host cell factor-1

Overview
Namehost cell factor-1 (AFJ24752.1)
Smed IDSMED30022027
Length (bp)3391
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of host cell factor-1 (SMED30022027) t-SNE clustered cells

Violin plots show distribution of expression levels for host cell factor-1 (SMED30022027) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of host cell factor-1 (SMED30022027) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for host cell factor-1 (SMED30022027) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022027

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30022027SMESG000068250.1 SmedASXL_015073SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30022027SMESG000068250.1 SmedASXL_015073SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30022027SMESG000068250.1 dd_Smed_v4_6196_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30022027SMESG000068250.1 KC262343smed_ncbi_20200123PMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30022027SMESG000068250.1 KC262343smed_ncbi_20200123PMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30022027SMESG000068250.1 KC262343smed_ncbi_20200123PMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30022027SMESG000068250.1 KC262343smed_ncbi_20200123PMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of host cell factor-1 vs. Ensembl Human
Match: HCFC1 (host cell factor C1 [Source:HGNC Symbol;Acc:HGNC:4839])

HSP 1 Score: 561.222 bits (1445), Expect = 2.215e-173
Identity = 239/392 (60.97%), Postives = 306/392 (78.06%), Query Frame = 2
Query:  128 INPKWVKVIAATGNSPRARHGHKAVALKELIIIFGGGNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNR-NSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLWYLETSLPPSPSKIQLERAHDESLELTCNPVPTADYYMLQIRIYHI 1300
            + P+W +V+  +G  PR RHGH+AVA+KELI++FGGGNEGIVDELH YNT TNQWF+P++RG+IPPGCAA+G V D TRLL+FGGM+EYGKYS DLYEL ASRWEWK+L+ K P+ G  PC R+GHS +L+GNK YLFGGLANDSED K NIPRYLNDLY+L+++   G + W+ P   G +P PRESH+AV Y       D  + KL++YGGM   R GD++ L++DT++W KP++ G  P PRSLHSAT +GNKMY+FGGWVPLV+DD +  + EKEWKCTN++  L+L+T++W+ +  D  E  +PR RAGH AVA++TR+YIWSGRDGYRKAWNNQVC KDLWYLET  PP P+++QL RA+  SLE++   V TAD Y+LQ++ Y I
Sbjct:   15 LQPRWKRVVGWSGPVPRPRHGHRAVAIKELIVVFGGGNEGIVDELHVYNTATNQWFIPAVRGDIPPGCAAYGFVCDGTRLLVFGGMVEYGKYSNDLYELQASRWEWKRLKAKTPKNGPPPCPRLGHSFSLVGNKCYLFGGLANDSEDPKNNIPRYLNDLYILELRPGSGVVAWDIPITYGVLPPPRESHTAVVY----TEKDNKKSKLVIYGGMSGCRLGDLWTLDIDTLTWNKPSLSGVAPLPRSLHSATTIGNKMYVFGGWVPLVMDDVKVATHEKEWKCTNTLACLNLDTMAWETILMDTLEDNIPRARAGHCAVAINTRLYIWSGRDGYRKAWNNQVCCKDLWYLETEKPPPPARVQLVRANTNSLEVSWGAVATADSYLLQLQKYDI 402          

HSP 2 Score: 185.652 bits (470), Expect = 9.324e-47
Identity = 97/195 (49.74%), Postives = 126/195 (64.62%), Query Frame = 2
Query: 2474 WYDALITTQPKFTVTSYF-----AIPNTTGMPNLSLINETESEGLRVNLTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAIKVVKVRNGAQLSWEPPH-NCHNISEYSIYLAVKNNNPSSGQQNKGFT-----FIRVYCGQEPKAIVTASFLTQAHLDNSSKPAVIFRIAARNELGYGPATQVRWL 3025
            W+D  +       VT YF     A+P+   +  +   N+ + + L+    PGTAYK RVA IN CGRGP+SE  AFKT LPGFPGAP AIK+ K  +GA L+WEPP      I EYS+YLA++++   +G + K  T     F+RVYCG  P  +V +S L+ AH+D ++KPA+IFRIAARNE GYGPATQVRWL
Sbjct: 1812 WFDVGVIKGTNVMVTHYFLPPDDAVPSDDDLGTVPDYNQLKKQELQ----PGTAYKFRVAGINACGRGPFSEISAFKTCLPGFPGAPCAIKISKSPDGAHLTWEPPSVTSGKIIEYSVYLAIQSSQ--AGGELKSSTPAQLAFMRVYCGPSPSCLVQSSSLSNAHIDYTTKPAIIFRIAARNEKGYGPATQVRWL 2000          
BLAST of host cell factor-1 vs. Ensembl Human
Match: HCFC1 (host cell factor C1 [Source:HGNC Symbol;Acc:HGNC:4839])

HSP 1 Score: 561.992 bits (1447), Expect = 2.434e-173
Identity = 239/392 (60.97%), Postives = 306/392 (78.06%), Query Frame = 2
Query:  128 INPKWVKVIAATGNSPRARHGHKAVALKELIIIFGGGNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNR-NSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLWYLETSLPPSPSKIQLERAHDESLELTCNPVPTADYYMLQIRIYHI 1300
            + P+W +V+  +G  PR RHGH+AVA+KELI++FGGGNEGIVDELH YNT TNQWF+P++RG+IPPGCAA+G V D TRLL+FGGM+EYGKYS DLYEL ASRWEWK+L+ K P+ G  PC R+GHS +L+GNK YLFGGLANDSED K NIPRYLNDLY+L+++   G + W+ P   G +P PRESH+AV Y       D  + KL++YGGM   R GD++ L++DT++W KP++ G  P PRSLHSAT +GNKMY+FGGWVPLV+DD +  + EKEWKCTN++  L+L+T++W+ +  D  E  +PR RAGH AVA++TR+YIWSGRDGYRKAWNNQVC KDLWYLET  PP P+++QL RA+  SLE++   V TAD Y+LQ++ Y I
Sbjct:   15 LQPRWKRVVGWSGPVPRPRHGHRAVAIKELIVVFGGGNEGIVDELHVYNTATNQWFIPAVRGDIPPGCAAYGFVCDGTRLLVFGGMVEYGKYSNDLYELQASRWEWKRLKAKTPKNGPPPCPRLGHSFSLVGNKCYLFGGLANDSEDPKNNIPRYLNDLYILELRPGSGVVAWDIPITYGVLPPPRESHTAVVY----TEKDNKKSKLVIYGGMSGCRLGDLWTLDIDTLTWNKPSLSGVAPLPRSLHSATTIGNKMYVFGGWVPLVMDDVKVATHEKEWKCTNTLACLNLDTMAWETILMDTLEDNIPRARAGHCAVAINTRLYIWSGRDGYRKAWNNQVCCKDLWYLETEKPPPPARVQLVRANTNSLEVSWGAVATADSYLLQLQKYDI 402          

