLELARAGRPLGINLGKNKLSTDAVADYLEGVRTLGPLADYLVINVSSPNTPGLRDLQGKKELRHLLAKVLKERDSLQGKNGPPVLVKIAPDLSQQDKQDIAEVITELGVDGLIVSNTTVSRPETLQDPK-KNEIGGLSGQPLKDMSTRMVREMYTLTKGKVPIIGVGGIACGQDALDKIRAGASLVQLYTALVYQGPPVVTKIKRELDELLIAQGFTNVSE 386          
BLAST of Dihydroorotate dehydrogenase (Quinone), mitochondrial vs. Ensembl Sea Lamprey
Match: dhodh (dihydroorotate dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-030131-3157])

HSP 1 Score: 330.487 bits (846), Expect = 1.680e-110
Identity = 182/390 (46.67%), Postives = 256/390 (65.64%), Query Frame = 3
Query:  186 QLKNSLSMIGMSFCMFSGYCIYEGNEKFYYKILLPTSHLILSPEIAHKFAVFMGKHNLFPKF--SNSSYPDLSVKLFGLQFSHPVGIAAGFDKQGEAILGLLNAGFSHVEVGSVTPEPQAGNICPRVFRLVNDEAVINRYGFNSDGHRVVRDRL-SNIDW-----KGKGVVGVNLGINKHTNDPAGDYVTGVERFGEICDYLVINVSSPNTEGLRLLQKENQLRETLNRVMKARDAL--PRKTPILLKISPDETDEDVKNIVKVSLEQNIDGFIVCNTSNSRDGLLSSAELVAETGGLSGKPLRDKSTELISRISTLTNGRVPXXXXXXXXXXKDAWLKLMAGASLIQLYTSMVFYGPPIVKKVTRELDEEMRNSEFSNLHEFLWKRNLE 1325
            +L+ +L ++G    +F+G+    G+E+FY ++L+P    ++ PE AH  ++ +    L P+   + +  P L  ++FG  F++PVGIAAGFDK GEA+ GL + G   VEVGS+TP PQ GN  PRVFRL  D AVINRYGFNSDGH VV  RL +  D      +G   +G+NLG NK +   A DYV GV RFG + DYLV+NVS PNT GL++LQ  ++LR  L +V++ARDAL  P +  +LLKI+PD TDE  ++I  V  E  +DG IV NT+ SR   L SA    ETGGLSG PLR+ ST+ +  +  LT G VPI+GVGG+++G DA+ K+ AGASL+QLYT++++ GPP++ +V REL + +    +S++ E +   + E
Sbjct:    2 RLREALLVLGGGVAIFAGHATVSGDERFYRELLMPALRRVVPPEAAHTLSIRLLALGLGPRLRPTRNDGPALETRVFGRTFANPVGIAAGFDKHGEAVDGLFHLGLGFVEVGSITPLPQPGNPKPRVFRLSEDSAVINRYGFNSDGHEVVAARLGARADAQKELSRGGHPLGINLGKNKLSPSAADDYVAGVTRFGPLADYLVVNVSCPNTPGLQVLQGCSELRALLQQVVRARDALPTPHRPALLLKIAPDLTDEAKRDIAAVVTEMGVDGLIVSNTTLSRPAGLQSAHRT-ETGGLSGVPLRELSTQTVRDMYKLTGGSVPIVGVGGITNGADAFEKINAGASLVQLYTALMYQGPPVIARVKRELQDLLSEHGYSSVAEAVGAEHRE 390          
BLAST of Dihydroorotate dehydrogenase (Quinone), mitochondrial vs. Ensembl Nematostella
Match: EDO35448 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLG1])

HSP 1 Score: 329.331 bits (843), Expect = 9.605e-110
Identity = 188/378 (49.74%), Postives = 248/378 (65.61%), Query Frame = 3
Query:  189 LKNSLSMIGMSFCMFSGYCIYEGNEKFYYKILLPTSHLILSPEIAHKFAVFMGKHNLFPKFSNSSYPDLSVKLFGLQFSHPVGIAAGFDKQGEAILGLLNAGFSHVEVGSVTPEPQAGNICPRVFRLVNDEAVINRYGFNSDGHRVVRDRLSNIDWKG---KGVVGVNLGINKHTNDPAGDYVTGVERFGEICDYLVINVSSPNTEGLRLLQKENQLRETLNRVMKA-RDALPR-KTPILLKISPDETDEDVKNIVKVSLEQ--NIDGFIVCNTSNSRDGLLSSAELVAETGGLSGKPLRDKSTELISRISTLTNGRVPXXXXXXXXXXKDAWLKLMAGASLIQLYTSMVFYGPPIVKKVTRELDEEMRNSEFSNLHE 1301
