EGR-like protein 1

Overview
NameEGR-like protein 1 (AEI69697.1)
Smed IDSMED30022030
Length (bp)734
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of EGR-like protein 1 (SMED30022030) t-SNE clustered cells

Violin plots show distribution of expression levels for EGR-like protein 1 (SMED30022030) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of EGR-like protein 1 (SMED30022030) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for EGR-like protein 1 (SMED30022030) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022030

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 18

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30022030SMESG000000960.1 SmedASXL_019323SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30022030SMESG000000960.1 SmedASXL_019323SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30022030SMESG000000959.1 dd_Smed_v4_12410_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30022030SMESG000000959.1 dd_Smed_v4_12410_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30022030SMESG000000959.1 dd_Smed_v4_12410_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30022030SMESG000000959.1 dd_Smed_v4_12410_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30022030SMESG000000959.1 dd_Smed_v4_12410_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30022030SMESG000000960.1 dd_Smed_v4_7731_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30022030SMESG000000960.1 dd_Smed_v4_7731_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30022030SMESG000000960.1 dd_Smed_v4_7731_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30022030SMESG000000960.1 dd_Smed_v4_7731_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30022030SMESG000000960.1 dd_Smed_v4_7731_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30022030SMESG000000959.1 dd_Smed_v6_12410_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022030SMESG000000960.1 dd_Smed_v4_7731_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30022030SMESG000000960.1 dd_Smed_v4_7731_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30022030SMESG000000960.1 SMED_23310_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30022030SMESG000000959.1 SMED_07471_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30022030SMESG000000959.1 SMED_07471_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of EGR-like protein 1 vs. Ensembl Human
Match: EGR4 (early growth response 4 [Source:HGNC Symbol;Acc:HGNC:3241])

HSP 1 Score: 102.449 bits (254), Expect = 1.659e-24
Identity = 46/79 (58.23%), Postives = 54/79 (68.35%), Query Frame = 2
Query:  437 KQFTC--NTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 667
            K F C   +C +SF R DEL RH RIHTG +P  C  C + F RSDHL+TH R HTGEKP+ C+VC R F RSDE+ RH
Sbjct:  378 KAFACPVESCVRSFARSDELNRHLRIHTGHKPFQCRICLRNFSRSDHLTTHVRTHTGEKPFACDVCGRRFARSDEKKRH 456          

HSP 2 Score: 64.6994 bits (156), Expect = 2.115e-11
Identity = 30/78 (38.46%), Postives = 42/78 (53.85%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHF 670
            K F C  C ++F R D L  H R HTGE+P AC+ C +RF RSD    H+++H  +K            R++ERL+  
Sbjct:  408 KPFQCRICLRNFSRSDHLTTHVRTHTGEKPFACDVCGRRFARSDEKKRHSKVHLKQK-----------ARAEERLKGL 474          

HSP 3 Score: 51.9878 bits (123), Expect = 3.149e-7
Identity = 23/44 (52.27%), Postives = 28/44 (63.64%), Query Frame = 2
Query:  542 CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            C + F RSD L+ H RIHTG KP++C +C R F RSD    H R
Sbjct:  387 CVRSFARSDELNRHLRIHTGHKPFQCRICLRNFSRSDHLTTHVR 430          
BLAST of EGR-like protein 1 vs. Ensembl Human
Match: EGR4 (early growth response 4 [Source:HGNC Symbol;Acc:HGNC:3241])

HSP 1 Score: 102.064 bits (253), Expect = 3.436e-24
Identity = 46/80 (57.50%), Postives = 54/80 (67.50%), Query Frame = 2
Query:  434 IKQFTC--NTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 667
             K F C   +C +SF R DEL RH RIHTG +P  C  C + F RSDHL+TH R HTGEKP+ C+VC R F RSDE+ RH
Sbjct:  480 AKAFACPVESCVRSFARSDELNRHLRIHTGHKPFQCRICLRNFSRSDHLTTHVRTHTGEKPFACDVCGRRFARSDEKKRH 559          

HSP 2 Score: 64.3142 bits (155), Expect = 3.090e-11
Identity = 30/78 (38.46%), Postives = 42/78 (53.85%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHF 670
            K F C  C ++F R D L  H R HTGE+P AC+ C +RF RSD    H+++H  +K            R++ERL+  
Sbjct:  511 KPFQCRICLRNFSRSDHLTTHVRTHTGEKPFACDVCGRRFARSDEKKRHSKVHLKQK-----------ARAEERLKGL 577          

HSP 3 Score: 51.6026 bits (122), Expect = 5.200e-7
Identity = 23/44 (52.27%), Postives = 28/44 (63.64%), Query Frame = 2
Query:  542 CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            C + F RSD L+ H RIHTG KP++C +C R F RSD    H R
Sbjct:  490 CVRSFARSDELNRHLRIHTGHKPFQCRICLRNFSRSDHLTTHVR 533          
BLAST of EGR-like protein 1 vs. Ensembl Human
Match: EGR1 (early growth response 1 [Source:HGNC Symbol;Acc:HGNC:3238])

HSP 1 Score: 101.679 bits (252), Expect = 4.172e-24
Identity = 42/71 (59.15%), Postives = 51/71 (71.83%), Query Frame = 2
Query:  455 TCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 667
            +C + F R DEL RH RIHTG++P  C  C + F RSDHL+TH R HTGEKP+ C++C R F RSDER RH
Sbjct:  344 SCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRH 414          

HSP 2 Score: 67.3958 bits (163), Expect = 2.377e-12
Identity = 31/62 (50.00%), Postives = 38/62 (61.29%), Query Frame = 2
Query:  494 RHERIHTGERPLACNF--CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            R  +    ERP AC    CD+RF RSD L+ H RIHTG+KP++C +C R F RSD    H R
Sbjct:  327 RPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIR 388          

HSP 3 Score: 64.3142 bits (155), Expect = 2.832e-11
Identity = 27/57 (47.37%), Postives = 35/57 (61.40%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 607
            K F C  C ++F R D L  H R HTGE+P AC+ C ++F RSD    HT+IH  +K
Sbjct:  366 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQK 422          
BLAST of EGR-like protein 1 vs. Ensembl Human
Match: EGR3 (early growth response 3 [Source:HGNC Symbol;Acc:HGNC:3240])

HSP 1 Score: 96.2857 bits (238), Expect = 1.625e-22
Identity = 42/72 (58.33%), Postives = 48/72 (66.67%), Query Frame = 2
Query:  458 CKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            C + F R DEL RH RIHTG +P  C  C + F RSDHL+TH R HTGEKP+ C  C R F RSDER RH +
Sbjct:  282 CDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAK 353          

HSP 2 Score: 65.4698 bits (158), Expect = 9.065e-12
Identity = 28/57 (49.12%), Postives = 34/57 (59.65%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 607
            K F C  C +SF R D L  H R HTGE+P AC FC ++F RSD    H +IH  +K
Sbjct:  303 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQK 359          

HSP 3 Score: 64.3142 bits (155), Expect = 2.135e-11
Identity = 38/108 (35.19%), Postives = 50/108 (46.30%), Query Frame = 2
Query:  380 LRIISSPLSEISEKSQFRIKQFTCN--------TCKKSFYRRDELKRHERIHTGERPLACNF--CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            +R+   P++ +     F+ KQ               K    R    R  +    ERP AC    CD+RF RSD L+ H RIHTG KP++C +C R F RSD    H R
Sbjct:  218 IRVNPPPITPLETIKAFKDKQIHPGFGSLPQPPLTLKPIRPRKYPNRPSKTPLHERPHACPAEGCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIR 325          
BLAST of EGR-like protein 1 vs. Ensembl Human
Match: EGR3 (early growth response 3 [Source:HGNC Symbol;Acc:HGNC:3240])

HSP 1 Score: 95.5153 bits (236), Expect = 2.067e-22
Identity = 42/72 (58.33%), Postives = 48/72 (66.67%), Query Frame = 2
Query:  458 CKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            C + F R DEL RH RIHTG +P  C  C + F RSDHL+TH R HTGEKP+ C  C R F RSDER RH +
Sbjct:  244 CDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAK 315          

HSP 2 Score: 65.0846 bits (157), Expect = 1.060e-11
Identity = 28/57 (49.12%), Postives = 34/57 (59.65%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 607
            K F C  C +SF R D L  H R HTGE+P AC FC ++F RSD    H +IH  +K
Sbjct:  265 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQK 321          

HSP 3 Score: 63.929 bits (154), Expect = 2.976e-11
Identity = 38/108 (35.19%), Postives = 50/108 (46.30%), Query Frame = 2
Query:  380 LRIISSPLSEISEKSQFRIKQFTCN--------TCKKSFYRRDELKRHERIHTGERPLACNF--CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            +R+   P++ +     F+ KQ               K    R    R  +    ERP AC    CD+RF RSD L+ H RIHTG KP++C +C R F RSD    H R
Sbjct:  180 IRVNPPPITPLETIKAFKDKQIHPGFGSLPQPPLTLKPIRPRKYPNRPSKTPLHERPHACPAEGCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIR 287          
BLAST of EGR-like protein 1 vs. Ensembl Celegans
Match: egrh-2 (EGR (Early Growth factor Response factor) Homolog [Source:UniProtKB/TrEMBL;Acc:U4PM44])

HSP 1 Score: 98.2117 bits (243), Expect = 6.576e-26
Identity = 46/87 (52.87%), Postives = 57/87 (65.52%), Query Frame = 2
Query:  413 SEKSQFRIKQFTC--NTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 667
            S K   + + + C  + C K F R DEL RH RIHTG++P  C  C +RF RSDHL+TH R HTGEKPY C++C + F R DER RH
Sbjct:    3 SSKMHLQDRPYKCPRDECDKKFSRSDELTRHIRIHTGQKPFQCRICMRRFSRSDHLTTHVRTHTGEKPYSCDICGKKFARCDERTRH 89          

HSP 2 Score: 62.7734 bits (151), Expect = 1.525e-12
Identity = 29/59 (49.15%), Postives = 39/59 (66.10%), Query Frame = 2
Query:  503 RIHTGERPLAC--NFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            ++H  +RP  C  + CDK+F RSD L+ H RIHTG+KP++C +C R F RSD    H R
Sbjct:    5 KMHLQDRPYKCPRDECDKKFSRSDELTRHIRIHTGQKPFQCRICMRRFSRSDHLTTHVR 63          

HSP 3 Score: 56.6102 bits (135), Expect = 3.358e-10
Identity = 25/53 (47.17%), Postives = 32/53 (60.38%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIH 595
            K F C  C + F R D L  H R HTGE+P +C+ C K+F R D  + HT+IH
Sbjct:   41 KPFQCRICMRRFSRSDHLTTHVRTHTGEKPYSCDICGKKFARCDERTRHTKIH 93          
BLAST of EGR-like protein 1 vs. Ensembl Celegans
Match: egrh-2 (EGR (Early Growth factor Response factor) Homolog [Source:UniProtKB/TrEMBL;Acc:U4PM44])

HSP 1 Score: 102.064 bits (253), Expect = 1.032e-25
Identity = 62/150 (41.33%), Postives = 79/150 (52.67%), Query Frame = 2
Query:  224 HESFYLDNTENWSNLKTPSPMDCNNLEFVFIYESEDDSNHFSTKLNPNTKKSLRIISSPLSEISEKSQFRIKQFTC--NTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 667
            H SF    +     LKT  PMD  +  F     S++D N F     P   K++          S K   + + + C  + C K F R DEL RH RIHTG++P  C  C +RF RSDHL+TH R HTGEKPY C++C + F R DER RH
Sbjct:  115 HTSFSDSASLAHFELKT-EPMDDYSYNF-----SDNDFNSFKFSSTPEEPKNIGCQKMK----SSKMHLQDRPYKCPRDECDKKFSRSDELTRHIRIHTGQKPFQCRICMRRFSRSDHLTTHVRTHTGEKPYSCDICGKKFARCDERTRH 254          

HSP 2 Score: 65.4698 bits (158), Expect = 2.513e-12
Identity = 29/62 (46.77%), Postives = 40/62 (64.52%), Query Frame = 2
Query:  494 RHERIHTGERPLAC--NFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            +  ++H  +RP  C  + CDK+F RSD L+ H RIHTG+KP++C +C R F RSD    H R
Sbjct:  167 KSSKMHLQDRPYKCPRDECDKKFSRSDELTRHIRIHTGQKPFQCRICMRRFSRSDHLTTHVR 228          
BLAST of EGR-like protein 1 vs. Ensembl Celegans
Match: egrh-2 (EGR (Early Growth factor Response factor) Homolog [Source:UniProtKB/TrEMBL;Acc:U4PM44])

HSP 1 Score: 102.064 bits (253), Expect = 1.256e-25
Identity = 62/150 (41.33%), Postives = 79/150 (52.67%), Query Frame = 2
Query:  224 HESFYLDNTENWSNLKTPSPMDCNNLEFVFIYESEDDSNHFSTKLNPNTKKSLRIISSPLSEISEKSQFRIKQFTC--NTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 667
            H SF    +     LKT  PMD  +  F     S++D N F     P   K++          S K   + + + C  + C K F R DEL RH RIHTG++P  C  C +RF RSDHL+TH R HTGEKPY C++C + F R DER RH
Sbjct:  115 HTSFSDSASLAHFELKT-EPMDDYSYNF-----SDNDFNSFKFSSTPEEPKNIGCQKMK----SSKMHLQDRPYKCPRDECDKKFSRSDELTRHIRIHTGQKPFQCRICMRRFSRSDHLTTHVRTHTGEKPYSCDICGKKFARCDERTRH 254          

HSP 2 Score: 65.0846 bits (157), Expect = 3.721e-12
Identity = 29/62 (46.77%), Postives = 40/62 (64.52%), Query Frame = 2
Query:  494 RHERIHTGERPLAC--NFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            +  ++H  +RP  C  + CDK+F RSD L+ H RIHTG+KP++C +C R F RSD    H R
Sbjct:  167 KSSKMHLQDRPYKCPRDECDKKFSRSDELTRHIRIHTGQKPFQCRICMRRFSRSDHLTTHVR 228          
BLAST of EGR-like protein 1 vs. Ensembl Celegans
Match: egrh-2 (EGR (Early Growth factor Response factor) Homolog [Source:UniProtKB/TrEMBL;Acc:U4PM44])

HSP 1 Score: 97.8265 bits (242), Expect = 1.284e-25
Identity = 46/87 (52.87%), Postives = 57/87 (65.52%), Query Frame = 2
Query:  413 SEKSQFRIKQFTC--NTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 667
            S K   + + + C  + C K F R DEL RH RIHTG++P  C  C +RF RSDHL+TH R HTGEKPY C++C + F R DER RH
Sbjct:    3 SSKMHLQDRPYKCPRDECDKKFSRSDELTRHIRIHTGQKPFQCRICMRRFSRSDHLTTHVRTHTGEKPYSCDICGKKFARCDERTRH 89          