HSP 2 Score: 185.652 bits (470), Expect = 1.030e-46
Identity = 97/195 (49.74%), Postives = 126/195 (64.62%), Query Frame = 2
Query: 2474 WYDALITTQPKFTVTSYF-----AIPNTTGMPNLSLINETESEGLRVNLTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAIKVVKVRNGAQLSWEPPH-NCHNISEYSIYLAVKNNNPSSGQQNKGFT-----FIRVYCGQEPKAIVTASFLTQAHLDNSSKPAVIFRIAARNELGYGPATQVRWL 3025
            W+D  +       VT YF     A+P+   +  +   N+ + + L+    PGTAYK RVA IN CGRGP+SE  AFKT LPGFPGAP AIK+ K  +GA L+WEPP      I EYS+YLA++++   +G + K  T     F+RVYCG  P  +V +S L+ AH+D ++KPA+IFRIAARNE GYGPATQVRWL
Sbjct: 1857 WFDVGVIKGTNVMVTHYFLPPDDAVPSDDDLGTVPDYNQLKKQELQ----PGTAYKFRVAGINACGRGPFSEISAFKTCLPGFPGAPCAIKISKSPDGAHLTWEPPSVTSGKIIEYSVYLAIQSSQ--AGGELKSSTPAQLAFMRVYCGPSPSCLVQSSSLSNAHIDYTTKPAIIFRIAARNEKGYGPATQVRWL 2045          
BLAST of host cell factor-1 vs. Ensembl Human
Match: HCFC2 (host cell factor C2 [Source:HGNC Symbol;Acc:HGNC:24972])

HSP 1 Score: 446.817 bits (1148), Expect = 2.219e-146
Identity = 215/386 (55.70%), Postives = 281/386 (72.80%), Query Frame = 2
Query:  140 WVKVIAATGNSPRARHGHKAVALKELIIIFGGGNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNS-QEKEWKCTNSVHRLDLETLSWDRVCEDADEAE---MPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLWYLETSLPPSPSKIQLERAHDESLELTCNPVPTADYYMLQI 1285
            W +V + TG  PRARHGH+AVA++EL+IIFGGGNEGI DELH YNT TNQWF+P++RG+IPPGCAA G V D TR+L+FGGM+EYG+YS +LYEL ASRW WKK++P PP  G  PC R+GHS +L GNK YLFGGLAN+SED+  N+PRYLND Y L+++   G + W  P  KG +P+PRESH+AV Y       D    K+ V+GGM   R  D++ L+++TMSW+KP   G +P PRSLH+A+++GNKMYIFGGWVP   ++   S  + EW+CT+S   L+L+T  W  +  D+ E +    PRPRAGH AVA+ TR+Y WSGRDGY+KA N+QVC KDLWYL+T  PP+PS++QL +A   S  +  + V T + Y+LQ+
Sbjct:    9 WRRVSSFTGPVPRARHGHRAVAIRELMIIFGGGNEGIADELHVYNTATNQWFLPAVRGDIPPGCAAHGFVCDGTRILVFGGMVEYGRYSNELYELQASRWLWKKVKPHPPPSGLPPCPRLGHSFSLYGNKCYLFGGLANESEDSNNNVPRYLNDFYELELQHGSGVVGWSIPVTKGVVPSPRESHTAVIY----CKKDSGSPKMYVFGGMCGARLDDLWQLDLETMSWSKPETKGTVPLPRSLHTASVIGNKMYIFGGWVPHKGENTETSPHDCEWRCTSSFSYLNLDTTEWTTLVSDSQEDKKNSRPRPRAGHCAVAIGTRLYFWSGRDGYKKALNSQVCCKDLWYLDTEKPPAPSQVQLIKATTNSFHVKWDEVSTVEGYLLQL 390          
BLAST of host cell factor-1 vs. Ensembl Human
Match: HCFC2 (host cell factor C2 [Source:HGNC Symbol;Acc:HGNC:24972])

HSP 1 Score: 456.447 bits (1173), Expect = 7.142e-145
Identity = 215/386 (55.70%), Postives = 281/386 (72.80%), Query Frame = 2
Query:  140 WVKVIAATGNSPRARHGHKAVALKELIIIFGGGNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNS-QEKEWKCTNSVHRLDLETLSWDRVCEDADEAEM---PRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLWYLETSLPPSPSKIQLERAHDESLELTCNPVPTADYYMLQI 1285
            W +V + TG  PRARHGH+AVA++EL+IIFGGGNEGI DELH YNT TNQWF+P++RG+IPPGCAA G V D TR+L+FGGM+EYG+YS +LYEL ASRW WKK++P PP  G  PC R+GHS +L GNK YLFGGLAN+SED+  N+PRYLND Y L+++   G + W  P  KG +P+PRESH+AV Y       D    K+ V+GGM   R  D++ L+++TMSW+KP   G +P PRSLH+A+++GNKMYIFGGWVP   ++   S  + EW+CT+S   L+L+T  W  +  D+ E +    PRPRAGH AVA+ TR+Y WSGRDGY+KA N+QVC KDLWYL+T  PP+PS++QL +A   S  +  + V T + Y+LQ+
Sbjct:    9 WRRVSSFTGPVPRARHGHRAVAIRELMIIFGGGNEGIADELHVYNTATNQWFLPAVRGDIPPGCAAHGFVCDGTRILVFGGMVEYGRYSNELYELQASRWLWKKVKPHPPPSGLPPCPRLGHSFSLYGNKCYLFGGLANESEDSNNNVPRYLNDFYELELQHGSGVVGWSIPVTKGVVPSPRESHTAVIY----CKKDSGSPKMYVFGGMCGARLDDLWQLDLETMSWSKPETKGTVPLPRSLHTASVIGNKMYIFGGWVPHKGENTETSPHDCEWRCTSSFSYLNLDTTEWTTLVSDSQEDKKNSRPRPRAGHCAVAIGTRLYFWSGRDGYKKALNSQVCCKDLWYLDTEKPPAPSQVQLIKATTNSFHVKWDEVSTVEGYLLQL 390          