            L++ L++IG +  +F GY    GNEKFY  +++P   L L  E AH  AV    +   P+  N     L+ K+FGLQFS+PVG+AAGFDK  EA+ GLL  GF  VEVGSVTPEPQ GN  PRVFRLV D+AVINRYGFNSDGH+    RL +   +    KGV+G+N+G NK + D   DYV GV+ F  +  YLVIN+SSPNT GLR LQ   +L + ++  ++A R A P  + P+L+KI+PD T+ED  +I  V   Q   IDG IV NT+ +R   L S     E GGLSG PLR+ ST  +  +  LT G++PIIGVGG+SSG+DA+ K+ AGASL+QLYT++ + GPP+V+K+ REL E +R   F ++ E
Sbjct:   13 LRHGLALIGCTGVVFGGYYTMTGNEKFYSTVVMPAIRL-LDAERAHLLAVKAAAYGWTPQDKNKDPEILNTKVFGLQFSNPVGLAAGFDKHAEAVDGLLKMGFGFVEVGSVTPEPQPGNPKPRVFRLVEDQAVINRYGFNSDGHKAASKRLQDRLARSGHPKGVLGINVGKNKTSPDAVSDYVKGVKCFSPLAHYLVINISSPNTPGLRALQGREELTQLIDNALEARRQASPSAQPPLLVKIAPDLTEEDKIDIASVITRQGHQIDGLIVSNTTITRPSTLQSPNKT-EQGGLSGAPLREMSTGAVGDMYRLTEGKIPIIGVGGISSGQDAYDKIKAGASLVQLYTALAYQGPPVVRKIKRELAELLRKDGFGSVQE 388          
BLAST of Dihydroorotate dehydrogenase (Quinone), mitochondrial vs. Ensembl Nematostella
Match: EDO27412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9B5])

HSP 1 Score: 114.775 bits (286), Expect = 9.729e-30
Identity = 83/202 (41.09%), Postives = 122/202 (60.40%), Query Frame = 3
Query:  672 VGVNLGINKHT-NDPAGD-YVTGVERFGEICDYLVINVSSPNTEGLRLLQKENQLRETLNRVM--KARDA--LPRKTPILLKISPDETDEDVKNIVKVSLEQNIDGFIVCNTSNSRDGLLSSAELVAETGGLSGKPLRDKSTELISRISTLTNGRVPXXXXXXXXXXKDAWLKLMAGASLIQLYTSMVFYGPPIVKKVTREL 1259
            +G+N+G NK T N+ A D Y+  + +      Y+ +NVSSPNT GLR LQ  + L   L  +   +AR A    R  PI +KI+PD T+E+V  + +      IDG I  NT+ SR+G+  S  +  E GGLSG P+R+KST +I  +S   +G +PIIGVGG++ G DA  K+ AGASL+Q+Y+  ++ GP ++    R +
Sbjct:    1 LGINIGKNKDTPNENANDDYLYCLRKVYSRASYVTVNVSSPNTPGLRTLQFGDSLNTLLEALKNEQARQAGLHDRYVPIAVKIAPDMTEEEVAMVAESLKTYEIDGVIATNTTLSREGVEDSP-VHHEAGGLSGAPVRNKSTRVIRLLSKELSGALPIIGVGGITEGFDAAEKIEAGASLVQIYSGFIYKGPSLITDSVRAI 201          
BLAST of Dihydroorotate dehydrogenase (Quinone), mitochondrial vs. Ensembl Medaka
Match: dhodh (dihydroorotate dehydrogenase (quinone) [Source:NCBI gene;Acc:101170010])

HSP 1 Score: 321.242 bits (822), Expect = 4.158e-106
Identity = 185/386 (47.93%), Postives = 247/386 (63.99%), Query Frame = 3
Query:  186 QLKNSLSMIGMSFCMFSGYCIYEGNEKFYYKILLPTSHLILSPEIAHKFAVFMGKHNLFPKFSNSSYPDLSVKLFGLQFSHPVGIAAGFDKQGEAILGLLNAGFSHVEVGSVTPEPQAGNICPRVFRLVNDEAVINRYGFNSDGHRVVRDRLSNIDWKGKGV------VGVNLGINKHTNDPAGDYVTGVERFGEICDYLVINVSSPNTEGLRLLQKENQLRETLNRVMKARDALP--RKTPILLKISPDETDEDVKNIVKVSLEQNIDGFIVCNTSNSRDGLLSSAELVAETGGLSGKPLRDKSTELISRISTLTNGRVPXXXXXXXXXXKDAWLKLMAGASLIQLYTSMVFYGPPIVKKVTRELDEEMRNSEFSNLHEFLWKRN 1319