HSP 2 Score: 62.003 bits (149), Expect = 4.048e-12
Identity = 29/59 (49.15%), Postives = 39/59 (66.10%), Query Frame = 2
Query:  503 RIHTGERPLAC--NFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            ++H  +RP  C  + CDK+F RSD L+ H RIHTG+KP++C +C R F RSD    H R
Sbjct:    5 KMHLQDRPYKCPRDECDKKFSRSDELTRHIRIHTGQKPFQCRICMRRFSRSDHLTTHVR 63          

HSP 3 Score: 57.7658 bits (138), Expect = 1.358e-10
Identity = 26/58 (44.83%), Postives = 33/58 (56.90%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKP 610
            K F C  C + F R D L  H R HTGE+P +C+ C K+F R D  + HT+IH    P
Sbjct:   41 KPFQCRICMRRFSRSDHLTTHVRTHTGEKPYSCDICGKKFARCDERTRHTKIHKKSGP 98          
BLAST of EGR-like protein 1 vs. Ensembl Celegans
Match: egrh-1 (EGR (Early Growth factor Response factor) Homolog [Source:UniProtKB/TrEMBL;Acc:Q18250])

HSP 1 Score: 100.523 bits (249), Expect = 3.287e-24
Identity = 45/89 (50.56%), Postives = 58/89 (65.17%), Query Frame = 2
Query:  413 SEKSQFRIKQFTC--NTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            S K   + + + C  + C + F R DEL RH RIHTG++P  C  C + F RSDHL+TH R HTGEKP+ C++C R F RSDER RH +
Sbjct:  364 SSKMPLQDRPYKCPRDGCDRRFSRSDELTRHIRIHTGQKPFQCRICMRAFSRSDHLTTHVRTHTGEKPFSCDICGRKFARSDERKRHTK 452          

HSP 2 Score: 61.2326 bits (147), Expect = 1.163e-10
Identity = 24/53 (45.28%), Postives = 33/53 (62.26%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIH 595
            K F C  C ++F R D L  H R HTGE+P +C+ C ++F RSD    HT++H
Sbjct:  402 KPFQCRICMRAFSRSDHLTTHVRTHTGEKPFSCDICGRKFARSDERKRHTKVH 454          
BLAST of EGR-like protein 1 vs. Ensembl Fly
Match: sr (gene:FBgn0003499 transcript:FBtr0083542)

HSP 1 Score: 100.908 bits (250), Expect = 5.031e-24
Identity = 41/70 (58.57%), Postives = 50/70 (71.43%), Query Frame = 2
Query:  458 CKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 667
            C + F R DEL RH RIHTG++P  C  C + F RSDHL+TH R HTGEKP+ C++C R F RSDE+ RH
Sbjct: 1043 CDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRH 1112          

HSP 2 Score: 68.5514 bits (166), Expect = 5.679e-13
Identity = 31/62 (50.00%), Postives = 38/62 (61.29%), Query Frame = 2
Query:  494 RHERIHTGERPLACNF--CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            R  +    ERP AC    CD+RF RSD L+ H RIHTG+KP++C +C R F RSD    H R
Sbjct: 1025 RPSKTPVHERPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIR 1086          

HSP 3 Score: 63.1586 bits (152), Expect = 4.316e-11
Identity = 24/57 (42.11%), Postives = 34/57 (59.65%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 607
            K F C  C +SF R D L  H R HTGE+P +C+ C ++F RSD    H ++H  ++
Sbjct: 1064 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRHAKVHLKQR 1120          
BLAST of EGR-like protein 1 vs. Ensembl Fly
Match: sr (gene:FBgn0003499 transcript:FBtr0330050)

HSP 1 Score: 100.908 bits (250), Expect = 5.088e-24
Identity = 41/70 (58.57%), Postives = 50/70 (71.43%), Query Frame = 2
Query:  458 CKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 667
            C + F R DEL RH RIHTG++P  C  C + F RSDHL+TH R HTGEKP+ C++C R F RSDE+ RH
Sbjct: 1043 CDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRH 1112          

HSP 2 Score: 68.5514 bits (166), Expect = 5.738e-13
Identity = 31/62 (50.00%), Postives = 38/62 (61.29%), Query Frame = 2
Query:  494 RHERIHTGERPLACNF--CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            R  +    ERP AC    CD+RF RSD L+ H RIHTG+KP++C +C R F RSD    H R
Sbjct: 1025 RPSKTPVHERPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIR 1086          

HSP 3 Score: 63.1586 bits (152), Expect = 4.360e-11
Identity = 24/57 (42.11%), Postives = 34/57 (59.65%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 607
            K F C  C +SF R D L  H R HTGE+P +C+ C ++F RSD    H ++H  ++
Sbjct: 1064 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRHAKVHLKQR 1120          
BLAST of EGR-like protein 1 vs. Ensembl Fly
Match: sr (gene:FBgn0003499 transcript:FBtr0301615)

HSP 1 Score: 99.7525 bits (247), Expect = 1.116e-23
Identity = 43/87 (49.43%), Postives = 56/87 (64.37%), Query Frame = 2
Query:  419 KSQFRIKQFTCNT--CKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            K+    + + C    C + F R DEL RH RIHTG++P  C  C + F RSDHL+TH R HTGEKP+ C++C R F RSDE+ RH +
Sbjct:  559 KTPVHERPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRHAK 645          

HSP 2 Score: 68.9366 bits (167), Expect = 4.777e-13
Identity = 40/107 (37.38%), Postives = 54/107 (50.47%), Query Frame = 2
Query:  359 NPNTKKSLRIISSPLSEISEKSQFRIKQFTCNTCKKSFYRRDELKRHERIHTGERPLACNF--CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            +P+T K   I    LS++ ++S   +K             R    R  +    ERP AC    CD+RF RSD L+ H RIHTG+KP++C +C R F RSD    H R
Sbjct:  522 SPSTSKGHEI----LSQVYQQSTVPLKLVPVKP-------RKYPNRPSKTPVHERPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIR 617          

HSP 3 Score: 61.6178 bits (148), Expect = 1.366e-10
Identity = 24/53 (45.28%), Postives = 32/53 (60.38%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIH 595
            K F C  C +SF R D L  H R HTGE+P +C+ C ++F RSD    H ++H
Sbjct:  595 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRHAKVH 647          
BLAST of EGR-like protein 1 vs. Ensembl Fly
Match: sr (gene:FBgn0003499 transcript:FBtr0344633)

HSP 1 Score: 99.7525 bits (247), Expect = 1.428e-23
Identity = 41/70 (58.57%), Postives = 50/70 (71.43%), Query Frame = 2
Query:  458 CKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 667
            C + F R DEL RH RIHTG++P  C  C + F RSDHL+TH R HTGEKP+ C++C R F RSDE+ RH
Sbjct:  763 CDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRH 832          

HSP 2 Score: 67.781 bits (164), Expect = 1.176e-12
Identity = 31/62 (50.00%), Postives = 38/62 (61.29%), Query Frame = 2
Query:  494 RHERIHTGERPLACNF--CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            R  +    ERP AC    CD+RF RSD L+ H RIHTG+KP++C +C R F RSD    H R
Sbjct:  745 RPSKTPVHERPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIR 806          

HSP 3 Score: 62.3882 bits (150), Expect = 7.967e-11
Identity = 24/57 (42.11%), Postives = 34/57 (59.65%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 607
            K F C  C +SF R D L  H R HTGE+P +C+ C ++F RSD    H ++H  ++
Sbjct:  784 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRHAKVHLKQR 840          
BLAST of EGR-like protein 1 vs. Ensembl Fly
Match: sr (gene:FBgn0003499 transcript:FBtr0083543)

HSP 1 Score: 99.7525 bits (247), Expect = 1.428e-23
Identity = 41/70 (58.57%), Postives = 50/70 (71.43%), Query Frame = 2
Query:  458 CKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 667
            C + F R DEL RH RIHTG++P  C  C + F RSDHL+TH R HTGEKP+ C++C R F RSDE+ RH
Sbjct:  763 CDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRH 832          

HSP 2 Score: 67.781 bits (164), Expect = 1.176e-12
Identity = 31/62 (50.00%), Postives = 38/62 (61.29%), Query Frame = 2
Query:  494 RHERIHTGERPLACNF--CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            R  +    ERP AC    CD+RF RSD L+ H RIHTG+KP++C +C R F RSD    H R
Sbjct:  745 RPSKTPVHERPYACPVENCDRRFSRSDELTRHIRIHTGQKPFQCRICMRSFSRSDHLTTHIR 806          

HSP 3 Score: 62.3882 bits (150), Expect = 7.967e-11
Identity = 24/57 (42.11%), Postives = 34/57 (59.65%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 607
            K F C  C +SF R D L  H R HTGE+P +C+ C ++F RSD    H ++H  ++
Sbjct:  784 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRHAKVHLKQR 840          
BLAST of EGR-like protein 1 vs. Ensembl Zebrafish
Match: egr4 (early growth response 4 [Source:ZFIN;Acc:ZDB-GENE-080204-90])

HSP 1 Score: 103.605 bits (257), Expect = 1.249e-25
Identity = 49/89 (55.06%), Postives = 60/89 (67.42%), Query Frame = 2
Query:  413 SEKSQFRIKQFTC--NTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            + K   R K F+C   +C++ F R DEL RH RIHTG +P  C  C + F RSDHL+TH R HTGEKP+ C+VC+R F RSDER RH R
Sbjct:  240 ARKGAAREKPFSCPVESCERRFSRSDELNRHVRIHTGHKPFQCRVCLRCFSRSDHLTTHMRTHTGEKPFSCDVCARRFARSDERKRHMR 328          

HSP 2 Score: 59.6918 bits (143), Expect = 5.304e-10
Identity = 25/57 (43.86%), Postives = 33/57 (57.89%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 607
            K F C  C + F R D L  H R HTGE+P +C+ C +RF RSD    H R+H  ++
Sbjct:  278 KPFQCRVCLRCFSRSDHLTTHMRTHTGEKPFSCDVCARRFARSDERKRHMRVHLKQR 334          
BLAST of EGR-like protein 1 vs. Ensembl Zebrafish
Match: egr1 (early growth response 1 [Source:NCBI gene;Acc:30498])

HSP 1 Score: 102.449 bits (254), Expect = 1.488e-24
Identity = 43/73 (58.90%), Postives = 51/73 (69.86%), Query Frame = 2
Query:  455 TCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            TC + F R DEL RH RIHTG++P  C  C + F RSDHL+TH R HTGEKP+ C +C R F RSDER RH +
Sbjct:  317 TCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACEICGRKFARSDERKRHTK 389          

HSP 2 Score: 69.3218 bits (168), Expect = 4.114e-13
Identity = 39/94 (41.49%), Postives = 48/94 (51.06%), Query Frame = 2
Query:  434 IKQFTCNTCK---KSFYRRDELK---------RHERIHTGERPLACNF--CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            IK F   T     KS Y+   +K         R  +    ERP AC    CD+RF RSD L+ H RIHTG+KP++C +C R F RSD    H R
Sbjct:  268 IKAFATQTGSQDLKSVYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVETCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIR 361          

HSP 3 Score: 63.5438 bits (153), Expect = 2.989e-11
Identity = 27/57 (47.37%), Postives = 34/57 (59.65%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 607
            K F C  C ++F R D L  H R HTGE+P AC  C ++F RSD    HT+IH  +K
Sbjct:  339 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACEICGRKFARSDERKRHTKIHMRQK 395          
BLAST of EGR-like protein 1 vs. Ensembl Zebrafish
Match: egr1 (early growth response 1 [Source:NCBI gene;Acc:30498])

HSP 1 Score: 102.449 bits (254), Expect = 1.488e-24
Identity = 43/73 (58.90%), Postives = 51/73 (69.86%), Query Frame = 2
Query:  455 TCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            TC + F R DEL RH RIHTG++P  C  C + F RSDHL+TH R HTGEKP+ C +C R F RSDER RH +
Sbjct:  317 TCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACEICGRKFARSDERKRHTK 389          

HSP 2 Score: 69.3218 bits (168), Expect = 4.114e-13
Identity = 39/94 (41.49%), Postives = 48/94 (51.06%), Query Frame = 2
Query:  434 IKQFTCNTCK---KSFYRRDELK---------RHERIHTGERPLACNF--CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            IK F   T     KS Y+   +K         R  +    ERP AC    CD+RF RSD L+ H RIHTG+KP++C +C R F RSD    H R
Sbjct:  268 IKAFATQTGSQDLKSVYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVETCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIR 361          

HSP 3 Score: 63.5438 bits (153), Expect = 2.989e-11
Identity = 27/57 (47.37%), Postives = 34/57 (59.65%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 607
            K F C  C ++F R D L  H R HTGE+P AC  C ++F RSD    HT+IH  +K
Sbjct:  339 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACEICGRKFARSDERKRHTKIHMRQK 395          
BLAST of EGR-like protein 1 vs. Ensembl Zebrafish
Match: egr2a (early growth response 2a [Source:ZFIN;Acc:ZDB-GENE-030723-6])

HSP 1 Score: 93.9745 bits (232), Expect = 1.060e-22
Identity = 42/70 (60.00%), Postives = 48/70 (68.57%), Query Frame = 2
Query:  458 CKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 667
            C + F R DEL RH RIHTG +P  C  C + F RSDHL+TH R HTGEKP+ C+ C R F RSDER RH
Sbjct:  155 CDRRFSRSDELTRHVRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDFCGRKFARSDERRRH 224          

HSP 2 Score: 62.7734 bits (151), Expect = 2.139e-11
Identity = 28/57 (49.12%), Postives = 35/57 (61.40%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 607
            K F C  C +SF R D L  H R HTGE+P +C+FC ++F RSD    HT+IH   K
Sbjct:  176 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDFCGRKFARSDERRRHTKIHQRHK 232          

HSP 3 Score: 61.2326 bits (147), Expect = 8.457e-11
Identity = 29/54 (53.70%), Postives = 34/54 (62.96%), Query Frame = 2
Query:  518 ERPLACNF--CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            ERP  C    CD+RF RSD L+ H RIHTG KP++C +C R F RSD    H R
Sbjct:  145 ERPYPCPAEGCDRRFSRSDELTRHVRIHTGHKPFQCRICMRSFSRSDHLTTHIR 198          
BLAST of EGR-like protein 1 vs. Ensembl Zebrafish
Match: egr2a (early growth response 2a [Source:ZFIN;Acc:ZDB-GENE-030723-6])

HSP 1 Score: 93.9745 bits (232), Expect = 1.060e-22
Identity = 42/70 (60.00%), Postives = 48/70 (68.57%), Query Frame = 2
Query:  458 CKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 667
            C + F R DEL RH RIHTG +P  C  C + F RSDHL+TH R HTGEKP+ C+ C R F RSDER RH
Sbjct:  155 CDRRFSRSDELTRHVRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDFCGRKFARSDERRRH 224          

HSP 2 Score: 62.7734 bits (151), Expect = 2.139e-11
Identity = 28/57 (49.12%), Postives = 35/57 (61.40%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 607
            K F C  C +SF R D L  H R HTGE+P +C+FC ++F RSD    HT+IH   K
Sbjct:  176 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDFCGRKFARSDERRRHTKIHQRHK 232          

HSP 3 Score: 61.2326 bits (147), Expect = 8.457e-11
Identity = 29/54 (53.70%), Postives = 34/54 (62.96%), Query Frame = 2
Query:  518 ERPLACNF--CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            ERP  C    CD+RF RSD L+ H RIHTG KP++C +C R F RSD    H R
Sbjct:  145 ERPYPCPAEGCDRRFSRSDELTRHVRIHTGHKPFQCRICMRSFSRSDHLTTHIR 198          
BLAST of EGR-like protein 1 vs. Ensembl Xenopus
Match: egr1 (early growth response 1 [Source:NCBI gene;Acc:100038164])

HSP 1 Score: 102.064 bits (253), Expect = 2.173e-24
Identity = 42/73 (57.53%), Postives = 51/73 (69.86%), Query Frame = 2
Query:  449 CNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 667
              +C + F R DEL RH RIHTG++P  C  C + F RSDHL+TH R HTGEKP+ C++C R F RSDER RH
Sbjct:  284 VESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRH 356          

HSP 2 Score: 67.781 bits (164), Expect = 1.534e-12
Identity = 31/62 (50.00%), Postives = 38/62 (61.29%), Query Frame = 2
Query:  494 RHERIHTGERPLACNF--CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            R  +    ERP AC    CD+RF RSD L+ H RIHTG+KP++C +C R F RSD    H R
Sbjct:  269 RPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIR 330          

HSP 3 Score: 64.6994 bits (156), Expect = 2.091e-11
Identity = 27/57 (47.37%), Postives = 35/57 (61.40%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 607
            K F C  C ++F R D L  H R HTGE+P AC+ C ++F RSD    HT+IH  +K
Sbjct:  308 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQK 364          
BLAST of EGR-like protein 1 vs. Ensembl Xenopus
Match: egr1 (early growth response 1 [Source:NCBI gene;Acc:100038164])

HSP 1 Score: 102.064 bits (253), Expect = 2.318e-24
Identity = 42/73 (57.53%), Postives = 51/73 (69.86%), Query Frame = 2
Query:  449 CNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 667
              +C + F R DEL RH RIHTG++P  C  C + F RSDHL+TH R HTGEKP+ C++C R F RSDER RH
Sbjct:  311 VESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRH 383          

HSP 2 Score: 67.781 bits (164), Expect = 1.655e-12
Identity = 31/62 (50.00%), Postives = 38/62 (61.29%), Query Frame = 2
Query:  494 RHERIHTGERPLACNF--CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            R  +    ERP AC    CD+RF RSD L+ H RIHTG+KP++C +C R F RSD    H R
Sbjct:  296 RPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIR 357          

HSP 3 Score: 64.6994 bits (156), Expect = 1.958e-11
Identity = 27/57 (47.37%), Postives = 35/57 (61.40%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 607
            K F C  C ++F R D L  H R HTGE+P AC+ C ++F RSD    HT+IH  +K
Sbjct:  335 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQK 391          
BLAST of EGR-like protein 1 vs. Ensembl Xenopus
Match: usp31 (ubiquitin specific peptidase 31 [Source:Xenbase;Acc:XB-GENE-920956])

HSP 1 Score: 99.3673 bits (246), Expect = 2.416e-23
Identity = 45/79 (56.96%), Postives = 54/79 (68.35%), Query Frame = 2
Query:  437 KQFTC--NTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 667
            K F C   +C +SF R DEL RH RIHTG +P  C  C + F RSDHL+TH R HTGEKP+ C++C R F RSDE+ RH
Sbjct:  438 KAFACPVESCIRSFARSDELNRHLRIHTGHKPFQCRICLRNFSRSDHLTTHIRTHTGEKPFSCDLCGRRFARSDEKKRH 516          

HSP 2 Score: 60.077 bits (144), Expect = 6.219e-10
Identity = 25/57 (43.86%), Postives = 34/57 (59.65%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 607
            K F C  C ++F R D L  H R HTGE+P +C+ C +RF RSD    H ++H  +K
Sbjct:  468 KPFQCRICLRNFSRSDHLTTHIRTHTGEKPFSCDLCGRRFARSDEKKRHGKVHMKQK 524          

HSP 3 Score: 53.9138 bits (128), Expect = 7.507e-8
Identity = 26/54 (48.15%), Postives = 32/54 (59.26%), Query Frame = 2
Query:  518 ERPLACNF--CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            E+  AC    C + F RSD L+ H RIHTG KP++C +C R F RSD    H R
Sbjct:  437 EKAFACPVESCIRSFARSDELNRHLRIHTGHKPFQCRICLRNFSRSDHLTTHIR 490          
BLAST of EGR-like protein 1 vs. Ensembl Xenopus
Match: serpinb4 (serpin peptidase inhibitor, clade B (ovalbumin), member 4 [Source:Xenbase;Acc:XB-GENE-5787878])

HSP 1 Score: 95.9005 bits (237), Expect = 1.448e-22
Identity = 42/72 (58.33%), Postives = 49/72 (68.06%), Query Frame = 2
Query:  458 CKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            C + F R DEL RH RIHTG +P  C  C + F RSDHL+TH R HTGEKP+ C+ C R F RSDER RH +
Sbjct:  279 CDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACDFCGRKFARSDERKRHAK 350          

HSP 2 Score: 64.6994 bits (156), Expect = 1.559e-11
Identity = 42/128 (32.81%), Postives = 60/128 (46.88%), Query Frame = 2
Query:  341 HFSTKLNPNTKK------SLRIISSPLSEISEKSQFRIKQFTCN---------TCKKSFYRRDELKRHERIHTGERPLAC--NFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            H +T++ P  +K      ++R+   P++ +     F+ KQ   +            K    R    R  +    ERP AC    CD+RF RSD L+ H RIHTG KP++C +C R F RSD    H R
Sbjct:  195 HHNTEMPPVDQKPFQNMEAIRVNPPPITPLETIKAFKEKQVLPSFGGMGHQPPLTLKPIRPRKYPNRPSKTPLHERPHACPAEGCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIR 322          

HSP 3 Score: 64.6994 bits (156), Expect = 1.713e-11
Identity = 27/53 (50.94%), Postives = 33/53 (62.26%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIH 595
            K F C  C +SF R D L  H R HTGE+P AC+FC ++F RSD    H +IH
Sbjct:  300 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACDFCGRKFARSDERKRHAKIH 352          
BLAST of EGR-like protein 1 vs. Ensembl Xenopus
Match: tbl1x (transducin beta like 1 X-linked [Source:Xenbase;Acc:XB-GENE-982285])

HSP 1 Score: 95.1301 bits (235), Expect = 4.052e-22
Identity = 42/70 (60.00%), Postives = 48/70 (68.57%), Query Frame = 2
Query:  458 CKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 667
            C + F R DEL RH RIHTG +P  C  C + F RSDHL+TH R HTGEKP+ C+ C R F RSDER RH
Sbjct:  268 CDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRH 337          

HSP 2 Score: 63.929 bits (154), Expect = 2.606e-11
Identity = 27/57 (47.37%), Postives = 36/57 (63.16%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 607
            K F C  C ++F R D L  H R HTGE+P AC++C ++F RSD    HT+IH  +K
Sbjct:  289 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTKIHLRQK 345          

HSP 3 Score: 61.2326 bits (147), Expect = 2.085e-10
Identity = 30/62 (48.39%), Postives = 36/62 (58.06%), Query Frame = 2
Query:  494 RHERIHTGERPLACNF--CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            R  +    ERP  C    CD+RF RSD L+ H RIHTG KP++C +C R F RSD    H R
Sbjct:  250 RPSKTPVHERPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIR 311          
BLAST of EGR-like protein 1 vs. Ensembl Mouse
Match: Egr4 (early growth response 4 [Source:MGI Symbol;Acc:MGI:99252])

HSP 1 Score: 104.76 bits (260), Expect = 1.921e-25
Identity = 46/80 (57.50%), Postives = 55/80 (68.75%), Query Frame = 2
Query:  434 IKQFTC--NTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 667
            +K F C   +C +SF R DEL RH RIHTG +P  C  C + F RSDHL+TH R HTGEKP+ C+VC R F RSDE+ RH
Sbjct:  369 VKAFACPVESCVRSFARSDELNRHLRIHTGHKPFQCRICLRNFSRSDHLTTHVRTHTGEKPFACDVCGRRFARSDEKKRH 448          

HSP 2 Score: 64.6994 bits (156), Expect = 1.481e-11
Identity = 30/78 (38.46%), Postives = 42/78 (53.85%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHF 670
            K F C  C ++F R D L  H R HTGE+P AC+ C +RF RSD    H+++H  +K            R++ERL+  
Sbjct:  400 KPFQCRICLRNFSRSDHLTTHVRTHTGEKPFACDVCGRRFARSDEKKRHSKVHLKQK-----------ARAEERLKGL 466          

HSP 3 Score: 52.373 bits (124), Expect = 2.069e-7
Identity = 23/44 (52.27%), Postives = 28/44 (63.64%), Query Frame = 2
Query:  542 CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            C + F RSD L+ H RIHTG KP++C +C R F RSD    H R
Sbjct:  379 CVRSFARSDELNRHLRIHTGHKPFQCRICLRNFSRSDHLTTHVR 422          
BLAST of EGR-like protein 1 vs. Ensembl Mouse
Match: Egr1 (early growth response 1 [Source:MGI Symbol;Acc:MGI:95295])

HSP 1 Score: 101.679 bits (252), Expect = 3.151e-24
Identity = 42/71 (59.15%), Postives = 51/71 (71.83%), Query Frame = 2
Query:  455 TCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 667
            +C + F R DEL RH RIHTG++P  C  C + F RSDHL+TH R HTGEKP+ C++C R F RSDER RH
Sbjct:  342 SCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRH 412          

HSP 2 Score: 67.3958 bits (163), Expect = 1.812e-12
Identity = 31/62 (50.00%), Postives = 38/62 (61.29%), Query Frame = 2
Query:  494 RHERIHTGERPLACNF--CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            R  +    ERP AC    CD+RF RSD L+ H RIHTG+KP++C +C R F RSD    H R
Sbjct:  325 RPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIR 386          

HSP 3 Score: 64.3142 bits (155), Expect = 2.219e-11
Identity = 27/57 (47.37%), Postives = 35/57 (61.40%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 607
            K F C  C ++F R D L  H R HTGE+P AC+ C ++F RSD    HT+IH  +K
Sbjct:  364 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQK 420          
BLAST of EGR-like protein 1 vs. Ensembl Mouse
Match: Egr1 (early growth response 1 [Source:MGI Symbol;Acc:MGI:95295])

HSP 1 Score: 101.679 bits (252), Expect = 3.151e-24
Identity = 42/71 (59.15%), Postives = 51/71 (71.83%), Query Frame = 2
Query:  455 TCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 667
            +C + F R DEL RH RIHTG++P  C  C + F RSDHL+TH R HTGEKP+ C++C R F RSDER RH
Sbjct:  342 SCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRH 412          

HSP 2 Score: 67.3958 bits (163), Expect = 1.812e-12
Identity = 31/62 (50.00%), Postives = 38/62 (61.29%), Query Frame = 2
Query:  494 RHERIHTGERPLACNF--CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            R  +    ERP AC    CD+RF RSD L+ H RIHTG+KP++C +C R F RSD    H R
Sbjct:  325 RPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIR 386          

HSP 3 Score: 64.3142 bits (155), Expect = 2.219e-11
Identity = 27/57 (47.37%), Postives = 35/57 (61.40%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 607
            K F C  C ++F R D L  H R HTGE+P AC+ C ++F RSD    HT+IH  +K
Sbjct:  364 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQK 420          
BLAST of EGR-like protein 1 vs. Ensembl Mouse
Match: Egr3 (early growth response 3 [Source:MGI Symbol;Acc:MGI:1306780])

HSP 1 Score: 96.2857 bits (238), Expect = 1.030e-22
Identity = 42/72 (58.33%), Postives = 48/72 (66.67%), Query Frame = 2
Query:  458 CKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            C + F R DEL RH RIHTG +P  C  C + F RSDHL+TH R HTGEKP+ C  C R F RSDER RH +
Sbjct:  282 CDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAK 353          

HSP 2 Score: 65.4698 bits (158), Expect = 6.165e-12
Identity = 28/57 (49.12%), Postives = 34/57 (59.65%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 607
            K F C  C +SF R D L  H R HTGE+P AC FC ++F RSD    H +IH  +K
Sbjct:  303 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQK 359          

HSP 3 Score: 64.3142 bits (155), Expect = 1.479e-11
Identity = 38/108 (35.19%), Postives = 50/108 (46.30%), Query Frame = 2
Query:  380 LRIISSPLSEISEKSQFRIKQFTCN--------TCKKSFYRRDELKRHERIHTGERPLACNF--CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            +R+   P++ +     F+ KQ               K    R    R  +    ERP AC    CD+RF RSD L+ H RIHTG KP++C +C R F RSD    H R
Sbjct:  218 IRVNPPPITPLETIKAFKDKQIHPGFGSLPQPPLTLKPIRPRKYPNRPSKTPLHERPHACPAEGCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIR 325          
BLAST of EGR-like protein 1 vs. Ensembl Mouse
Match: Egr3 (early growth response 3 [Source:MGI Symbol;Acc:MGI:1306780])

HSP 1 Score: 95.5153 bits (236), Expect = 1.270e-22
Identity = 42/72 (58.33%), Postives = 48/72 (66.67%), Query Frame = 2
Query:  458 CKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            C + F R DEL RH RIHTG +P  C  C + F RSDHL+TH R HTGEKP+ C  C R F RSDER RH +
Sbjct:  244 CDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAK 315          

HSP 2 Score: 65.0846 bits (157), Expect = 7.485e-12
Identity = 28/57 (49.12%), Postives = 34/57 (59.65%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 607
            K F C  C +SF R D L  H R HTGE+P AC FC ++F RSD    H +IH  +K
Sbjct:  265 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQK 321          