HSP 2 Score: 164.851 bits (416), Expect = 5.073e-41
Identity = 89/201 (44.28%), Postives = 119/201 (59.20%), Query Frame = 2
Query: 2465 EVVWYDALITTQPKFTVTSYFAIPN---------TTGMPNLSLINETESEGLRVNLTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAIKVVKVRNGAQLSWEPPHN-CHNISEYSIYLAVK----NNNPSSGQQNKGFTFIRVYCGQEPKAIVTASFLTQAHLDNSSKPAVIFRIAARNELGYGPATQVRWL 3025
            E  W D  I       V+ ++ +P             +P+ SL+ + +       L PGT Y+ RVAAIN CG GP+S+   FKT +PGFPGAPSA+++ K   G  LSWEPP +   NI EYS YLA++     +NPS         F+R+YCG +   IVTA  L  AH+D +S+PA++FRI+A+NE GYGPATQVRWL
Sbjct:  595 ERQWCDVGIFKNNTALVSQFYLLPKGKQSISKVGNADVPDYSLLKKQD-------LVPGTGYRFRVAAINGCGIGPFSKISEFKTCIPGFPGAPSAVRISKNVEGIHLSWEPPTSPSGNILEYSAYLAIRTAQIQDNPSQ------LVFMRIYCGLKTSCIVTAGQLANAHIDYTSRPAIVFRISAKNEKGYGPATQVRWL 782          
BLAST of host cell factor-1 vs. Ensembl Human
Match: HCFC1 (host cell factor C1 [Source:HGNC Symbol;Acc:HGNC:4839])

HSP 1 Score: 189.504 bits (480), Expect = 5.997e-50
Identity = 97/195 (49.74%), Postives = 126/195 (64.62%), Query Frame = 2
Query: 2474 WYDALITTQPKFTVTSYF-----AIPNTTGMPNLSLINETESEGLRVNLTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAIKVVKVRNGAQLSWEPPH-NCHNISEYSIYLAVKNNNPSSGQQNKGFT-----FIRVYCGQEPKAIVTASFLTQAHLDNSSKPAVIFRIAARNELGYGPATQVRWL 3025
            W+D  +       VT YF     A+P+   +  +   N+ + + L+    PGTAYK RVA IN CGRGP+SE  AFKT LPGFPGAP AIK+ K  +GA L+WEPP      I EYS+YLA++++   +G + K  T     F+RVYCG  P  +V +S L+ AH+D ++KPA+IFRIAARNE GYGPATQVRWL
Sbjct:  388 WFDVGVIKGTNVMVTHYFLPPDDAVPSDDDLGTVPDYNQLKKQELQ----PGTAYKFRVAGINACGRGPFSEISAFKTCLPGFPGAPCAIKISKSPDGAHLTWEPPSVTSGKIIEYSVYLAIQSSQ--AGGELKSSTPAQLAFMRVYCGPSPSCLVQSSSLSNAHIDYTTKPAIIFRIAARNEKGYGPATQVRWL 576          
BLAST of host cell factor-1 vs. Ensembl Celegans
Match: hcf-1 (HCF1 related; Host cell factor 1 [Source:UniProtKB/TrEMBL;Acc:G5EC23])

HSP 1 Score: 387.111 bits (993), Expect = 3.099e-119
Identity = 191/393 (48.60%), Postives = 257/393 (65.39%), Query Frame = 2
Query:  137 KWVKVIAATGNSPRARHGHKAVALKELIIIFGGGNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTL--IGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIG----GEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQ-EKEWKCTNSVHRLDLETLSW---DRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLWYLETSLPPSPSKIQLERAHDESLELTCNPVPTADYYMLQI 1285
            +W  V  +TG +P+ RHGH+AV LKELI+IFGGGNEG++DELHAYNT   +W  P   G++P   AAFG ++   ++  FGGM EYGKY+ DLYEL ++RWEW++L P+    G LPC RIGHS  +     K Y+FGGL+ND  D K N+P YL+DLYV+++   Q  ++WE  +  G  P  RESH+AV Y+        +  +++VYGGM+  R GD++ LN++T+ WT+        G  P PRSLHS+ L+G+KM+++GGWVPL+   +   Q EKEWKCT+S+   ++    W      C D D   +PR RAGH A AV  R+YIWSGRDGYRKAW+NQVC +D+W L+T LP  P K+QL RA   SLE++   V  A  Y LQI
Sbjct:   29 RWRIVQQSTGPNPKPRHGHRAVVLKELIVIFGGGNEGMIDELHAYNTQKREWTAPQCCGDVPTPAAAFGAISLGNKIYRFGGMTEYGKYTNDLYELQSTRWEWRRLNPRVHSNGHLPCPRIGHSFVVSQKSQKAYVFGGLSNDLNDPKRNVPHYLDDLYVINLSGPQ-HLIWEKLNATGPGPISRESHTAVIYE------KDSISRMVVYGGMNGVRLGDLWYLNLNTLHWTEIKFDDPRTGIPPMPRSLHSSVLIGDKMFVYGGWVPLLEHASTEQQTEKEWKCTSSLGCWNITEDRWVPLHLYCSDED--TIPRGRAGHCAAAVGDRMYIWSGRDGYRKAWSNQVCCRDMWLLDTILPEQPGKVQLGRAGFNSLEISWPIVQGASGYFLQI 412          