            +LK+++ +IG    +F+ Y    G+E+FY   L+P    I+ PE+AH FAV +    L P         L V   GL+F +P+GIAAGFDK GEA+  L   GF  VEVG+VTP+PQ GN  PRVFRL  D AVINRYGFNS G   V+ RL   +   + +      +G+NLG NK + D A DY  GV+  G + DYLV+NVSSPNT GLR LQ + +LR+ L  V+K RDALP   + P+LLKI+PD T +D ++I  V  E  +DG +V NT+ SR   L    L  ETGGLSG+PL++ ST  +  +  LT G+VPIIG+GGV+SG+DA  K+ AGASLIQLYTS+ + GPP+V KV REL++ +++  FS + E +   N
Sbjct:    8 RLKDAVKVIGSGSLLFASYLTAVGDERFYANQLMPLLQRIVGPEMAHVFAVKIMGMGLVPLNRYQDPAALEVTTLGLKFKNPIGIAAGFDKHGEAVDALYKLGFGFVEVGTVTPKPQEGNPKPRVFRLPADNAVINRYGFNSCGLAEVQTRLKAREETQQQLTKTGLPLGINLGKNKLSQDAAADYKEGVKALGPLADYLVVNVSSPNTPGLRDLQGKAELRQLLCTVLKERDALPDAHRPPVLLKIAPDLTAQDKRDIADVVAELGVDGLMVTNTTVSRPETLQDP-LKYETGGLSGQPLKEMSTNTVREMYKLTKGKVPIIGIGGVASGQDAMDKIRAGASLIQLYTSLTYQGPPVVTKVKRELEDLLKDQGFSCVAEAVGADN 392          
BLAST of Dihydroorotate dehydrogenase (Quinone), mitochondrial vs. Planmine SMEST
Match: SMESG000065729.1 (SMESG000065729.1)

HSP 1 Score: 790.801 bits (2041), Expect = 0.000e+0
Identity = 395/395 (100.00%), Postives = 395/395 (100.00%), Query Frame = 3
Query:  159 MRFHPNIGAQLKNSLSMIGMSFCMFSGYCIYEGNEKFYYKILLPTSHLILSPEIAHKFAVFMGKHNLFPKFSNSSYPDLSVKLFGLQFSHPVGIAAGFDKQGEAILGLLNAGFSHVEVGSVTPEPQAGNICPRVFRLVNDEAVINRYGFNSDGHRVVRDRLSNIDWKGKGVVGVNLGINKHTNDPAGDYVTGVERFGEICDYLVINVSSPNTEGLRLLQKENQLRETLNRVMKARDALPRKTPILLKISPDETDEDVKNIVKVSLEQNIDGFIVCNTSNSRDGLLSSAELVAETGGLSGKPLRDKSTELISRISTLTNGRVPXXXXXXXXXXKDAWLKLMAGASLIQLYTSMVFYGPPIVKKVTRELDEEMRNSEFSNLHEFLWKRNLEKQIVVQ 1343
            MRFHPNIGAQLKNSLSMIGMSFCMFSGYCIYEGNEKFYYKILLPTSHLILSPEIAHKFAVFMGKHNLFPKFSNSSYPDLSVKLFGLQFSHPVGIAAGFDKQGEAILGLLNAGFSHVEVGSVTPEPQAGNICPRVFRLVNDEAVINRYGFNSDGHRVVRDRLSNIDWKGKGVVGVNLGINKHTNDPAGDYVTGVERFGEICDYLVINVSSPNTEGLRLLQKENQLRETLNRVMKARDALPRKTPILLKISPDETDEDVKNIVKVSLEQNIDGFIVCNTSNSRDGLLSSAELVAETGGLSGKPLRDKSTELISRISTLTNGRVPIIGVGGVSSGKDAWLKLMAGASLIQLYTSMVFYGPPIVKKVTRELDEEMRNSEFSNLHEFLWKRNLEKQIVVQ
Sbjct:    1 MRFHPNIGAQLKNSLSMIGMSFCMFSGYCIYEGNEKFYYKILLPTSHLILSPEIAHKFAVFMGKHNLFPKFSNSSYPDLSVKLFGLQFSHPVGIAAGFDKQGEAILGLLNAGFSHVEVGSVTPEPQAGNICPRVFRLVNDEAVINRYGFNSDGHRVVRDRLSNIDWKGKGVVGVNLGINKHTNDPAGDYVTGVERFGEICDYLVINVSSPNTEGLRLLQKENQLRETLNRVMKARDALPRKTPILLKISPDETDEDVKNIVKVSLEQNIDGFIVCNTSNSRDGLLSSAELVAETGGLSGKPLRDKSTELISRISTLTNGRVPIIGVGGVSSGKDAWLKLMAGASLIQLYTSMVFYGPPIVKKVTRELDEEMRNSEFSNLHEFLWKRNLEKQIVVQ 395          
The following BLAST results are available for this feature:
BLAST of Dihydroorotate dehydrogenase (Quinone), mitochondrial vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
DHODH1.459e-10849.47dihydroorotate dehydrogenase (quinone) [Source:HGN... [more]
DHODH6.940e-10548.95dihydroorotate dehydrogenase (quinone) [Source:HGN... [more]
DHODH9.711e-4147.44dihydroorotate dehydrogenase (quinone) [Source:HGN... [more]