HSP 3 Score: 63.929 bits (154), Expect = 1.894e-11
Identity = 38/108 (35.19%), Postives = 50/108 (46.30%), Query Frame = 2
Query:  380 LRIISSPLSEISEKSQFRIKQFTCN--------TCKKSFYRRDELKRHERIHTGERPLACNF--CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            +R+   P++ +     F+ KQ               K    R    R  +    ERP AC    CD+RF RSD L+ H RIHTG KP++C +C R F RSD    H R
Sbjct:  180 IRVNPPPITPLETIKAFKDKQIHPGFGSLPQPPLTLKPIRPRKYPNRPSKTPLHERPHACPAEGCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIR 287          
BLAST of EGR-like protein 1 vs. UniProt/SwissProt
Match: sp|Q9WUF2|EGR4_MOUSE (Early growth response protein 4 OS=Mus musculus OX=10090 GN=Egr4 PE=3 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 1.344e-24
Identity = 46/80 (57.50%), Postives = 55/80 (68.75%), Query Frame = 2
Query:  434 IKQFTC--NTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 667
            +K F C   +C +SF R DEL RH RIHTG +P  C  C + F RSDHL+TH R HTGEKP+ C+VC R F RSDE+ RH
Sbjct:  369 VKAFACPVESCVRSFARSDELNRHLRIHTGHKPFQCRICLRNFSRSDHLTTHVRTHTGEKPFACDVCGRRFARSDEKKRH 448          

HSP 2 Score: 64.6994 bits (156), Expect = 1.036e-10
Identity = 30/78 (38.46%), Postives = 42/78 (53.85%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHF 670
            K F C  C ++F R D L  H R HTGE+P AC+ C +RF RSD    H+++H  +K            R++ERL+  
Sbjct:  400 KPFQCRICLRNFSRSDHLTTHVRTHTGEKPFACDVCGRRFARSDEKKRHSKVHLKQK-----------ARAEERLKGL 466          

HSP 3 Score: 52.373 bits (124), Expect = 1.448e-6
Identity = 23/44 (52.27%), Postives = 28/44 (63.64%), Query Frame = 2
Query:  542 CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            C + F RSD L+ H RIHTG KP++C +C R F RSD    H R
Sbjct:  379 CVRSFARSDELNRHLRIHTGHKPFQCRICLRNFSRSDHLTTHVR 422          
BLAST of EGR-like protein 1 vs. UniProt/SwissProt
Match: sp|O73693|EGR1_TAEGU (Early growth response protein 1 (Fragment) OS=Taeniopygia guttata OX=59729 GN=EGR1 PE=3 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 2.447e-24
Identity = 42/70 (60.00%), Postives = 50/70 (71.43%), Query Frame = 2
Query:  458 CKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 667
            C + F R DEL RH RIHTG++P  C  C + F RSDHL+TH R HTGEKP+ C++C R F RSDER RH
Sbjct:    1 CDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRH 70          

HSP 2 Score: 62.3882 bits (150), Expect = 1.193e-10
Identity = 27/57 (47.37%), Postives = 35/57 (61.40%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 607
            K F C  C ++F R D L  H R HTGE+P AC+ C ++F RSD    HT+IH  +K
Sbjct:   22 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQK 78          

HSP 3 Score: 59.6918 bits (143), Expect = 9.841e-10
Identity = 25/44 (56.82%), Postives = 31/44 (70.45%), Query Frame = 2
Query:  542 CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            CD+RF RSD L+ H RIHTG+KP++C +C R F RSD    H R
Sbjct:    1 CDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIR 44          
BLAST of EGR-like protein 1 vs. UniProt/SwissProt
Match: sp|Q00911|EGR4_RAT (Early growth response protein 4 OS=Rattus norvegicus OX=10116 GN=Egr4 PE=2 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 3.364e-24
Identity = 45/80 (56.25%), Postives = 55/80 (68.75%), Query Frame = 2
Query:  434 IKQFTC--NTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 667
            +K F C   +C ++F R DEL RH RIHTG +P  C  C + F RSDHL+TH R HTGEKP+ C+VC R F RSDE+ RH
Sbjct:  369 VKAFACPVESCVRTFARSDELNRHLRIHTGHKPFQCRICLRNFSRSDHLTTHVRTHTGEKPFACDVCGRRFARSDEKKRH 448          

HSP 2 Score: 64.6994 bits (156), Expect = 1.055e-10
Identity = 30/78 (38.46%), Postives = 42/78 (53.85%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHF 670
            K F C  C ++F R D L  H R HTGE+P AC+ C +RF RSD    H+++H  +K            R++ERL+  
Sbjct:  400 KPFQCRICLRNFSRSDHLTTHVRTHTGEKPFACDVCGRRFARSDEKKRHSKVHLKQK-----------ARAEERLKGL 466          

HSP 3 Score: 51.9878 bits (123), Expect = 1.631e-6
Identity = 23/44 (52.27%), Postives = 28/44 (63.64%), Query Frame = 2
Query:  542 CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            C + F RSD L+ H RIHTG KP++C +C R F RSD    H R
Sbjct:  379 CVRTFARSDELNRHLRIHTGHKPFQCRICLRNFSRSDHLTTHVR 422          
BLAST of EGR-like protein 1 vs. UniProt/SwissProt
Match: sp|O73692|EGR1_COTJA (Early growth response protein 1 (Fragment) OS=Coturnix japonica OX=93934 GN=EGR1 PE=3 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 3.369e-24
Identity = 42/70 (60.00%), Postives = 50/70 (71.43%), Query Frame = 2
Query:  458 CKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 667
            C + F R DEL RH RIHTG++P  C  C + F RSDHL+TH R HTGEKP+ C++C R F RSDER RH
Sbjct:    1 CDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRH 70          

HSP 2 Score: 62.003 bits (149), Expect = 1.667e-10
Identity = 27/57 (47.37%), Postives = 35/57 (61.40%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 607
            K F C  C ++F R D L  H R HTGE+P AC+ C ++F RSD    HT+IH  +K
Sbjct:   22 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQK 78          

HSP 3 Score: 59.6918 bits (143), Expect = 1.230e-9
Identity = 25/44 (56.82%), Postives = 31/44 (70.45%), Query Frame = 2
Query:  542 CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            CD+RF RSD L+ H RIHTG+KP++C +C R F RSD    H R
Sbjct:    1 CDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIR 44          
BLAST of EGR-like protein 1 vs. UniProt/SwissProt
Match: sp|O73691|EGR1_CHICK (Early growth response protein 1 (Fragment) OS=Gallus gallus OX=9031 GN=EGR1 PE=3 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 7.519e-24
Identity = 42/70 (60.00%), Postives = 50/70 (71.43%), Query Frame = 2
Query:  458 CKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 667
            C + F R DEL RH RIHTG++P  C  C + F RSDHL+TH R HTGEKP+ C++C R F RSDER RH
Sbjct:    1 CDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRH 70          

HSP 2 Score: 61.2326 bits (147), Expect = 2.827e-10
Identity = 27/57 (47.37%), Postives = 35/57 (61.40%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 607
            K F C  C ++F R D L  H R HTGE+P AC+ C ++F RSD    HT+IH  +K
Sbjct:   22 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQK 78          

HSP 3 Score: 58.9214 bits (141), Expect = 2.078e-9
Identity = 25/44 (56.82%), Postives = 31/44 (70.45%), Query Frame = 2
Query:  542 CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            CD+RF RSD L+ H RIHTG+KP++C +C R F RSD    H R
Sbjct:    1 CDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIR 44          
BLAST of EGR-like protein 1 vs. TrEMBL
Match: G1CSV5 (EGR-like protein 1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 368.237 bits (944), Expect = 1.100e-127
Identity = 177/186 (95.16%), Postives = 180/186 (96.77%), Query Frame = 2
Query:  128 MVKNIQKLTLPVKIDKLEFNEIQTGYTPLPGIHESFYLDNTENWSNLKTPSPMDCNNLEFVFIYESEDDSNHFSTKLNPNTKKSLRIISSPLSEISEKSQFRIKQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFRQNHL 685
            MVKNIQKLTLPVKIDKLEFNEIQTGYTPLPGIHESFYLDNTENWSNLKTPSPMDCNNLEFVFIYESEDDSNHFSTKLNPNTKKSLRIISSPLSEISEKSQFRIKQFTCNTCKKSFYRRDELKRHERIHTGERPLAC+FCDKRFMRSDHLSTH RIHTGEKPY+C+ C RLF RSDERLRH RQ HL
Sbjct:    1 MVKNIQKLTLPVKIDKLEFNEIQTGYTPLPGIHESFYLDNTENWSNLKTPSPMDCNNLEFVFIYESEDDSNHFSTKLNPNTKKSLRIISSPLSEISEKSQFRIKQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIRQTHL 186          
BLAST of EGR-like protein 1 vs. TrEMBL
Match: I1ZI70 (Early growth response-3 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 313.538 bits (802), Expect = 8.239e-106
Identity = 153/197 (77.66%), Postives = 170/197 (86.29%), Query Frame = 2
Query:  128 MVKNIQKLTLPVKIDKLEFNEIQTGYTPLPGIHESFYLDNTENWSNLKTPSPMDCNNLEFVFIYESEDDSNHFSTKL-------NPNTKKSLRII----SSPLSEISEKSQFRIKQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFRQNHL 685
            MV+NIQKLTL VKIDK EF+EIQTGYTPLPGIHESFYL+NTENW+NLKTPSPMDC ++EF+ IY S++D+  +ST +         N+ KSL +I    SSPLSE S KSQ R++QF CNTCKK+FYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFRQNHL
Sbjct:    1 MVRNIQKLTLKVKIDKSEFDEIQTGYTPLPGIHESFYLENTENWNNLKTPSPMDCRDIEFILIYGSDEDNKRYSTIIPDSSQSDTSNSNKSLCVITNRCSSPLSENSSKSQNRVRQFMCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFRQNHL 197          
BLAST of EGR-like protein 1 vs. TrEMBL
Match: T1DF98 (Egrl-3 (Fragment) OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 239.58 bits (610), Expect = 8.355e-77
Identity = 114/187 (60.96%), Postives = 144/187 (77.01%), Query Frame = 2
Query:  134 KNIQKLTLPVKIDKLEFNEIQTGYTPLPGIHESFYLDNTENWSNLKTPSPMDCNNLEFVFIYESEDDSNHFSTKLNPNTKKSLRII----SSPLSEISEKSQFRIKQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFRQNH 682
            KN++KL L VKIDK EF  I TGYTPLPG+H+SFY ++T NW+N+KTPSPMDC+++EF+  Y S +++N  ST +  +++ +L        SP SE S KSQ + K+F C+TC KSF RRDELKRHERIH+GERPL+C++C+KRFMRSDH +TH RIHTGEKPY C+ C   FGRSDERLRH R NH
Sbjct:    1 KNLRKLKLSVKIDKTEFENIHTGYTPLPGVHQSFYCNDTINWNNIKTPSPMDCDDIEFILFYNSNEENNVISTVVPVSSENTLTYTFSQCGSPKSETSSKSQLKRKEFPCSTCTKSFSRRDELKRHERIHSGERPLSCDYCNKRFMRSDHRATHLRIHTGEKPYHCHFCPISFGRSDERLRHMRLNH 187          
BLAST of EGR-like protein 1 vs. TrEMBL
Match: T1E116 (Egrl-1 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 1.287e-65
Identity = 100/185 (54.05%), Postives = 133/185 (71.89%), Query Frame = 2
Query:  128 MVKNIQKLTLPVKIDKLEFNEIQTGYTPLPGIHESFYLDNTENWSNLKTPSPMDCNNLEFVFIYESEDDSNHFSTKLNPNTKKSLRIISSPLSEISEKSQFRIKQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFRQNH 682
            MV+N+  + L VKID  EF+   TGYTP PG+H+SFY ++T    N+KTPSP+DC ++EF+ +Y S ++     +K++     +  +I  P ++    SQ   K+F C+TC K F+RRDEL+RH RIH+GERPLAC+FCDKRFMRSDH +TH RIHTGEKPY+C+ C+  FGRSDERLRH R NH
Sbjct:    1 MVRNV--IQLSVKIDLSEFDNFHTGYTPFPGVHQSFYGNDTTQIDNIKTPSPIDCKDIEFILVYSSTEEK----SKMSSEEHFTFSMIPKPKTD----SQTMKKKFICSTCMKPFFRRDELRRHGRIHSGERPLACDFCDKRFMRSDHRTTHRRIHTGEKPYKCHFCASSFGRSDERLRHMRVNH 175          
BLAST of EGR-like protein 1 vs. TrEMBL
Match: I1ZI72 (Early growth response-4 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 1.828e-27
Identity = 51/79 (64.56%), Postives = 62/79 (78.48%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            + F C  C   F RRDELKRHE+IH+GE+PL+C +CDK FMRSDH +TH R HTGEKPY C++CS+ F RSDE+LRH R
Sbjct:  197 RNFPCEFCPAKFSRRDELKRHEKIHSGEKPLSCPYCDKCFMRSDHRTTHIRTHTGEKPYSCDICSKRFARSDEKLRHKR 275          

HSP 2 Score: 58.9214 bits (141), Expect = 2.041e-6
Identity = 30/75 (40.00%), Postives = 40/75 (53.33%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRC---NVCSRLFGRSD 652
            K  +C  C K F R D    H R HTGE+P +C+ C KRF RSD    H RIH  EK  +     +C +L  +++
Sbjct:  225 KPLSCPYCDKCFMRSDHRTTHIRTHTGEKPYSCDICSKRFARSDEKLRHKRIHLKEKSKKNITHEICLKLMSQAN 299          
BLAST of EGR-like protein 1 vs. Ensembl Cavefish
Match: egr4 (early growth response protein 1-B [Source:NCBI gene;Acc:103025429])

HSP 1 Score: 104.375 bits (259), Expect = 5.072e-26
Identity = 49/83 (59.04%), Postives = 56/83 (67.47%), Query Frame = 2
Query:  431 RIKQFTCNT--CKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            R K F C    C++ F R DEL RH R+HTG RP  C  C +RF RSDHL+TH R HTGEKP+ C+VC R F RSDER RH R
Sbjct:  233 REKPFPCPVENCERRFSRSDELNRHVRVHTGHRPFQCRVCSRRFGRSDHLTTHMRTHTGEKPFSCDVCGRRFARSDERKRHAR 315          

HSP 2 Score: 59.6918 bits (143), Expect = 3.863e-10
Identity = 24/57 (42.11%), Postives = 33/57 (57.89%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 607
            + F C  C + F R D L  H R HTGE+P +C+ C +RF RSD    H R+H  ++
Sbjct:  265 RPFQCRVCSRRFGRSDHLTTHMRTHTGEKPFSCDVCGRRFARSDERKRHARVHIKQR 321          
BLAST of EGR-like protein 1 vs. Ensembl Cavefish
Match: egr4 (early growth response protein 1-B [Source:NCBI gene;Acc:103025429])

HSP 1 Score: 104.375 bits (259), Expect = 7.994e-26
Identity = 49/83 (59.04%), Postives = 56/83 (67.47%), Query Frame = 2
Query:  431 RIKQFTCNT--CKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            R K F C    C++ F R DEL RH R+HTG RP  C  C +RF RSDHL+TH R HTGEKP+ C+VC R F RSDER RH R
Sbjct:  272 REKPFPCPVENCERRFSRSDELNRHVRVHTGHRPFQCRVCSRRFGRSDHLTTHMRTHTGEKPFSCDVCGRRFARSDERKRHAR 354          