HSP 2 Score: 161.77 bits (408), Expect = 1.511e-40
Identity = 88/201 (43.78%), Postives = 121/201 (60.20%), Query Frame = 2
Query: 2462 DEVVWYDALITTQPKFTVTSYFAIPNTTGMPNLS-LINETESEGL---------RVNLTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAIKVVKVRNGAQLSWEPPHNCH---NISEYSIYLAVKNNNPSSGQQNKGFTFIRVYCGQEPKAIVTASFLTQAHLDNSSKPAVIFRIAARNELGYGPATQVRWL 3025
            D++ W+D  I  +    VT YF     +    L+ LI+    + +         ++ L  G +Y+ RV+AIN  G+G WSE  + KT +PG+P APS+I++ K   GAQL+WEPP N +    I EYS+YLAVKN + +S   +    F+RVYCG +    V  S L  A +D ++KPA+IFRIAARNE GYGPATQVRWL
Sbjct:  549 DDLPWFDVGIIDKATINVTHYFNDRQQSLEKQLNDLIDHNAFKCVNDSVFTTEDKIPLINGQSYRFRVSAINGLGKGAWSETASCKTCVPGYPSAPSSIRITKSHEGAQLTWEPPSNTNISGKIIEYSVYLAVKNQSANSA--DSQLAFMRVYCGPQADCQVLQSNLGTAFVDQTNKPAIIFRIAARNEKGYGPATQVRWL 747          
BLAST of host cell factor-1 vs. Ensembl Celegans
Match: F53E4.1 (pep chromosome:WBcel235:V:15652438:15659079:-1 gene:WBGene00009978.1 transcript:F53E4.1b.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F53E4.1)

HSP 1 Score: 89.3521 bits (220), Expect = 2.586e-18
Identity = 71/261 (27.20%), Postives = 115/261 (44.06%), Query Frame = 2
Query:  164 GNSPRARHGHKAVALKELIIIFGGGNE--GIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYG-KYSGDLYELHASRWEWKKLRPK--PPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETP--SMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPL 925
            G  P  R+GH  V  +    ++GG N+  G  + LH Y+   N W    + G +PP       V  N ++ +FGG  E   ++S + Y    +   W+++  K  PPR       R  H+ ++I   MY+FGG +++S        +Y + L  L++     T   + P  +MK   P  R SHS   Y       D   +    Y G     Y ++Y  +  T  W+  ++ G  P  R  H + +   K+Y+FGG +PL
Sbjct:   87 GAVPYQRYGHTVVEYQGKAYVWGGRNDDYGACNLLHEYDPEYNVWKKVEIEGFVPPSRDGHTAVVWNNQMFVFGGYEEDAQRFSQETYVFDFATSTWREMHTKNDPPR------WRDFHTASVIDGMMYIFGGRSDESGQFHTIHDQYDDTLMALNLATGAWTRT-KVPENTMK---PGGRRSHSTWVY-------DGKMYMFGGYLGTINVHYNELYCFDPKTSMWSVISVRGTYPSARRRHCSVVSNGKVYLFGGTMPL 330          

HSP 2 Score: 64.6994 bits (156), Expect = 1.791e-10
Identity = 63/226 (27.88%), Postives = 98/226 (43.36%), Query Frame = 2
Query:  494 RIGHSLTLIGNKMYLFGG-LANDSEDAK-------FNIPRY----LNDLYVLD----IKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYIL---NVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGR 1114
            R+ H+   +G+++Y FGG  + +  DAK        N   Y    +N  YV +     KA   +   ++  M G++P  R  H+ V YQ           K  V+GG +   YG   +L   + +   W K  I G +P  R  H+A +  N+M++FGG+     D  R SQE         +  D  T +W  +    D    PR R  H+A  +   +YI+ GR
Sbjct:   14 RVNHASIAVGSRIYSFGGYCSGEVTDAKDPLDVHVLNTENYRWIKMNPGYVYNNRIITKATIESPYSDSDKMFGAVPYQRYGHTVVEYQ----------GKAYVWGGRND-DYGACNLLHEYDPEYNVWKKVEIEGFVPPSRDGHTAVVWNNQMFVFGGYEE---DAQRFSQE--------TYVFDFATSTWREMHTKNDP---PRWRDFHTASVIDGMMYIFGGR 214          

HSP 3 Score: 60.8474 bits (146), Expect = 3.159e-9
Identity = 53/199 (26.63%), Postives = 81/199 (40.70%), Query Frame = 2
Query:  146 KVIAATGNSPRARHGHKAVALKELIIIFGGGNEG---IVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVAD-NTRLLMFGGMLE--------YGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVA 706
            K +   G  P +R GH AV     + +FGG  E       E + ++  T+ W     + + PP    F   +  +  + +FGG  +        + +Y   L  L+ +   W   R K P     P  R  HS  +   KMY+FGG           I  + N+LY  D K    T MW   S++G+ P+ R  H +V 
Sbjct:  132 KKVEIEGFVPPSRDGHTAVVWNNQMFVFGGYEEDAQRFSQETYVFDFATSTWREMHTKND-PPRWRDFHTASVIDGMMYIFGGRSDESGQFHTIHDQYDDTLMALNLATGAWT--RTKVPENTMKPGGRRSHSTWVYDGKMYMFGGYLG-------TINVHYNELYCFDPK----TSMWSVISVRGTYPSARRRHCSVV 316          
BLAST of host cell factor-1 vs. Ensembl Celegans
Match: F53E4.1 (pep chromosome:WBcel235:V:15652438:15659067:-1 gene:WBGene00009978.1 transcript:F53E4.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F53E4.1)

HSP 1 Score: 89.3521 bits (220), Expect = 2.586e-18
Identity = 71/261 (27.20%), Postives = 115/261 (44.06%), Query Frame = 2
Query:  164 GNSPRARHGHKAVALKELIIIFGGGNE--GIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYG-KYSGDLYELHASRWEWKKLRPK--PPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETP--SMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPL 925
            G  P  R+GH  V  +    ++GG N+  G  + LH Y+   N W    + G +PP       V  N ++ +FGG  E   ++S + Y    +   W+++  K  PPR       R  H+ ++I   MY+FGG +++S        +Y + L  L++     T   + P  +MK   P  R SHS   Y       D   +    Y G     Y ++Y  +  T  W+  ++ G  P  R  H + +   K+Y+FGG +PL
Sbjct:   87 GAVPYQRYGHTVVEYQGKAYVWGGRNDDYGACNLLHEYDPEYNVWKKVEIEGFVPPSRDGHTAVVWNNQMFVFGGYEEDAQRFSQETYVFDFATSTWREMHTKNDPPR------WRDFHTASVIDGMMYIFGGRSDESGQFHTIHDQYDDTLMALNLATGAWTRT-KVPENTMK---PGGRRSHSTWVY-------DGKMYMFGGYLGTINVHYNELYCFDPKTSMWSVISVRGTYPSARRRHCSVVSNGKVYLFGGTMPL 330          