DHODH3.369e-3852.59dihydroorotate dehydrogenase (quinone) [Source:HGN... [more]
back to top
BLAST of Dihydroorotate dehydrogenase (Quinone), mitochondrial vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dhod-16.334e-9644.92Dihydroorotate dehydrogenase (quinone), mitochondr... [more]
dhod-16.334e-9644.92Dihydroorotate dehydrogenase (quinone), mitochondr... [more]
back to top
BLAST of Dihydroorotate dehydrogenase (Quinone), mitochondrial vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Dhod4.011e-9547.86gene:FBgn0000447 transcript:FBtr0300442[more]
Dhod4.011e-9547.86gene:FBgn0000447 transcript:FBtr0081890[more]
back to top
BLAST of Dihydroorotate dehydrogenase (Quinone), mitochondrial vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dhodh2.409e-10346.98dihydroorotate dehydrogenase [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Dihydroorotate dehydrogenase (Quinone), mitochondrial vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
piezo12.809e-10048.63piezo-type mechanosensitive ion channel component ... [more]
piezo11.093e-9748.14piezo-type mechanosensitive ion channel component ... [more]
piezo12.135e-9448.15piezo-type mechanosensitive ion channel component ... [more]
back to top
BLAST of Dihydroorotate dehydrogenase (Quinone), mitochondrial vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dhodh5.810e-10749.07dihydroorotate dehydrogenase [Source:MGI Symbol;Ac... [more]
Dhodh6.642e-7246.92dihydroorotate dehydrogenase [Source:MGI Symbol;Ac... [more]
Dhodh1.367e-3446.00dihydroorotate dehydrogenase [Source:MGI Symbol;Ac... [more]
Dhodh1.844e-2752.43dihydroorotate dehydrogenase [Source:MGI Symbol;Ac... [more]
Dhodh1.820e-2364.29dihydroorotate dehydrogenase [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Dihydroorotate dehydrogenase (Quinone), mitochondrial vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q63707|PYRD_RAT1.537e-10849.34Dihydroorotate dehydrogenase (quinone), mitochondr... [more]
sp|Q02127|PYRD_HUMAN7.005e-10849.47Dihydroorotate dehydrogenase (quinone), mitochondr... [more]
sp|O35435|PYRD_MOUSE4.064e-10649.07Dihydroorotate dehydrogenase (quinone), mitochondr... [more]
sp|Q5E9W3|PYRD_BOVIN2.153e-10547.89Dihydroorotate dehydrogenase (quinone), mitochondr... [more]
sp|Q5R6X6|PYRD_PONAB2.799e-10448.95Dihydroorotate dehydrogenase (quinone), mitochondr... [more]
back to top
BLAST of Dihydroorotate dehydrogenase (Quinone), mitochondrial vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183LA781.039e-12551.85DHO_dh domain-containing protein OS=Schistosoma ma... [more]