HSP 2 Score: 59.6918 bits (143), Expect = 4.266e-10
Identity = 24/57 (42.11%), Postives = 33/57 (57.89%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 607
            + F C  C + F R D L  H R HTGE+P +C+ C +RF RSD    H R+H  ++
Sbjct:  304 RPFQCRVCSRRFGRSDHLTTHMRTHTGEKPFSCDVCGRRFARSDERKRHARVHIKQR 360          
BLAST of EGR-like protein 1 vs. Ensembl Cavefish
Match: egr1 (early growth response 1 [Source:NCBI gene;Acc:103036296])

HSP 1 Score: 101.293 bits (251), Expect = 2.714e-24
Identity = 43/73 (58.90%), Postives = 51/73 (69.86%), Query Frame = 2
Query:  455 TCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            TC + F R DEL RH RIHTG++P  C  C + F RSDHL+TH R HTGEKP+ C +C R F RSDER RH +
Sbjct:  324 TCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACEICGRKFARSDERKRHTK 396          

HSP 2 Score: 67.0106 bits (162), Expect = 2.150e-12
Identity = 30/54 (55.56%), Postives = 36/54 (66.67%), Query Frame = 2
Query:  518 ERPLACNF--CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            ERP AC    CD+RF RSD L+ H RIHTG+KP++C +C R F RSD    H R
Sbjct:  315 ERPYACPVETCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIR 368          

HSP 3 Score: 62.3882 bits (150), Expect = 6.321e-11
Identity = 26/53 (49.06%), Postives = 32/53 (60.38%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIH 595
            K F C  C ++F R D L  H R HTGE+P AC  C ++F RSD    HT+IH
Sbjct:  346 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACEICGRKFARSDERKRHTKIH 398          
BLAST of EGR-like protein 1 vs. Ensembl Cavefish
Match: EGR2 (early growth response protein 2b-like [Source:NCBI gene;Acc:103032442])

HSP 1 Score: 96.6709 bits (239), Expect = 6.806e-23
Identity = 41/72 (56.94%), Postives = 50/72 (69.44%), Query Frame = 2
Query:  458 CKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            C + F R DEL RH R+HTG +P  C  C + F RSDHL+TH R HTGEKP+ C++C R F RSDER RH +
Sbjct:  284 CDRRFSRSDELARHVRVHTGHKPFQCRICMRSFGRSDHLTTHIRTHTGEKPFACDLCGRKFARSDERRRHAK 355          

HSP 2 Score: 65.0846 bits (157), Expect = 7.826e-12
Identity = 29/54 (53.70%), Postives = 35/54 (64.81%), Query Frame = 2
Query:  518 ERPLAC--NFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            ERP  C    CD+RF RSD L+ H R+HTG KP++C +C R FGRSD    H R
Sbjct:  274 ERPYPCPAEGCDRRFSRSDELARHVRVHTGHKPFQCRICMRSFGRSDHLTTHIR 327          

HSP 3 Score: 62.003 bits (149), Expect = 8.093e-11
Identity = 26/53 (49.06%), Postives = 32/53 (60.38%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIH 595
            K F C  C +SF R D L  H R HTGE+P AC+ C ++F RSD    H +IH
Sbjct:  305 KPFQCRICMRSFGRSDHLTTHIRTHTGEKPFACDLCGRKFARSDERRRHAKIH 357          
BLAST of EGR-like protein 1 vs. Ensembl Cavefish
Match: egr3 (early growth response 3 [Source:NCBI gene;Acc:103035480])

HSP 1 Score: 95.9005 bits (237), Expect = 1.394e-22
Identity = 42/72 (58.33%), Postives = 48/72 (66.67%), Query Frame = 2
Query:  458 CKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            C + F R DEL RH RIHTG +P  C  C + F RSDHL+TH R HTGEKP+ C  C R F RSDER RH +
Sbjct:  309 CDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCEFCGRKFARSDERKRHAK 380          

HSP 2 Score: 63.929 bits (154), Expect = 2.021e-11
Identity = 30/54 (55.56%), Postives = 35/54 (64.81%), Query Frame = 2
Query:  518 ERPLACNF--CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            ERP AC    CD+RF RSD L+ H RIHTG KP++C +C R F RSD    H R
Sbjct:  299 ERPHACPAENCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIR 352          

HSP 3 Score: 63.1586 bits (152), Expect = 3.712e-11
Identity = 26/57 (45.61%), Postives = 34/57 (59.65%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 607
            K F C  C +SF R D L  H R HTGE+P +C FC ++F RSD    H ++H  +K
Sbjct:  330 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCEFCGRKFARSDERKRHAKVHLKQK 386          
BLAST of EGR-like protein 1 vs. Ensembl Sea Lamprey
Match: egr4 (early growth response 4 [Source:ZFIN;Acc:ZDB-GENE-080204-90])

HSP 1 Score: 97.4413 bits (241), Expect = 1.192e-24
Identity = 46/87 (52.87%), Postives = 54/87 (62.07%), Query Frame = 2
Query:  419 KSQFRIKQFTCNT--CKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            K+    + F C    C + F R DEL RH RIHTG +P  C  C + F RSDHL+TH R HTGEKP+ C+ C R F RSDER RH R
Sbjct:  164 KTPPHARPFPCPAEGCDRRFSRTDELTRHIRIHTGHKPFTCRICMRSFSRSDHLTTHVRTHTGEKPFACDFCGRRFARSDERKRHGR 250          

HSP 2 Score: 68.5514 bits (166), Expect = 5.634e-14
Identity = 30/53 (56.60%), Postives = 34/53 (64.15%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIH 595
            K FTC  C +SF R D L  H R HTGE+P AC+FC +RF RSD    H RIH
Sbjct:  200 KPFTCRICMRSFSRSDHLTTHVRTHTGEKPFACDFCGRRFARSDERKRHGRIH 252          
BLAST of EGR-like protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006002.1 (pep scaffold:Pmarinus_7.0:GL479218:16696:34135:-1 gene:ENSPMAG00000005404.1 transcript:ENSPMAT00000006002.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 88.9669 bits (219), Expect = 1.092e-21
Identity = 40/77 (51.95%), Postives = 49/77 (63.64%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 667
            +Q+ C  C + F R D LK H RIHTGE+P  C  C + F +S  L TH R+HTGEKPYRC VC R+F +S    RH
Sbjct:    3 QQYECRQCGREFVRSDALKAHMRIHTGEKPYRCGACGRAFSQSSGLKTHQRVHTGEKPYRCGVCGRVFAQSSHCNRH 79          

HSP 2 Score: 63.5438 bits (153), Expect = 2.075e-12
Identity = 27/68 (39.71%), Postives = 40/68 (58.82%), Query Frame = 2
Query:  443 FTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGR 646
            F C+ C ++F      +RH R HTG+RP  C  C + F +  ++  H R H GEKP+ C+VC++ F R
Sbjct:  145 FRCDVCSRAFAEYSNYRRHTRTHTGQRPYRCEACGRAFSKRSNMKRHQRSHKGEKPFGCDVCAQGFTR 212          

HSP 3 Score: 56.6102 bits (135), Expect = 5.072e-10
Identity = 27/76 (35.53%), Postives = 41/76 (53.95%), Query Frame = 2
Query:  419 KSQFRI----KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSR 634
            K+  RI    K + C  C ++F +   LK H+R+HTGE+P  C  C + F +S H + H + HT    + C  C+R
Sbjct:   21 KAHMRIHTGEKPYRCGACGRAFSQSSGLKTHQRVHTGEKPYRCGVCGRVFAQSSHCNRHRKAHTVSHMHSCRQCTR 96          

HSP 4 Score: 55.8398 bits (133), Expect = 1.158e-9
Identity = 24/46 (52.17%), Postives = 28/46 (60.87%), Query Frame = 2
Query:  515 GERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSD 652
            G +   C  C + F+RSD L  H RIHTGEKPYRC  C R F +S 
Sbjct:    1 GRQQYECRQCGREFVRSDALKAHMRIHTGEKPYRCGACGRAFSQSS 46          

HSP 5 Score: 53.5286 bits (127), Expect = 6.342e-9
Identity = 28/75 (37.33%), Postives = 36/75 (48.00%), Query Frame = 2
Query:  449 CNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            C  C K      E + H R +  ERP  C+ C + F    +   HTR HTG++PYRC  C R F +     RH R
Sbjct:  119 CIQCYKGSSDVVEFRVHFRANICERPFRCDVCSRAFAEYSNYRRHTRTHTGQRPYRCEACGRAFSKRSNMKRHQR 193          

HSP 6 Score: 53.5286 bits (127), Expect = 7.043e-9
Identity = 23/60 (38.33%), Postives = 34/60 (56.67%), Query Frame = 2
Query:  443 FTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCN 622
            + C  C ++F +R  +KRH+R H GE+P  C+ C + F R  +L  H   H GE P  C+
Sbjct:  173 YRCEACGRAFSKRSNMKRHQRSHKGEKPFGCDVCAQGFTRLCNLKVHLLKHAGEFPQICS 232          
BLAST of EGR-like protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000923.1 (pep scaffold:Pmarinus_7.0:GL480775:18221:19434:-1 gene:ENSPMAG00000000839.1 transcript:ENSPMAT00000000923.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.9593 bits (206), Expect = 3.800e-21
Identity = 36/79 (45.57%), Postives = 47/79 (59.49%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            + + C  C + F R    +RH R+HTGERP AC  C +RF +  HL+ HTR+HTGE+PY C  C R F +     RH R
Sbjct:   20 RPYACGDCGRRFARGANEERHRRVHTGERPYACAACGRRFRQKPHLAAHTRLHTGERPYACAACGRRFAKPYSLTRHLR 98          

HSP 2 Score: 58.151 bits (139), Expect = 1.786e-11
Identity = 25/46 (54.35%), Postives = 29/46 (63.04%), Query Frame = 2
Query:  503 RIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLF 640
            R HTGERP AC  C +RF R  +   H R+HTGE+PY C  C R F
Sbjct:   14 RNHTGERPYACGDCGRRFARGANEERHRRVHTGERPYACAACGRRF 59          
BLAST of EGR-like protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007569.1 (pep scaffold:Pmarinus_7.0:GL477836:135382:139743:-1 gene:ENSPMAG00000006836.1 transcript:ENSPMAT00000007569.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 84.7297 bits (208), Expect = 5.569e-20
Identity = 50/136 (36.76%), Postives = 68/136 (50.00%), Query Frame = 2
Query:  308 VFIYESEDDSNHFSTKLNPNTKKSLRIISSPLSEISEKSQFRIKQ--------------FTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            V +Y  ED    FS   +    + +     P S       FR+KQ              F C+ C + F  +  L+ H R HTGERP AC+FCD+RF+RSD+L+ H RIHTGE+P+ C  C + F  S    +H R
Sbjct:   87 VNLYACEDCGKKFSLSHDLTRHRRIHTGERPFSCRDCGMTFRLKQHLRRHQKTHEGEAPFRCDHCGRLFMHKRSLRIHVRNHTGERPYACDFCDQRFLRSDNLTRHRRIHTGERPFGCERCGKRFSCSHHLTQHRR 222          

HSP 2 Score: 72.4034 bits (176), Expect = 1.810e-15
Identity = 35/80 (43.75%), Postives = 47/80 (58.75%), Query Frame = 2
Query:  443 FTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFRQNH 682
            + C+ C + F R D L RH RIHTGERP  C  C KRF  S HL+ H R  T   P+ C +C ++FG+  + L + +Q H
Sbjct:  174 YACDFCDQRFLRSDNLTRHRRIHTGERPFGCERCGKRFSCSHHLTQHRRSCTMTAPFTCTLCGQMFGKKSDSLGYHQQLH 253          

HSP 3 Score: 67.0106 bits (162), Expect = 1.297e-13
Identity = 31/75 (41.33%), Postives = 41/75 (54.67%), Query Frame = 2
Query:  416 EKSQFRIKQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLF 640
            +++   +  + C  C K F    +L RH RIHTGERP +C  C   F    HL  H + H GE P+RC+ C RLF
Sbjct:   81 QRTHTGVNLYACEDCGKKFSLSHDLTRHRRIHTGERPFSCRDCGMTFRLKQHLRRHQKTHEGEAPFRCDHCGRLF 155          

HSP 4 Score: 64.6994 bits (156), Expect = 1.013e-12
Identity = 32/66 (48.48%), Postives = 40/66 (60.61%), Query Frame = 2
Query:  446 TCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGE-KPYRCNVCSRLF 640
             C  C   F +  E+ RH RIHTGE+P AC  C +RF  S+ L+ H RIHTGE KP++C  C   F
Sbjct:    6 ACEVCGALFRKACEVTRHRRIHTGEKPFACEKCGRRFTWSNSLARHRRIHTGESKPFQCGDCGHRF 71          

HSP 5 Score: 56.6102 bits (135), Expect = 5.941e-10
Identity = 33/82 (40.24%), Postives = 42/82 (51.22%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFRQNH 682
            K F C  C   F      +RH+R HTG    AC  C K+F  S  L+ H RIHTGE+P+ C  C   F R  + LR  ++ H
Sbjct:   60 KPFQCGDCGHRFRNVISFRRHQRTHTGVNLYACEDCGKKFSLSHDLTRHRRIHTGERPFSCRDCGMTF-RLKQHLRRHQKTH 140          

HSP 6 Score: 52.7582 bits (125), Expect = 1.147e-8
Identity = 32/80 (40.00%), Postives = 37/80 (46.25%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGE-RPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            K F C  C + F   + L RH RIHTGE +P  C  C  RF        H R HTG   Y C  C + F  S +  RH R
Sbjct:   31 KPFACEKCGRRFTWSNSLARHRRIHTGESKPFQCGDCGHRFRNVISFRRHQRTHTGVNLYACEDCGKKFSLSHDLTRHRR 110          
BLAST of EGR-like protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007831.1 (pep scaffold:Pmarinus_7.0:GL477655:47469:47963:1 gene:ENSPMAG00000007084.1 transcript:ENSPMAT00000007831.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 79.7221 bits (195), Expect = 1.360e-19
Identity = 34/78 (43.59%), Postives = 48/78 (61.54%), Query Frame = 2
Query:  434 IKQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 667
             K F C  C K+F +  +L+ H+R HTGE+P  C+ C+K F +S +L  H R HTGEKP++C VC + F  S    +H
Sbjct:   29 TKPFRCPLCGKAFAKSSDLQSHQRTHTGEKPFKCSVCEKAFSQSSNLKKHQRTHTGEKPFKCTVCEKAFTESSPLRKH 106          