HSP 2 Score: 64.6994 bits (156), Expect = 1.791e-10
Identity = 63/226 (27.88%), Postives = 98/226 (43.36%), Query Frame = 2
Query:  494 RIGHSLTLIGNKMYLFGG-LANDSEDAK-------FNIPRY----LNDLYVLD----IKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYIL---NVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGR 1114
            R+ H+   +G+++Y FGG  + +  DAK        N   Y    +N  YV +     KA   +   ++  M G++P  R  H+ V YQ           K  V+GG +   YG   +L   + +   W K  I G +P  R  H+A +  N+M++FGG+     D  R SQE         +  D  T +W  +    D    PR R  H+A  +   +YI+ GR
Sbjct:   14 RVNHASIAVGSRIYSFGGYCSGEVTDAKDPLDVHVLNTENYRWIKMNPGYVYNNRIITKATIESPYSDSDKMFGAVPYQRYGHTVVEYQ----------GKAYVWGGRND-DYGACNLLHEYDPEYNVWKKVEIEGFVPPSRDGHTAVVWNNQMFVFGGYEE---DAQRFSQE--------TYVFDFATSTWREMHTKNDP---PRWRDFHTASVIDGMMYIFGGR 214          

HSP 3 Score: 60.8474 bits (146), Expect = 3.159e-9
Identity = 53/199 (26.63%), Postives = 81/199 (40.70%), Query Frame = 2
Query:  146 KVIAATGNSPRARHGHKAVALKELIIIFGGGNEG---IVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVAD-NTRLLMFGGMLE--------YGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVA 706
            K +   G  P +R GH AV     + +FGG  E       E + ++  T+ W     + + PP    F   +  +  + +FGG  +        + +Y   L  L+ +   W   R K P     P  R  HS  +   KMY+FGG           I  + N+LY  D K    T MW   S++G+ P+ R  H +V 
Sbjct:  132 KKVEIEGFVPPSRDGHTAVVWNNQMFVFGGYEEDAQRFSQETYVFDFATSTWREMHTKND-PPRWRDFHTASVIDGMMYIFGGRSDESGQFHTIHDQYDDTLMALNLATGAWT--RTKVPENTMKPGGRRSHSTWVYDGKMYMFGGYLG-------TINVHYNELYCFDPK----TSMWSVISVRGTYPSARRRHCSVV 316          
BLAST of host cell factor-1 vs. Ensembl Celegans
Match: F53E4.1 (pep chromosome:WBcel235:V:15652438:15668300:-1 gene:WBGene00009978.1 transcript:F53E4.1d.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F53E4.1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.631e-17
Identity = 68/263 (25.86%), Postives = 112/263 (42.59%), Query Frame = 2
Query:  164 GNSPRARHGHKAVALKELIIIFGGGNE--GIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYG-KYSGDLYELHASRWEWKKLRPK--PPRGGSLPCARIGHSLTLIGNKMYLFGGLANDS----EDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPL 925
            G  P  R+GH  V  +    ++GG N+  G  + LH Y+   N W    + G +PP       V  N ++ +FGG  E   ++S + Y    +   W+++  K  PPR       R  H+ ++I   MY+FGG +++S    ++  F+      D  ++ +  A G             P  R SHS   Y       D   +    Y G     Y ++Y  +  T  W+  ++ G  P  R  H + +   K+Y+FGG +PL
Sbjct:   93 GAVPYQRYGHTVVEYQGKAYVWGGRNDDYGACNLLHEYDPEYNVWKKVEIEGFVPPSRDGHTAVVWNNQMFVFGGYEEDAQRFSQETYVFDFATSTWREMHTKNDPPR------WRDFHTASVIDGMMYIFGGRSDESGQVGDEHLFHTIHDQYDDTLMALNLATGAWTRTKVPENTMKPGGRRSHSTWVY-------DGKMYMFGGYLGTINVHYNELYCFDPKTSMWSVISVRGTYPSARRRHCSVVSNGKVYLFGGTMPL 342          

HSP 2 Score: 64.6994 bits (156), Expect = 1.922e-10
Identity = 63/226 (27.88%), Postives = 98/226 (43.36%), Query Frame = 2
Query:  494 RIGHSLTLIGNKMYLFGG-LANDSEDAK-------FNIPRY----LNDLYVLD----IKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNV---DTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGR 1114
            R+ H+   +G+++Y FGG  + +  DAK        N   Y    +N  YV +     KA   +   ++  M G++P  R  H+ V YQ           K  V+GG +   YG   +L+    +   W K  I G +P  R  H+A +  N+M++FGG+     D  R SQE         +  D  T +W  +    D    PR R  H+A  +   +YI+ GR
Sbjct:   20 RVNHASIAVGSRIYSFGGYCSGEVTDAKDPLDVHVLNTENYRWIKMNPGYVYNNRIITKATIESPYSDSDKMFGAVPYQRYGHTVVEYQ----------GKAYVWGGRND-DYGACNLLHEYDPEYNVWKKVEIEGFVPPSRDGHTAVVWNNQMFVFGGYEE---DAQRFSQE--------TYVFDFATSTWREMHTKNDP---PRWRDFHTASVIDGMMYIFGGR 220          