G4VFD72.424e-12451.06Dihydroorotate dehydrogenase OS=Schistosoma manson... [more]
A0A094ZN754.229e-12451.71Dihydroorotate dehydrogenase (Quinone), mitochondr... [more]
G7Y8A22.399e-12351.30Dihydroorotate dehydrogenase (quinone), mitochondr... [more]
A0A4V3SCC63.443e-12350.65Dihydroorotate dehydrogenase (quinone), mitochondr... [more]
back to top
BLAST of Dihydroorotate dehydrogenase (Quinone), mitochondrial vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dhodh2.002e-10446.84dihydroorotate dehydrogenase (quinone) [Source:NCB... [more]
back to top
BLAST of Dihydroorotate dehydrogenase (Quinone), mitochondrial vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dhodh1.680e-11046.67dihydroorotate dehydrogenase [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Dihydroorotate dehydrogenase (Quinone), mitochondrial vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dihydroorotate dehydrogenase (Quinone), mitochondrial vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO354489.605e-11049.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO274129.729e-3041.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dihydroorotate dehydrogenase (Quinone), mitochondrial vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dhodh4.158e-10647.93dihydroorotate dehydrogenase (quinone) [Source:NCB... [more]
back to top
BLAST of Dihydroorotate dehydrogenase (Quinone), mitochondrial vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000065729.10.000e+0100.00SMESG000065729.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022035 ID=SMED30022035|Name=Dihydroorotate dehydrogenase (Quinone), mitochondrial|organism=Schmidtea mediterranea sexual|type=transcript|length=1371bp
TTTTTTTTTCATTGTATAATTTTGAAATATATACATTAAATTACGTGTTG
CATAACTCTTATTTTATATATTGAATATTTTTTATCTAAGTTTTTATTTT
TCATATTTTTTATTAAATTCTAGTATTTTTTCTAATATAGCATTTTAAAG
GACTTCTAATGCGATTTCATCCTAATATTGGTGCTCAACTAAAAAATTCC
CTTTCTATGATTGGAATGAGTTTCTGTATGTTTAGTGGTTATTGCATTTA
CGAAGGGAATGAAAAATTCTATTATAAAATATTGCTTCCAACTTCTCATT
TGATTTTATCACCGGAAATAGCTCACAAATTTGCGGTTTTTATGGGCAAA
CATAATCTGTTTCCTAAATTCTCGAATTCTTCATATCCCGATCTTAGCGT
TAAATTATTCGGATTGCAATTTAGTCACCCGGTAGGAATTGCTGCAGGAT
TTGACAAGCAAGGCGAGGCAATTTTAGGCCTGCTTAATGCGGGATTTTCT
CACGTTGAAGTCGGCAGTGTCACTCCGGAACCACAAGCGGGAAATATTTG
CCCCCGAGTGTTCCGATTAGTAAATGATGAAGCCGTAATTAATCGATACG
GATTCAATAGCGATGGACATCGAGTTGTGCGGGACAGATTGAGCAATATC
GACTGGAAAGGCAAAGGAGTTGTCGGAGTCAATTTGGGAATCAATAAGCA
CACAAATGATCCGGCTGGCGATTACGTGACGGGAGTTGAACGGTTCGGGG
AGATTTGTGATTATCTCGTGATCAATGTGTCGAGCCCAAATACGGAGGGA
CTGAGGCTGTTACAGAAGGAGAATCAGTTGAGGGAGACTCTCAATCGGGT