HSP 2 Score: 68.9366 bits (167), Expect = 1.773e-15
Identity = 33/79 (41.77%), Postives = 45/79 (56.96%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            K F C  C+K+F +   L  H R HT  +P  C  C K F +S  L +H R HTGEKP++C+VC + F +S    +H R
Sbjct:    4 KPFKCTVCEKAFAQSSYLTIHLRTHT--KPFRCPLCGKAFAKSSDLQSHQRTHTGEKPFKCSVCEKAFSQSSNLKKHQR 80          

HSP 3 Score: 53.1434 bits (126), Expect = 1.364e-9
Identity = 23/54 (42.59%), Postives = 33/54 (61.11%), Query Frame = 2
Query:  512 TGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            TGE+P  C  C+K F +S +L+ H R HT  KP+RC +C + F +S +   H R
Sbjct:    1 TGEKPFKCTVCEKAFAQSSYLTIHLRTHT--KPFRCPLCGKAFAKSSDLQSHQR 52          
BLAST of EGR-like protein 1 vs. Ensembl Yeast
Match: ZAP1 (Zinc-regulated transcription factor; binds to zinc-responsive promoters to induce transcription of certain genes in presence of zinc, represses other genes in low zinc; regulates its own transcription; contains seven zinc-finger domains [Source:SGD;Acc:S000003592])

HSP 1 Score: 77.7962 bits (190), Expect = 6.727e-17
Identity = 33/85 (38.82%), Postives = 48/85 (56.47%), Query Frame = 2
Query:  419 KSQFRIKQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            K   + K + C TCK+ F   + L +H R H+GE+P  C+ C+K+F  S  L  H R HTGEKP +C +C + F  S    +H +
Sbjct:  760 KVHSKYKPYKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHIK 844          

HSP 2 Score: 63.1586 bits (152), Expect = 5.040e-12
Identity = 31/68 (45.59%), Postives = 40/68 (58.82%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLF 640
            K + C+ C K F     LK H R HTGE+PL C  C KRF  S +LS H + H  +K Y+C+ CS+ F
Sbjct:  794 KPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHIKTH--QKKYKCSDCSKSF 859          

HSP 3 Score: 62.7734 bits (151), Expect = 6.853e-12
Identity = 27/72 (37.50%), Postives = 43/72 (59.72%), Query Frame = 2
Query:  458 CKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            C ++F +R +L RH ++H+  +P  C  C + F   + L  HTR H+GEKPY+C++C++ F  S     H R
Sbjct:  745 CHRTFPQRQKLIRHLKVHSKYKPYKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIR 816          
BLAST of EGR-like protein 1 vs. Ensembl Yeast
Match: AZF1 (Zinc-finger transcription factor; involved in diauxic shift; in the presence of glucose, activates transcription of genes involved in growth and carbon metabolism; in nonfermentable carbon sources, activates transcription of genes involved in maintenance of cell wall integrity; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000005639])

HSP 1 Score: 76.2554 bits (186), Expect = 1.987e-16
Identity = 31/79 (39.24%), Postives = 45/79 (56.96%), Query Frame = 2
Query:  434 IKQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHF 670
            +K+  C  C + F +   L+ H R H G +P  C++C KRF +  +L TH R+HTGEKPY C++C + F R      H 
Sbjct:  590 VKKHECPYCHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHL 668          

HSP 2 Score: 71.2478 bits (173), Expect = 1.042e-14
Identity = 31/80 (38.75%), Postives = 47/80 (58.75%), Query Frame = 2
Query:  407 EISEKSQFRIKQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNV--CSRLF 640
            E+  +S    K F C+ C K F +   L+ HER+HTGE+P +C+ CDK+F R  +L+ H   H   KP+ C +  C++ F
Sbjct:  609 EVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTF 688          
BLAST of EGR-like protein 1 vs. Ensembl Yeast
Match: CRZ1 (Transcription factor, activates transcription of stress response genes; nuclear localization is positively regulated by calcineurin-mediated dephosphorylation; rapidly localizes to the nucleus under blue light stress; can be activated in stochastic pulses of nuclear localization in response to calcium [Source:SGD;Acc:S000004972])

HSP 1 Score: 68.1662 bits (165), Expect = 1.114e-13
Identity = 35/86 (40.70%), Postives = 41/86 (47.67%), Query Frame = 2
Query:  443 FTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCN---------VCSRLFGRSDERLRHFR 673
            F C+ C K F R   LK H R HT ERP  C+ C K F R      H  +HTG+K Y C           C + F RSD   RHF+
Sbjct:  569 FACDVCGKKFTRPYNLKSHLRTHTNERPFICSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRHFK 654          

HSP 2 Score: 48.521 bits (114), Expect = 3.754e-7
Identity = 23/64 (35.94%), Postives = 34/64 (53.12%), Query Frame = 2
Query:  443 FTCNTCKKSFYRRDELKRHERIHTGERPLACNF---------CDKRFMRSDHLSTHTRIHTGEK 607
            F C+ C K+F R+ + KRHE +HTG++   C           C K+F RSD L  H +  +G +
Sbjct:  597 FICSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRHFKTESGRR 660          
BLAST of EGR-like protein 1 vs. Ensembl Yeast
Match: MSN2 (Stress-responsive transcriptional activator; activated in stochastic pulses of nuclear localization in response to various stress conditions; binds DNA at stress response elements of responsive genes; relative distribution to nucleus increases upon DNA replication stress [Source:SGD;Acc:S000004640])

HSP 1 Score: 67.3958 bits (163), Expect = 2.110e-13
Identity = 31/63 (49.21%), Postives = 40/63 (63.49%), Query Frame = 2
Query:  410 ISEKSQFRIKQFTCNTCKKSFYRRDELKRHER-IHTGERPLACNFCDKRFMRSDHLSTHTRIH 595
            I    +   K F C+ C KSF R + LKRH R +H+ ERP AC+ CDK+F RSD+LS H + H
Sbjct:  636 IESTKELEEKPFHCHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIKTH 698          

HSP 2 Score: 55.8398 bits (133), Expect = 1.569e-9
Identity = 22/53 (41.51%), Postives = 34/53 (64.15%), Query Frame = 2
Query:  518 ERPLACNFCDKRFMRSDHLSTHTR-IHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            E+P  C+ C K F RS+HL  H R +H+ E+P+ C++C + F RSD   +H +
Sbjct:  644 EKPFHCHICPKSFKRSEHLKRHVRSVHSNERPFACHICDKKFSRSDNLSQHIK 696          
BLAST of EGR-like protein 1 vs. Ensembl Yeast
Match: MIG1 (Transcription factor involved in glucose repression; sequence specific DNA binding protein containing two Cys2His2 zinc finger motifs; regulated by the SNF1 kinase and the GLC7 phosphatase; regulates filamentous growth along with Mig2p in response to glucose depletion; activated in stochastic pulses of nuclear localization, shuttling between cytosol and nucleus depending on external glucose levels and its phosphorylation state [Source:SGD;Acc:S000003003])

HSP 1 Score: 65.4698 bits (158), Expect = 7.662e-13
Identity = 33/71 (46.48%), Postives = 45/71 (63.38%), Query Frame = 2
Query:  404 SEISEKSQFRIKQFTCNTCKKSFYRRDELKRHERIHTGERPLACNF--CDKRFMRSDHLSTHTRIHTGEKP 610
            S+++ KS+   +   C  C ++F+R +   RH RIHTGE+P AC+F  C KRF RSD L+ H RIHT   P
Sbjct:   26 SKVAAKSEA-PRPHACPICHRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHP 95          

HSP 2 Score: 56.6102 bits (135), Expect = 6.456e-10
Identity = 27/55 (49.09%), Postives = 33/55 (60.00%), Query Frame = 2
Query:  515 GERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNV--CSRLFGRSDERLRHFR 673
              RP AC  C + F R +H + H RIHTGEKP+ C+   C + F RSDE  RH R
Sbjct:   34 APRPHACPICHRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRR 88          
BLAST of EGR-like protein 1 vs. Ensembl Nematostella
Match: EDO49112 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGT8])

HSP 1 Score: 91.2781 bits (225), Expect = 5.656e-24
Identity = 42/73 (57.53%), Postives = 49/73 (67.12%), Query Frame = 2
Query:  455 TCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            TC + F R DEL RH R HTG++P  C  C + F RSDHL+TH R HTGEKP+ C  C R F RSDER RH +
Sbjct:   10 TCPRRFSRSDELTRHMRTHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACETCGRRFARSDERRRHMK 82          

HSP 2 Score: 55.8398 bits (133), Expect = 1.634e-10
Identity = 27/56 (48.21%), Postives = 32/56 (57.14%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGE 604
            K F C  C ++F R D L  H R HTGE+P AC  C +RF RSD    H +IH  E
Sbjct:   32 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACETCGRRFARSDERRRHMKIHLRE 87          
BLAST of EGR-like protein 1 vs. Ensembl Nematostella
Match: EDO49116 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGU6])

HSP 1 Score: 81.2629 bits (199), Expect = 2.741e-19
Identity = 38/78 (48.72%), Postives = 45/78 (57.69%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHF 670
            K +TC  C K F R    +RH  IHTG++P  C  C K F  + HL  H RIHTGEKPY CN+CSR F +     RH 
Sbjct:    2 KPYTCQHCSKVFTRSWNFQRHVLIHTGQKPYKCQKCPKAFALAAHLKIHNRIHTGEKPYTCNICSRGFAQLTNLQRHI 79          

HSP 2 Score: 76.2554 bits (186), Expect = 2.257e-17
Identity = 35/78 (44.87%), Postives = 45/78 (57.69%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHF 670
            K +TCN C + F +   L+RH   HTGE+P  C +C K F+ S  L  H RIHTGE+PY+C  CS+ F  S     H 
Sbjct:   58 KPYTCNICSRGFAQLTNLQRHILTHTGEKPHKCTYCPKAFVSSSDLRRHVRIHTGERPYKCKQCSKAFTTSGNLQSHI 135          

HSP 3 Score: 74.3294 bits (181), Expect = 1.424e-16
Identity = 36/79 (45.57%), Postives = 45/79 (56.96%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            K   C  C K+F    +L+RH RIHTGERP  C  C K F  S +L +H   HTGEKPY+C++C+  F  S     H R
Sbjct:   86 KPHKCTYCPKAFVSSSDLRRHVRIHTGERPYKCKQCSKAFTTSGNLQSHILTHTGEKPYKCSICNWKFISSSNLRTHIR 164          

HSP 4 Score: 73.559 bits (179), Expect = 2.814e-16
Identity = 34/79 (43.04%), Postives = 44/79 (55.70%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            K + C  C K+F     LK H RIHTGE+P  CN C + F +  +L  H   HTGEKP++C  C + F  S +  RH R
Sbjct:   30 KPYKCQKCPKAFALAAHLKIHNRIHTGEKPYTCNICSRGFAQLTNLQRHILTHTGEKPHKCTYCPKAFVSSSDLRRHVR 108          

HSP 5 Score: 48.521 bits (114), Expect = 2.581e-7
Identity = 21/51 (41.18%), Postives = 30/51 (58.82%), Query Frame = 2
Query:  443 FTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIH 595
            + C  C K+F     L+ H   HTGE+P  C+ C+ +F+ S +L TH RIH
Sbjct:  116 YKCKQCSKAFTTSGNLQSHILTHTGEKPYKCSICNWKFISSSNLRTHIRIH 166          

HSP 6 Score: 45.0542 bits (105), Expect = 4.176e-6
Identity = 20/52 (38.46%), Postives = 27/52 (51.92%), Query Frame = 2
Query:  518 ERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            ++P  C  C K F RS +   H  IHTG+KPY+C  C + F  +     H R
Sbjct:    1 DKPYTCQHCSKVFTRSWNFQRHVLIHTGQKPYKCQKCPKAFALAAHLKIHNR 52          
BLAST of EGR-like protein 1 vs. Ensembl Nematostella
Match: EDO29702 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2W2])

HSP 1 Score: 82.8037 bits (203), Expect = 5.715e-19
Identity = 40/88 (45.45%), Postives = 54/88 (61.36%), Query Frame = 2
Query:  419 KSQFRI----KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHF 670
            K+  RI    K + C+ C K F +  +LKRH +IHTG++P  C  C K F RS+ L TH RIH+G+KPY+C+VC + F  S    RH 
Sbjct:   80 KTHLRIHSGQKPYKCDECGKCFIQYVDLKRHLKIHTGQKPYECGECGKCFTRSERLKTHLRIHSGQKPYKCDVCGKCFSESRNLKRHL 167          

HSP 2 Score: 74.3294 bits (181), Expect = 6.830e-16
Identity = 33/78 (42.31%), Postives = 46/78 (58.97%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHF 670
            K + C  C K F R + LK H RIH+G++P  C+ C K F  S +L  H  IH+G+KPY+C+VC + F  S    +H 
Sbjct:  118 KPYECGECGKCFTRSERLKTHLRIHSGQKPYKCDVCGKCFSESRNLKRHLMIHSGQKPYKCDVCGKCFSESGNLKKHL 195          

HSP 3 Score: 73.559 bits (179), Expect = 1.160e-15
Identity = 33/79 (41.77%), Postives = 50/79 (63.29%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            K + C+ C K F +   L RH RIH+G++P  C+ C K F +S +L TH RIH+G+KPY+C+ C + F +  +  RH +
Sbjct:   34 KPYRCDECGKGFTQSGALNRHLRIHSGQKPYKCDECGKCFNQSANLKTHLRIHSGQKPYKCDECGKCFIQYVDLKRHLK 112          

HSP 4 Score: 70.8626 bits (172), Expect = 1.193e-14
Identity = 33/79 (41.77%), Postives = 46/79 (58.23%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            K + C+ C K F +   LK H RIH+G++P  C+ C K F++   L  H +IHTG+KPY C  C + F RS+    H R
Sbjct:   62 KPYKCDECGKCFNQSANLKTHLRIHSGQKPYKCDECGKCFIQYVDLKRHLKIHTGQKPYECGECGKCFTRSERLKTHLR 140          

HSP 5 Score: 70.0922 bits (170), Expect = 2.078e-14
Identity = 32/75 (42.67%), Postives = 44/75 (58.67%), Query Frame = 2
Query:  449 CNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            C  C   F R   LKRH  IH+G++P  C+ C K F +S  L+ H RIH+G+KPY+C+ C + F +S     H R
Sbjct:   10 CGECGMGFTRHAYLKRHLMIHSGQKPYRCDECGKGFTQSGALNRHLRIHSGQKPYKCDECGKCFNQSANLKTHLR 84          

HSP 6 Score: 68.1662 bits (165), Expect = 1.000e-13
Identity = 32/78 (41.03%), Postives = 45/78 (57.69%), Query Frame = 2
Query:  419 KSQFRI----KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLF 640
            K+  RI    K + C+ C K F     LKRH  IH+G++P  C+ C K F  S +L  H  IH+G+KPY+C+ C + F
Sbjct:  136 KTHLRIHSGQKPYKCDVCGKCFSESRNLKRHLMIHSGQKPYKCDVCGKCFSESGNLKKHLMIHSGQKPYKCDECGKCF 213          