HSP 3 Score: 59.6918 bits (143), Expect = 8.330e-9
Identity = 52/203 (25.62%), Postives = 79/203 (38.92%), Query Frame = 2
Query:  146 KVIAATGNSPRARHGHKAVALKELIIIFGGGNEG---IVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVAD-NTRLLMFGGMLEYGKYSGDLYELHASRWEWKK------------LRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVA 706
            K +   G  P +R GH AV     + +FGG  E       E + ++  T+ W     + + PP    F   +  +  + +FGG  +     GD +  H    ++               R K P     P  R  HS  +   KMY+FGG           I  + N+LY  D K    T MW   S++G+ P+ R  H +V 
Sbjct:  138 KKVEIEGFVPPSRDGHTAVVWNNQMFVFGGYEEDAQRFSQETYVFDFATSTWREMHTKND-PPRWRDFHTASVIDGMMYIFGGRSDESGQVGDEHLFHTIHDQYDDTLMALNLATGAWTRTKVPENTMKPGGRRSHSTWVYDGKMYMFGGYLG-------TINVHYNELYCFDPK----TSMWSVISVRGTYPSARRRHCSVV 328          
BLAST of host cell factor-1 vs. Ensembl Celegans
Match: F53E4.1 (pep chromosome:WBcel235:V:15652438:15659079:-1 gene:WBGene00009978.1 transcript:F53E4.1a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F53E4.1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.781e-17
Identity = 68/263 (25.86%), Postives = 112/263 (42.59%), Query Frame = 2
Query:  164 GNSPRARHGHKAVALKELIIIFGGGNE--GIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYG-KYSGDLYELHASRWEWKKLRPK--PPRGGSLPCARIGHSLTLIGNKMYLFGGLANDS----EDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPL 925
            G  P  R+GH  V  +    ++GG N+  G  + LH Y+   N W    + G +PP       V  N ++ +FGG  E   ++S + Y    +   W+++  K  PPR       R  H+ ++I   MY+FGG +++S    ++  F+      D  ++ +  A G             P  R SHS   Y       D   +    Y G     Y ++Y  +  T  W+  ++ G  P  R  H + +   K+Y+FGG +PL
Sbjct:   87 GAVPYQRYGHTVVEYQGKAYVWGGRNDDYGACNLLHEYDPEYNVWKKVEIEGFVPPSRDGHTAVVWNNQMFVFGGYEEDAQRFSQETYVFDFATSTWREMHTKNDPPR------WRDFHTASVIDGMMYIFGGRSDESGQVGDEHLFHTIHDQYDDTLMALNLATGAWTRTKVPENTMKPGGRRSHSTWVY-------DGKMYMFGGYLGTINVHYNELYCFDPKTSMWSVISVRGTYPSARRRHCSVVSNGKVYLFGGTMPL 336          

HSP 2 Score: 64.6994 bits (156), Expect = 1.965e-10
Identity = 63/226 (27.88%), Postives = 98/226 (43.36%), Query Frame = 2
Query:  494 RIGHSLTLIGNKMYLFGG-LANDSEDAK-------FNIPRY----LNDLYVLD----IKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNV---DTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGR 1114
            R+ H+   +G+++Y FGG  + +  DAK        N   Y    +N  YV +     KA   +   ++  M G++P  R  H+ V YQ           K  V+GG +   YG   +L+    +   W K  I G +P  R  H+A +  N+M++FGG+     D  R SQE         +  D  T +W  +    D    PR R  H+A  +   +YI+ GR
Sbjct:   14 RVNHASIAVGSRIYSFGGYCSGEVTDAKDPLDVHVLNTENYRWIKMNPGYVYNNRIITKATIESPYSDSDKMFGAVPYQRYGHTVVEYQ----------GKAYVWGGRND-DYGACNLLHEYDPEYNVWKKVEIEGFVPPSRDGHTAVVWNNQMFVFGGYEE---DAQRFSQE--------TYVFDFATSTWREMHTKNDP---PRWRDFHTASVIDGMMYIFGGR 214          

HSP 3 Score: 59.3066 bits (142), Expect = 9.169e-9
Identity = 52/203 (25.62%), Postives = 79/203 (38.92%), Query Frame = 2
Query:  146 KVIAATGNSPRARHGHKAVALKELIIIFGGGNEG---IVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVAD-NTRLLMFGGMLEYGKYSGDLYELHASRWEWKK------------LRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVA 706
            K +   G  P +R GH AV     + +FGG  E       E + ++  T+ W     + + PP    F   +  +  + +FGG  +     GD +  H    ++               R K P     P  R  HS  +   KMY+FGG           I  + N+LY  D K    T MW   S++G+ P+ R  H +V 
Sbjct:  132 KKVEIEGFVPPSRDGHTAVVWNNQMFVFGGYEEDAQRFSQETYVFDFATSTWREMHTKND-PPRWRDFHTASVIDGMMYIFGGRSDESGQVGDEHLFHTIHDQYDDTLMALNLATGAWTRTKVPENTMKPGGRRSHSTWVYDGKMYMFGGYLG-------TINVHYNELYCFDPK----TSMWSVISVRGTYPSARRRHCSVV 322          
BLAST of host cell factor-1 vs. Ensembl Fly
Match: Hcf (gene:FBgn0039904 transcript:FBtr0089125)

HSP 1 Score: 497.278 bits (1279), Expect = 1.445e-153
Identity = 212/395 (53.67%), Postives = 286/395 (72.41%), Query Frame = 2
Query:  137 KWVKVIAATGNSPRARHGHKAVALKELIIIFGGGNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQG-TMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLWYLETSLPPSPSKIQLERAHDESLELTCNPVPTADYYMLQIRIYHIPQSNST 1318
            +W +V+  TG  PR RHGH+A+ +KEL+++FGGGNEGIVDELH YNT+TNQW+VP L+G++P GCAA+G V + TR+ +FGGM+EYGKYS +LYEL A++WEW+K+ P+ P  G  PC R+GHS T++G K++LFGGLAN+S+D K NIP+YLNDLY+LD +        W  P   G  P PRESH+ +++             LL+YGGM   R GD+++L  D+M+W+KP   GE P PRSLHS+T++GNKMY+FGGWVPLV++D++++ E+EWKCTN++  LDLET++W+ V  D  E  +PR RAGH AV + +R+Y+WSGRDGYRKAWNNQVC KDLWYLE S P    K+ L RA   +LEL+      A  Y+LQI+    P + S+
Sbjct:   59 RWKRVLNPTGPQPRPRHGHRAINIKELMVVFGGGNEGIVDELHVYNTVTNQWYVPVLKGDVPNGCAAYGFVVEGTRMFVFGGMIEYGKYSNELYELQATKWEWRKMYPESPDSGLSPCPRLGHSFTMVGEKIFLFGGLANESDDPKNNIPKYLNDLYILDTRGVHSHNGKWIVPKTYGDSPPPRESHTGISF----ATKSNGNLNLLIYGGMSGCRLGDLWLLETDSMTWSKPKTSGEAPLPRSLHSSTMIGNKMYVFGGWVPLVINDSKSTTEREWKCTNTLAVLDLETMTWENVTLDTVEENVPRARAGHCAVGIQSRLYVWSGRDGYRKAWNNQVCCKDLWYLEVSKPLYAVKVALVRASTHALELSWTATTFAAAYVLQIQKIEQPLNTSS 449          