GATGAAGGCGAGGGACGCCTTACCGAGGAAAACGCCAATACTGCTGAAAA
TATCTCCAGATGAAACAGACGAAGACGTTAAAAATATAGTCAAAGTCAGC
TTGGAGCAAAACATTGACGGGTTCATAGTATGCAACACTAGCAATTCTCG
AGATGGGCTATTGAGCTCGGCGGAATTAGTCGCTGAAACTGGCGGATTAT
CAGGTAAACCATTGAGAGACAAATCAACGGAATTGATTTCGCGCATTTCA
ACGCTAACGAACGGCCGAGTTCCAATTATCGGAGTAGGGGGTGTCAGTAG
CGGCAAAGATGCGTGGTTGAAATTGATGGCTGGCGCATCTTTGATACAGC
TATACACTTCTATGGTTTTTTACGGGCCGCCAATTGTGAAAAAAGTCACT
AGAGAATTGGACGAGGAAATGCGGAATTCTGAATTTAGTAATCTTCATGA
ATTTCTTTGGAAACGAAATTTAGAAAAGCAAATTGTAGTTCAATAAATTT
TTTTGCATTTTTCAAAAAAAA
back to top

protein sequence of SMED30022035-orf-1

>SMED30022035-orf-1 ID=SMED30022035-orf-1|Name=SMED30022035-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=396bp
MRFHPNIGAQLKNSLSMIGMSFCMFSGYCIYEGNEKFYYKILLPTSHLIL
SPEIAHKFAVFMGKHNLFPKFSNSSYPDLSVKLFGLQFSHPVGIAAGFDK
QGEAILGLLNAGFSHVEVGSVTPEPQAGNICPRVFRLVNDEAVINRYGFN
SDGHRVVRDRLSNIDWKGKGVVGVNLGINKHTNDPAGDYVTGVERFGEIC
DYLVINVSSPNTEGLRLLQKENQLRETLNRVMKARDALPRKTPILLKISP
DETDEDVKNIVKVSLEQNIDGFIVCNTSNSRDGLLSSAELVAETGGLSGK
PLRDKSTELISRISTLTNGRVPIIGVGGVSSGKDAWLKLMAGASLIQLYT
SMVFYGPPIVKKVTRELDEEMRNSEFSNLHEFLWKRNLEKQIVVQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR005719Dihydroorotate_DH_2
IPR005720Dihydroorotate_DH
IPR013785Aldolase_TIM
IPR001295Dihydroorotate_DH_CS
Vocabulary: molecular function
TermDefinition
GO:0016627oxidoreductase activity, acting on the CH-CH group of donors
GO:0003824catalytic activity
GO:0004152dihydroorotate dehydrogenase activity
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0006207'de novo' pyrimidine nucleobase biosynthetic process
GO:0007017microtubule-based process
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0016020membrane
GO:0030286dynein complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 217..237
NoneNo IPR availablePANTHERPTHR43517FAMILY NOT NAMEDcoord: 24..381
NoneNo IPR availableSUPERFAMILYSSF51395FMN-linked oxidoreductasescoord: 39..382
IPR005720Dihydroorotate dehydrogenase domainPFAMPF01180DHO_dhcoord: 79..371
e-value: 7.9E-93
score: 310.9
IPR005719Dihydroorotate dehydrogenase, class 2TIGRFAMTIGR01036TIGR01036coord: 42..381
e-value: 7.6E-107
score: 355.1
IPR005719Dihydroorotate dehydrogenase, class 2CDDcd04738DHOD_2_likecoord: 50..367
e-value: 1.99781E-165
score: 464.665
IPR013785Aldolase-type TIM barrelGENE3DG3DSA:3.20.20.70coord: 31..386
e-value: 8.4E-130
score: 434.8
IPR001295Dihydroorotate dehydrogenase, conserved sitePROSITEPS00911DHODEHASE_1coord: 114..133
IPR001295Dihydroorotate dehydrogenase, conserved sitePROSITEPS00912DHODEHASE_2coord: 323..343