HSP 7 Score: 58.9214 bits (141), Expect = 1.696e-10
Identity = 28/74 (37.84%), Postives = 44/74 (59.46%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLST---HTRIHTGEKPYRCNVCSRLFGRS 649
            K + C+ C K F     LK+H  IH+G++P  C+ C K F+   +L T   H  IH+G+KP++C+ C + F +S
Sbjct:  174 KPYKCDVCGKCFSESGNLKKHLMIHSGQKPYKCDECGKCFILYRNLKTHLIHLMIHSGQKPHKCDECGKCFHQS 247          

HSP 8 Score: 48.1358 bits (113), Expect = 9.657e-7
Identity = 22/52 (42.31%), Postives = 29/52 (55.77%), Query Frame = 2
Query:  518 ERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            E+P  C  C   F R  +L  H  IH+G+KPYRC+ C + F +S    RH R
Sbjct:    5 EKPNECGECGMGFTRHAYLKRHLMIHSGQKPYRCDECGKGFTQSGALNRHLR 56          
BLAST of EGR-like protein 1 vs. Ensembl Nematostella
Match: EDO43177 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ64])

HSP 1 Score: 80.4925 bits (197), Expect = 6.589e-19
Identity = 40/89 (44.94%), Postives = 57/89 (64.04%), Query Frame = 2
Query:  419 KSQFRI----KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSD---ERLR 664
            K+  R+    K F C TC+KSF +   LK H R+H+ E+P  C+ C +RF +S  ++TH RIH+GE+PY+C VC+R F  S    +RLR
Sbjct:   50 KAHLRVHTGKKPFRCPTCQKSFSQDANLKAHLRVHSKEKPFKCHICHRRFAQSSSVTTHMRIHSGERPYKCKVCARGFSDSSTLTKRLR 138          

HSP 2 Score: 70.4774 bits (171), Expect = 3.257e-15
Identity = 31/77 (40.26%), Postives = 45/77 (58.44%), Query Frame = 2
Query:  443 FTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
             TC+ C K + R   LK H R+HTG++P  C  C K F +  +L  H R+H+ EKP++C++C R F +S     H R
Sbjct:   34 ITCHVCHKIYSRPSTLKAHLRVHTGKKPFRCPTCQKSFSQDANLKAHLRVHSKEKPFKCHICHRRFAQSSSVTTHMR 110          

HSP 3 Score: 70.4774 bits (171), Expect = 4.208e-15
Identity = 35/89 (39.33%), Postives = 47/89 (52.81%), Query Frame = 2
Query:  419 KSQFRI----KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            K+  R+    K F C+ C + F +   +  H RIH+GERP  C  C + F  S  L+   R HTGEKPY+C +C   F +S    RH R
Sbjct:   78 KAHLRVHSKEKPFKCHICHRRFAQSSSVTTHMRIHSGERPYKCKVCARGFSDSSTLTKRLRTHTGEKPYQCRICGMSFSQSGNLSRHMR 166          
BLAST of EGR-like protein 1 vs. Ensembl Nematostella
Match: EDO43107 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZJ7])

HSP 1 Score: 81.6481 bits (200), Expect = 1.418e-18
Identity = 37/74 (50.00%), Postives = 47/74 (63.51%), Query Frame = 2
Query:  449 CNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHF 670
            C  C K+FY  ++L+RH RIH+GERP  C  CDK F  +  L THT IHTGEKP++C  C + F  S +  RH 
Sbjct:   61 CPVCPKAFYSSNDLRRHSRIHSGERPYICKHCDKSFATTISLKTHTYIHTGEKPHKCPQCPKTFATSSKLGRHI 134          

HSP 2 Score: 60.8474 bits (146), Expect = 3.617e-11
Identity = 29/69 (42.03%), Postives = 41/69 (59.42%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFG 643
            +++ C+ C K+F     L++H   HTGERP  C  C K F  S+ L  H+RIH+GE+PY C  C + F 
Sbjct:   29 RKWKCSMCDKAFRHPFGLQQHIYTHTGERPHQCPVCPKAFYSSNDLRRHSRIHSGERPYICKHCDKSFA 97          

HSP 3 Score: 58.5362 bits (140), Expect = 2.856e-10
Identity = 31/80 (38.75%), Postives = 39/80 (48.75%), Query Frame = 2
Query:  443 FTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFRQNH 682
            + C  C KSF     LK H  IHTGE+P  C  C K F  S  L  H   H+ ++P+ C  C + F RS +  RH    H
Sbjct:   87 YICKHCDKSFATTISLKTHTYIHTGEKPHKCPQCPKTFATSSKLGRHIVTHSEQRPFSCEQCMKSFNRSGDLRRHCMTVH 166          

HSP 4 Score: 48.1358 bits (113), Expect = 7.976e-7
Identity = 30/79 (37.97%), Postives = 40/79 (50.63%), Query Frame = 2
Query:  446 TCNTCKKSFYRRDELKRH-ERI--HTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            TC  C K F   + L RH +R+      R   C+ CDK F     L  H   HTGE+P++C VC + F  S++  RH R
Sbjct:    1 TCGKCGKIFTSLNYLARHIKRVCPDMSCRKWKCSMCDKAFRHPFGLQQHIYTHTGERPHQCPVCPKAFYSSNDLRRHSR 79          
BLAST of EGR-like protein 1 vs. Ensembl Medaka
Match: egr1 (early growth response 1 [Source:NCBI gene;Acc:100272163])

HSP 1 Score: 101.293 bits (251), Expect = 2.870e-24
Identity = 43/73 (58.90%), Postives = 51/73 (69.86%), Query Frame = 2
Query:  455 TCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            TC + F R DEL RH RIHTG++P  C  C + F RSDHL+TH R HTGEKP+ C +C R F RSDER RH +
Sbjct:  319 TCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACEICGRKFARSDERKRHTK 391          

HSP 2 Score: 67.0106 bits (162), Expect = 1.787e-12
Identity = 38/94 (40.43%), Postives = 47/94 (50.00%), Query Frame = 2
Query:  434 IKQFTCNTCK---KSFYRRDELK---------RHERIHTGERPLACNF--CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            IK F   T     K  Y+   +K         R  +    ERP AC    CD+RF RSD L+ H RIHTG+KP++C +C R F RSD    H R
Sbjct:  270 IKAFATQTGSQDLKGVYQSQLIKPSRMRKYPTRPSKTPPHERPYACPVETCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIR 363          

HSP 3 Score: 63.1586 bits (152), Expect = 3.522e-11
Identity = 27/57 (47.37%), Postives = 34/57 (59.65%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 607
            K F C  C ++F R D L  H R HTGE+P AC  C ++F RSD    HT+IH  +K
Sbjct:  341 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACEICGRKFARSDERKRHTKIHLRQK 397          
BLAST of EGR-like protein 1 vs. Ensembl Medaka
Match: ENSORLT00000000940.2 (early growth response protein 1 [Source:NCBI gene;Acc:101160576])

HSP 1 Score: 98.5969 bits (244), Expect = 2.317e-23
Identity = 41/75 (54.67%), Postives = 52/75 (69.33%), Query Frame = 2
Query:  449 CNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
             + C++ F R DEL RH R+HTG++P  C  C + F RSDHL+TH R HTGEKP+ C+ C R F RSDER RH +
Sbjct:  287 ADGCERRFSRSDELTRHVRVHTGQKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFPCSECGRKFARSDERKRHAK 361          

HSP 2 Score: 65.0846 bits (157), Expect = 8.029e-12
Identity = 38/115 (33.04%), Postives = 59/115 (51.30%), Query Frame = 2
Query:  353 KLNPNT-KKSLRIISSPLS-------EISEKSQFRIKQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            +L+P+  +K L+   +PLS       +I  +    +   +C + K    R+     HER H        + C++RF RSD L+ H R+HTG+KP++C +C R F RSD    H R
Sbjct:  223 ELSPSPDQKPLQPPFTPLSTIKAFSAQIQPQGPGGLLAKSCQSKKSPGGRQCRTPPHERPHV----CPADGCERRFSRSDELTRHVRVHTGQKPFQCRICMRSFSRSDHLTTHIR 333          

HSP 3 Score: 59.3066 bits (142), Expect = 6.024e-10
Identity = 25/53 (47.17%), Postives = 31/53 (58.49%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIH 595
            K F C  C +SF R D L  H R HTGE+P  C+ C ++F RSD    H +IH
Sbjct:  311 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFPCSECGRKFARSDERKRHAKIH 363          
BLAST of EGR-like protein 1 vs. Ensembl Medaka
Match: ENSORLT00000034291.1 (early growth response protein 2b [Source:NCBI gene;Acc:101164744])

HSP 1 Score: 96.6709 bits (239), Expect = 6.476e-23
Identity = 51/127 (40.16%), Postives = 64/127 (50.39%), Query Frame = 2
Query:  305 FVFIYESEDDSNHFSTKLNPNTKKSLRIISSPLSEISEKSQFRIKQ--FTC--NTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            F     S       +     +    LR I  P    +  S+  + Q  + C   +C + F R DEL RH RIHTG +P  C  C + F RSDHL+TH R HTGEKP+ C  C R F RSDER RH +
Sbjct:  256 FTLAAPSSAAEGPMAAAFPAHQNLPLRPILRPRKYPNRPSKTPVHQRPYPCPAESCDRRFSRSDELSRHLRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFSCQQCGRKFARSDERRRHMK 382          

HSP 2 Score: 56.9954 bits (136), Expect = 3.279e-9
Identity = 25/57 (43.86%), Postives = 33/57 (57.89%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 607
            K F C  C ++F R D L  H R HTGE+P +C  C ++F RSD    H +IH  +K
Sbjct:  332 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFSCQQCGRKFARSDERRRHMKIHLRQK 388          
BLAST of EGR-like protein 1 vs. Ensembl Medaka
Match: egr3 (early growth response 3 [Source:NCBI gene;Acc:100272164])

HSP 1 Score: 95.9005 bits (237), Expect = 1.475e-22
Identity = 42/72 (58.33%), Postives = 48/72 (66.67%), Query Frame = 2
Query:  458 CKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            C + F R DEL RH RIHTG +P  C  C + F RSDHL+TH R HTGEKP+ C  C R F RSDER RH +
Sbjct:  303 CDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCEFCGRKFARSDERKRHAK 374          

HSP 2 Score: 63.5438 bits (153), Expect = 2.312e-11
Identity = 30/54 (55.56%), Postives = 35/54 (64.81%), Query Frame = 2
Query:  518 ERPLACNF--CDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            ERP AC    CD+RF RSD L+ H RIHTG KP++C +C R F RSD    H R
Sbjct:  293 ERPHACPAENCDRRFSRSDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIR 346          

HSP 3 Score: 62.7734 bits (151), Expect = 4.328e-11
Identity = 26/57 (45.61%), Postives = 34/57 (59.65%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 607
            K F C  C +SF R D L  H R HTGE+P +C FC ++F RSD    H ++H  +K
Sbjct:  324 KPFQCRICMRSFSRSDHLTTHIRTHTGEKPFSCEFCGRKFARSDERKRHAKVHLKQK 380          
BLAST of EGR-like protein 1 vs. Ensembl Medaka
Match: egr2b (early growth response 2 [Source:NCBI gene;Acc:101170128])

HSP 1 Score: 95.5153 bits (236), Expect = 2.784e-22
Identity = 42/70 (60.00%), Postives = 48/70 (68.57%), Query Frame = 2
Query:  458 CKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 667
            C + F R DEL RH RIHTG +P  C  C + F RSDHL+TH R HTGEKP+ C+ C R F RSDER RH
Sbjct:  337 CDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDFCGRKFARSDERKRH 406          

HSP 2 Score: 65.0846 bits (157), Expect = 7.977e-12
Identity = 28/57 (49.12%), Postives = 36/57 (63.16%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEK 607
            K F C  C ++F R D L  H R HTGE+P AC+FC ++F RSD    HT+IH  +K
Sbjct:  358 KPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDFCGRKFARSDERKRHTKIHLRQK 414          

HSP 3 Score: 61.6178 bits (148), Expect = 1.278e-10
Identity = 29/54 (53.70%), Postives = 34/54 (62.96%), Query Frame = 2
Query:  518 ERPLAC--NFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            ERP  C    CD+RF RSD L+ H RIHTG KP++C +C R F RSD    H R
Sbjct:  327 ERPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIR 380          
BLAST of EGR-like protein 1 vs. Planmine SMEST
Match: SMESG000000960.1 (SMESG000000960.1)

HSP 1 Score: 368.237 bits (944), Expect = 3.059e-131
Identity = 177/186 (95.16%), Postives = 180/186 (96.77%), Query Frame = 2
Query:  128 MVKNIQKLTLPVKIDKLEFNEIQTGYTPLPGIHESFYLDNTENWSNLKTPSPMDCNNLEFVFIYESEDDSNHFSTKLNPNTKKSLRIISSPLSEISEKSQFRIKQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFRQNHL 685
            MVKNIQKLTLPVKIDKLEFNEIQTGYTPLPGIHESFYLDNTENWSNLKTPSPMDCNNLEFVFIYESEDDSNHFSTKLNPNTKKSLRIISSPLSEISEKSQFRIKQFTCNTCKKSFYRRDELKRHERIHTGERPLAC+FCDKRFMRSDHLSTH RIHTGEKPY+C+ C RLF RSDERLRH RQ HL
Sbjct:    1 MVKNIQKLTLPVKIDKLEFNEIQTGYTPLPGIHESFYLDNTENWSNLKTPSPMDCNNLEFVFIYESEDDSNHFSTKLNPNTKKSLRIISSPLSEISEKSQFRIKQFTCNTCKKSFYRRDELKRHERIHTGERPLACHFCDKRFMRSDHLSTHVRIHTGEKPYQCSYCDRLFSRSDERLRHIRQTHL 186          
BLAST of EGR-like protein 1 vs. Planmine SMEST
Match: SMESG000000959.1 (SMESG000000959.1)

HSP 1 Score: 315.464 bits (807), Expect = 3.887e-110
Identity = 154/197 (78.17%), Postives = 171/197 (86.80%), Query Frame = 2
Query:  128 MVKNIQKLTLPVKIDKLEFNEIQTGYTPLPGIHESFYLDNTENWSNLKTPSPMDCNNLEFVFIYESEDDSNHFSTKL-------NPNTKKSLRII----SSPLSEISEKSQFRIKQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFRQNHL 685
            MV+NIQKLTL VKIDK EF+EIQTGYTPLPGIHESFYL+NTENW+NLKTPSPMDC ++EF+ IY S++D+  +ST +         N+ KSL +I    SSPLSE S KSQ R++QFTCNTCKK+FYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFRQNHL
Sbjct:    1 MVRNIQKLTLKVKIDKSEFDEIQTGYTPLPGIHESFYLENTENWNNLKTPSPMDCRDIEFILIYGSDEDNKRYSTIIPDSSQSDTSNSNKSLCVITNRCSSPLSENSSKSQNRVRQFTCNTCKKAFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFRQNHL 197          
BLAST of EGR-like protein 1 vs. Planmine SMEST
Match: SMESG000028801.1 (SMESG000028801.1)