HSP 2 Score: 172.94 bits (437), Expect = 2.932e-43
Identity = 84/147 (57.14%), Postives = 100/147 (68.03%), Query Frame = 2
Query: 2594 RVNLTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAIKVVK-VRNGAQLSWEPP--HNCHNISEYSIYLAVKNNNPSSGQQNKGFTFIRVYCGQEPKAIVTASFLTQAHLDNSSKPAVIFRIAARNELGYGPATQVRWL 3025
            R NL PGTAY+ R++AIN CGRG W E  +FKT LPGFPGAPSAIK+ K V+ GA L+WEPP       I EYS+YLAVK              F+RVY G   +  V  + L+ AH+D S+KPA+IFRIAARN+ GYGPATQVRWL
Sbjct: 1306 RTNLEPGTAYRFRLSAINSCGRGEWGEISSFKTCLPGFPGAPSAIKISKDVKEGAHLTWEPPPAQKTKEIIEYSVYLAVKPTAKDKALSTPQLAFVRVYVGAANQCTVPNASLSNAHVDCSNKPAIIFRIAARNQKGYGPATQVRWL 1452          
BLAST of host cell factor-1 vs. Ensembl Fly
Match: Hcf (gene:FBgn0039904 transcript:FBtr0089126)

HSP 1 Score: 497.278 bits (1279), Expect = 1.445e-153
Identity = 212/395 (53.67%), Postives = 286/395 (72.41%), Query Frame = 2
Query:  137 KWVKVIAATGNSPRARHGHKAVALKELIIIFGGGNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQG-TMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLWYLETSLPPSPSKIQLERAHDESLELTCNPVPTADYYMLQIRIYHIPQSNST 1318
            +W +V+  TG  PR RHGH+A+ +KEL+++FGGGNEGIVDELH YNT+TNQW+VP L+G++P GCAA+G V + TR+ +FGGM+EYGKYS +LYEL A++WEW+K+ P+ P  G  PC R+GHS T++G K++LFGGLAN+S+D K NIP+YLNDLY+LD +        W  P   G  P PRESH+ +++             LL+YGGM   R GD+++L  D+M+W+KP   GE P PRSLHS+T++GNKMY+FGGWVPLV++D++++ E+EWKCTN++  LDLET++W+ V  D  E  +PR RAGH AV + +R+Y+WSGRDGYRKAWNNQVC KDLWYLE S P    K+ L RA   +LEL+      A  Y+LQI+    P + S+
Sbjct:   59 RWKRVLNPTGPQPRPRHGHRAINIKELMVVFGGGNEGIVDELHVYNTVTNQWYVPVLKGDVPNGCAAYGFVVEGTRMFVFGGMIEYGKYSNELYELQATKWEWRKMYPESPDSGLSPCPRLGHSFTMVGEKIFLFGGLANESDDPKNNIPKYLNDLYILDTRGVHSHNGKWIVPKTYGDSPPPRESHTGISF----ATKSNGNLNLLIYGGMSGCRLGDLWLLETDSMTWSKPKTSGEAPLPRSLHSSTMIGNKMYVFGGWVPLVINDSKSTTEREWKCTNTLAVLDLETMTWENVTLDTVEENVPRARAGHCAVGIQSRLYVWSGRDGYRKAWNNQVCCKDLWYLEVSKPLYAVKVALVRASTHALELSWTATTFAAAYVLQIQKIEQPLNTSS 449          

HSP 2 Score: 172.94 bits (437), Expect = 2.932e-43
Identity = 84/147 (57.14%), Postives = 100/147 (68.03%), Query Frame = 2
Query: 2594 RVNLTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAIKVVK-VRNGAQLSWEPP--HNCHNISEYSIYLAVKNNNPSSGQQNKGFTFIRVYCGQEPKAIVTASFLTQAHLDNSSKPAVIFRIAARNELGYGPATQVRWL 3025
            R NL PGTAY+ R++AIN CGRG W E  +FKT LPGFPGAPSAIK+ K V+ GA L+WEPP       I EYS+YLAVK              F+RVY G   +  V  + L+ AH+D S+KPA+IFRIAARN+ GYGPATQVRWL
Sbjct: 1306 RTNLEPGTAYRFRLSAINSCGRGEWGEISSFKTCLPGFPGAPSAIKISKDVKEGAHLTWEPPPAQKTKEIIEYSVYLAVKPTAKDKALSTPQLAFVRVYVGAANQCTVPNASLSNAHVDCSNKPAIIFRIAARNQKGYGPATQVRWL 1452          
BLAST of host cell factor-1 vs. Ensembl Fly
Match: Hcf (gene:FBgn0039904 transcript:FBtr0345284)

HSP 1 Score: 497.278 bits (1279), Expect = 1.445e-153
Identity = 212/395 (53.67%), Postives = 286/395 (72.41%), Query Frame = 2
Query:  137 KWVKVIAATGNSPRARHGHKAVALKELIIIFGGGNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQG-TMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLWYLETSLPPSPSKIQLERAHDESLELTCNPVPTADYYMLQIRIYHIPQSNST 1318
            +W +V+  TG  PR RHGH+A+ +KEL+++FGGGNEGIVDELH YNT+TNQW+VP L+G++P GCAA+G V + TR+ +FGGM+EYGKYS +LYEL A++WEW+K+ P+ P  G  PC R+GHS T++G K++LFGGLAN+S+D K NIP+YLNDLY+LD +        W  P   G  P PRESH+ +++             LL+YGGM   R GD+++L  D+M+W+KP   GE P PRSLHS+T++GNKMY+FGGWVPLV++D++++ E+EWKCTN++  LDLET++W+ V  D  E  +PR RAGH AV + +R+Y+WSGRDGYRKAWNNQVC KDLWYLE S P    K+ L RA   +LEL+      A  Y+LQI+    P + S+
Sbjct:   59 RWKRVLNPTGPQPRPRHGHRAINIKELMVVFGGGNEGIVDELHVYNTVTNQWYVPVLKGDVPNGCAAYGFVVEGTRMFVFGGMIEYGKYSNELYELQATKWEWRKMYPESPDSGLSPCPRLGHSFTMVGEKIFLFGGLANESDDPKNNIPKYLNDLYILDTRGVHSHNGKWIVPKTYGDSPPPRESHTGISF----ATKSNGNLNLLIYGGMSGCRLGDLWLLETDSMTWSKPKTSGEAPLPRSLHSSTMIGNKMYVFGGWVPLVINDSKSTTEREWKCTNTLAVLDLETMTWENVTLDTVEENVPRARAGHCAVGIQSRLYVWSGRDGYRKAWNNQVCCKDLWYLEVSKPLYAVKVALVRASTHALELSWTATTFAAAYVLQIQKIEQPLNTSS 449          