HSP 1 Score: 117.087 bits (292), Expect = 3.366e-31
Identity = 51/79 (64.56%), Postives = 62/79 (78.48%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            + F C  C   F RRDELKRHE+IH+GE+PL+C +CDK FMRSDH +TH R HTGEKPY C++CS+ F RSDE+LRH R
Sbjct:  176 RNFPCEFCPAKFSRRDELKRHEKIHSGEKPLSCPYCDKCFMRSDHRTTHIRTHTGEKPYSCDICSKRFARSDEKLRHKR 254          

HSP 2 Score: 58.9214 bits (141), Expect = 5.400e-10
Identity = 30/75 (40.00%), Postives = 40/75 (53.33%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRC---NVCSRLFGRSD 652
            K  +C  C K F R D    H R HTGE+P +C+ C KRF RSD    H RIH  EK  +     +C +L  +++
Sbjct:  204 KPLSCPYCDKCFMRSDHRTTHIRTHTGEKPYSCDICSKRFARSDEKLRHKRIHLKEKSKKNITHEICLKLMSQAN 278          

HSP 3 Score: 55.8398 bits (133), Expect = 5.799e-9
Identity = 25/52 (48.08%), Postives = 29/52 (55.77%), Query Frame = 2
Query:  518 ERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            ER   C FC  +F R D L  H +IH+GEKP  C  C + F RSD R  H R
Sbjct:  175 ERNFPCEFCPAKFSRRDELKRHEKIHSGEKPLSCPYCDKCFMRSDHRTTHIR 226          
BLAST of EGR-like protein 1 vs. Planmine SMEST
Match: SMESG000028801.1 (SMESG000028801.1)

HSP 1 Score: 117.087 bits (292), Expect = 6.329e-31
Identity = 51/79 (64.56%), Postives = 62/79 (78.48%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            + F C  C   F RRDELKRHE+IH+GE+PL+C +CDK FMRSDH +TH R HTGEKPY C++CS+ F RSDE+LRH R
Sbjct:  201 RNFPCEFCPAKFSRRDELKRHEKIHSGEKPLSCPYCDKCFMRSDHRTTHIRTHTGEKPYSCDICSKRFARSDEKLRHKR 279          

HSP 2 Score: 58.9214 bits (141), Expect = 6.093e-10
Identity = 30/75 (40.00%), Postives = 40/75 (53.33%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRC---NVCSRLFGRSD 652
            K  +C  C K F R D    H R HTGE+P +C+ C KRF RSD    H RIH  EK  +     +C +L  +++
Sbjct:  229 KPLSCPYCDKCFMRSDHRTTHIRTHTGEKPYSCDICSKRFARSDEKLRHKRIHLKEKSKKNITHEICLKLMSQAN 303          

HSP 3 Score: 55.8398 bits (133), Expect = 6.272e-9
Identity = 25/52 (48.08%), Postives = 29/52 (55.77%), Query Frame = 2
Query:  518 ERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            ER   C FC  +F R D L  H +IH+GEKP  C  C + F RSD R  H R
Sbjct:  200 ERNFPCEFCPAKFSRRDELKRHEKIHSGEKPLSCPYCDKCFMRSDHRTTHIR 251          
BLAST of EGR-like protein 1 vs. Planmine SMEST
Match: SMESG000042500.1 (SMESG000042500.1)

HSP 1 Score: 117.087 bits (292), Expect = 2.497e-30
Identity = 49/77 (63.64%), Postives = 61/77 (79.22%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRH 667
            K F C+TC   F RRDEL+RHE+IH+GE+PL+C +CDK F+RSDH  TH R HTGEKPY C++C + F RSDE+LRH
Sbjct:  266 KTFCCSTCDVKFTRRDELRRHEKIHSGEKPLSCPYCDKCFIRSDHRKTHIRTHTGEKPYACDICLKRFARSDEKLRH 342          

HSP 2 Score: 58.151 bits (139), Expect = 1.038e-9
Identity = 27/53 (50.94%), Postives = 31/53 (58.49%), Query Frame = 2
Query:  437 KQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIH 595
            K  +C  C K F R D  K H R HTGE+P AC+ C KRF RSD    HT+ H
Sbjct:  294 KPLSCPYCDKCFIRSDHRKTHIRTHTGEKPYACDICLKRFARSDEKLRHTKTH 346          

HSP 3 Score: 56.9954 bits (136), Expect = 3.312e-9
Identity = 25/64 (39.06%), Postives = 36/64 (56.25%), Query Frame = 2
Query:  482 DELKRHERIHTGERPLACNFCDKRFMRSDHLSTHTRIHTGEKPYRCNVCSRLFGRSDERLRHFR 673
            D+  + +++   E+   C+ CD +F R D L  H +IH+GEKP  C  C + F RSD R  H R
Sbjct:  253 DKPVKTKKVVQTEKTFCCSTCDVKFTRRDELRRHEKIHSGEKPLSCPYCDKCFIRSDHRKTHIR 316          
The following BLAST results are available for this feature:
BLAST of EGR-like protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EGR41.659e-2458.23early growth response 4 [Source:HGNC Symbol;Acc:HG... [more]
EGR43.436e-2457.50early growth response 4 [Source:HGNC Symbol;Acc:HG... [more]
EGR14.172e-2459.15early growth response 1 [Source:HGNC Symbol;Acc:HG... [more]
EGR31.625e-2258.33early growth response 3 [Source:HGNC Symbol;Acc:HG... [more]
EGR32.067e-2258.33early growth response 3 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of EGR-like protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egrh-26.576e-2652.87EGR (Early Growth factor Response factor) Homolog ... [more]
egrh-21.032e-2541.33EGR (Early Growth factor Response factor) Homolog ... [more]
egrh-21.256e-2541.33EGR (Early Growth factor Response factor) Homolog ... [more]
egrh-21.284e-2552.87EGR (Early Growth factor Response factor) Homolog ... [more]
egrh-13.287e-2450.56EGR (Early Growth factor Response factor) Homolog ... [more]
back to top
BLAST of EGR-like protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sr5.031e-2458.57gene:FBgn0003499 transcript:FBtr0083542[more]
sr5.088e-2458.57gene:FBgn0003499 transcript:FBtr0330050[more]
sr1.116e-2349.43gene:FBgn0003499 transcript:FBtr0301615[more]
sr1.428e-2358.57gene:FBgn0003499 transcript:FBtr0344633[more]
sr1.428e-2358.57gene:FBgn0003499 transcript:FBtr0083543[more]
back to top
BLAST of EGR-like protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egr41.249e-2555.06early growth response 4 [Source:ZFIN;Acc:ZDB-GENE-... [more]
egr11.488e-2458.90early growth response 1 [Source:NCBI gene;Acc:3049... [more]
egr11.488e-2458.90early growth response 1 [Source:NCBI gene;Acc:3049... [more]
egr2a1.060e-2260.00early growth response 2a [Source:ZFIN;Acc:ZDB-GENE... [more]
egr2a1.060e-2260.00early growth response 2a [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of EGR-like protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egr12.173e-2457.53early growth response 1 [Source:NCBI gene;Acc:1000... [more]
egr12.318e-2457.53early growth response 1 [Source:NCBI gene;Acc:1000... [more]
usp312.416e-2356.96ubiquitin specific peptidase 31 [Source:Xenbase;Ac... [more]
serpinb41.448e-2258.33serpin peptidase inhibitor, clade B (ovalbumin), m... [more]
tbl1x4.052e-2260.00transducin beta like 1 X-linked [Source:Xenbase;Ac... [more]
back to top
BLAST of EGR-like protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Egr41.921e-2557.50early growth response 4 [Source:MGI Symbol;Acc:MGI... [more]
Egr13.151e-2459.15early growth response 1 [Source:MGI Symbol;Acc:MGI... [more]
Egr13.151e-2459.15early growth response 1 [Source:MGI Symbol;Acc:MGI... [more]
Egr31.030e-2258.33early growth response 3 [Source:MGI Symbol;Acc:MGI... [more]
Egr31.270e-2258.33early growth response 3 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of EGR-like protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9WUF2|EGR4_MOUSE1.344e-2457.50Early growth response protein 4 OS=Mus musculus OX... [more]
sp|O73693|EGR1_TAEGU2.447e-2460.00Early growth response protein 1 (Fragment) OS=Taen... [more]
sp|Q00911|EGR4_RAT3.364e-2456.25Early growth response protein 4 OS=Rattus norvegic... [more]
sp|O73692|EGR1_COTJA3.369e-2460.00Early growth response protein 1 (Fragment) OS=Cotu... [more]
sp|O73691|EGR1_CHICK7.519e-2460.00Early growth response protein 1 (Fragment) OS=Gall... [more]
back to top
BLAST of EGR-like protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G1CSV51.100e-12795.16EGR-like protein 1 OS=Schmidtea mediterranea OX=79... [more]
I1ZI708.239e-10677.66Early growth response-3 OS=Schmidtea mediterranea ... [more]
T1DF988.355e-7760.96Egrl-3 (Fragment) OS=Dendrocoelum lacteum OX=27895... [more]
T1E1161.287e-6554.05Egrl-1 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
I1ZI721.828e-2764.56Early growth response-4 OS=Schmidtea mediterranea ... [more]
back to top
BLAST of EGR-like protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egr45.072e-2659.04early growth response protein 1-B [Source:NCBI gen... [more]
egr47.994e-2659.04early growth response protein 1-B [Source:NCBI gen... [more]
egr12.714e-2458.90early growth response 1 [Source:NCBI gene;Acc:1030... [more]
EGR26.806e-2356.94early growth response protein 2b-like [Source:NCBI... [more]
egr31.394e-2258.33early growth response 3 [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of EGR-like protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egr41.192e-2452.87early growth response 4 [Source:ZFIN;Acc:ZDB-GENE-... [more]
ENSPMAT00000006002.11.092e-2151.95pep scaffold:Pmarinus_7.0:GL479218:16696:34135:-1 ... [more]
ENSPMAT00000000923.13.800e-2145.57pep scaffold:Pmarinus_7.0:GL480775:18221:19434:-1 ... [more]
ENSPMAT00000007569.15.569e-2036.76pep scaffold:Pmarinus_7.0:GL477836:135382:139743:-... [more]
ENSPMAT00000007831.11.360e-1943.59pep scaffold:Pmarinus_7.0:GL477655:47469:47963:1 g... [more]
back to top
BLAST of EGR-like protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ZAP16.727e-1738.82Zinc-regulated transcription factor; binds to zinc... [more]
AZF11.987e-1639.24Zinc-finger transcription factor; involved in diau... [more]
CRZ11.114e-1340.70Transcription factor, activates transcription of s... [more]
MSN22.110e-1349.21Stress-responsive transcriptional activator; activ... [more]
MIG17.662e-1346.48Transcription factor involved in glucose repressio... [more]
back to top
BLAST of EGR-like protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO491125.656e-2457.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO491162.741e-1948.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO297025.715e-1945.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431776.589e-1944.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431071.418e-1850.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of EGR-like protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egr12.870e-2458.90early growth response 1 [Source:NCBI gene;Acc:1002... [more]
ENSORLT00000000940.22.317e-2354.67early growth response protein 1 [Source:NCBI gene;... [more]
ENSORLT00000034291.16.476e-2340.16early growth response protein 2b [Source:NCBI gene... [more]
egr31.475e-2258.33early growth response 3 [Source:NCBI gene;Acc:1002... [more]
egr2b2.784e-2260.00early growth response 2 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of EGR-like protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000000960.13.059e-13195.16SMESG000000960.1[more]
SMESG000000959.13.887e-11078.17SMESG000000959.1[more]
SMESG000028801.13.366e-3164.56SMESG000028801.1[more]
SMESG000028801.16.329e-3164.56SMESG000028801.1[more]
SMESG000042500.12.497e-3063.64SMESG000042500.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30022030
GenBankAEI69697.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022030 ID=SMED30022030|Name=EGR-like protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=734bp
CTTTCTTTATTTGTAGATCGCATATGATTGGTTTTCAAAGCTATGACGTT
TTGTTCTATTTATAGTAACACAGATTTGATATTTATATAAGCAATTTAGT
ATTTGTTACATTTAAATTTCGATCAAAATGGTTAAAAATATTCAGAAGTT
AACTCTACCAGTGAAAATCGACAAATTAGAATTTAACGAAATCCAAACAG
GATATACTCCGTTGCCAGGAATTCATGAGTCGTTCTATCTCGATAATACA
GAAAATTGGAGTAATTTAAAAACACCATCTCCAATGGATTGCAATAATTT
GGAATTCGTTTTCATTTATGAATCTGAAGACGATTCCAATCATTTCTCAA
CCAAATTAAATCCGAACACCAAAAAATCTCTTCGTATTATTTCGAGTCCT
CTGTCAGAAATTAGCGAGAAAAGTCAATTTCGAATAAAACAATTTACTTG
TAACACATGCAAAAAGTCATTTTATCGTCGGGATGAATTGAAAAGACATG
AAAGAATTCACACTGGTGAACGTCCGTTAGCGTGCAATTTTTGCGATAAA
AGATTTATGCGATCAGATCACTTATCAACTCACACAAGAATCCACACCGG
TGAGAAACCATATCGGTGCAATGTATGTTCTCGCCTTTTTGGCAGATCAG
ACGAAAGGTTGCGACATTTCAGACAAAATCATCTGTGAAAATATTTTTTT
TTGTATTTTGGAGATTTCTTCGCATATTTTACGA
back to top

protein sequence of SMED30022030-orf-1

>SMED30022030-orf-1 ID=SMED30022030-orf-1|Name=SMED30022030-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=187bp
MVKNIQKLTLPVKIDKLEFNEIQTGYTPLPGIHESFYLDNTENWSNLKTP
SPMDCNNLEFVFIYESEDDSNHFSTKLNPNTKKSLRIISSPLSEISEKSQ
FRIKQFTCNTCKKSFYRRDELKRHERIHTGERPLACNFCDKRFMRSDHLS
THTRIHTGEKPYRCNVCSRLFGRSDERLRHFRQNHL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000028Category 2 cell
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR015880Znf_C2H2-like
IPR007087Znf_C2H2
IPR013087Znf_C2H2_type
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0003676nucleic acid binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCDDcd17276RMtype1_S_Sau1132ORF3780P-TRD1-CR1_likecoord: 18..67
e-value: 0.00565797
score: 32.5567