HSP 2 Score: 172.94 bits (437), Expect = 2.932e-43
Identity = 84/147 (57.14%), Postives = 100/147 (68.03%), Query Frame = 2
Query: 2594 RVNLTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAIKVVK-VRNGAQLSWEPP--HNCHNISEYSIYLAVKNNNPSSGQQNKGFTFIRVYCGQEPKAIVTASFLTQAHLDNSSKPAVIFRIAARNELGYGPATQVRWL 3025
            R NL PGTAY+ R++AIN CGRG W E  +FKT LPGFPGAPSAIK+ K V+ GA L+WEPP       I EYS+YLAVK              F+RVY G   +  V  + L+ AH+D S+KPA+IFRIAARN+ GYGPATQVRWL
Sbjct: 1306 RTNLEPGTAYRFRLSAINSCGRGEWGEISSFKTCLPGFPGAPSAIKISKDVKEGAHLTWEPPPAQKTKEIIEYSVYLAVKPTAKDKALSTPQLAFVRVYVGAANQCTVPNASLSNAHVDCSNKPAIIFRIAARNQKGYGPATQVRWL 1452          
BLAST of host cell factor-1 vs. Ensembl Fly
Match: Hcf (gene:FBgn0039904 transcript:FBtr0307379)

HSP 1 Score: 492.271 bits (1266), Expect = 7.786e-152
Identity = 212/397 (53.40%), Postives = 286/397 (72.04%), Query Frame = 2
Query:  137 KWVKVIAATGNSPRARHGHKAVALKELIIIFGGGNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQG-TMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQ--VCFKDLWYLETSLPPSPSKIQLERAHDESLELTCNPVPTADYYMLQIRIYHIPQSNST 1318
            +W +V+  TG  PR RHGH+A+ +KEL+++FGGGNEGIVDELH YNT+TNQW+VP L+G++P GCAA+G V + TR+ +FGGM+EYGKYS +LYEL A++WEW+K+ P+ P  G  PC R+GHS T++G K++LFGGLAN+S+D K NIP+YLNDLY+LD +        W  P   G  P PRESH+ +++             LL+YGGM   R GD+++L  D+M+W+KP   GE P PRSLHS+T++GNKMY+FGGWVPLV++D++++ E+EWKCTN++  LDLET++W+ V  D  E  +PR RAGH AV + +R+Y+WSGRDGYRKAWNNQ  VC KDLWYLE S P    K+ L RA   +LEL+      A  Y+LQI+    P + S+
Sbjct:   59 RWKRVLNPTGPQPRPRHGHRAINIKELMVVFGGGNEGIVDELHVYNTVTNQWYVPVLKGDVPNGCAAYGFVVEGTRMFVFGGMIEYGKYSNELYELQATKWEWRKMYPESPDSGLSPCPRLGHSFTMVGEKIFLFGGLANESDDPKNNIPKYLNDLYILDTRGVHSHNGKWIVPKTYGDSPPPRESHTGISF----ATKSNGNLNLLIYGGMSGCRLGDLWLLETDSMTWSKPKTSGEAPLPRSLHSSTMIGNKMYVFGGWVPLVINDSKSTTEREWKCTNTLAVLDLETMTWENVTLDTVEENVPRARAGHCAVGIQSRLYVWSGRDGYRKAWNNQVRVCCKDLWYLEVSKPLYAVKVALVRASTHALELSWTATTFAAAYVLQIQKIEQPLNTSS 451          

HSP 2 Score: 173.326 bits (438), Expect = 2.754e-43
Identity = 84/147 (57.14%), Postives = 100/147 (68.03%), Query Frame = 2
Query: 2594 RVNLTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAIKVVK-VRNGAQLSWEPP--HNCHNISEYSIYLAVKNNNPSSGQQNKGFTFIRVYCGQEPKAIVTASFLTQAHLDNSSKPAVIFRIAARNELGYGPATQVRWL 3025
            R NL PGTAY+ R++AIN CGRG W E  +FKT LPGFPGAPSAIK+ K V+ GA L+WEPP       I EYS+YLAVK              F+RVY G   +  V  + L+ AH+D S+KPA+IFRIAARN+ GYGPATQVRWL
Sbjct: 1290 RTNLEPGTAYRFRLSAINSCGRGEWGEISSFKTCLPGFPGAPSAIKISKDVKEGAHLTWEPPPAQKTKEIIEYSVYLAVKPTAKDKALSTPQLAFVRVYVGAANQCTVPNASLSNAHVDCSNKPAIIFRIAARNQKGYGPATQVRWL 1436          
BLAST of host cell factor-1 vs. Ensembl Fly
Match: Hcf (gene:FBgn0039904 transcript:FBtr0334479)

HSP 1 Score: 450.284 bits (1157), Expect = 1.379e-136
Identity = 187/337 (55.49%), Postives = 254/337 (75.37%), Query Frame = 2
Query:  137 KWVKVIAATGNSPRARHGHKAVALKELIIIFGGGNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQG-TMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQ 1144
            +W +V+  TG  PR RHGH+A+ +KEL+++FGGGNEGIVDELH YNT+TNQW+VP L+G++P GCAA+G V + TR+ +FGGM+EYGKYS +LYEL A++WEW+K+ P+ P  G  PC R+GHS T++G K++LFGGLAN+S+D K NIP+YLNDLY+LD +        W  P   G  P PRESH+ +++             LL+YGGM   R GD+++L  D+M+W+KP   GE P PRSLHS+T++GNKMY+FGGWVPLV++D++++ E+EWKCTN++  LDLET++W+ V  D  E  +PR RAGH AV + +R+Y+WSGRDGYRKAWNNQ
Sbjct:   59 RWKRVLNPTGPQPRPRHGHRAINIKELMVVFGGGNEGIVDELHVYNTVTNQWYVPVLKGDVPNGCAAYGFVVEGTRMFVFGGMIEYGKYSNELYELQATKWEWRKMYPESPDSGLSPCPRLGHSFTMVGEKIFLFGGLANESDDPKNNIPKYLNDLYILDTRGVHSHNGKWIVPKTYGDSPPPRESHTGISF----ATKSNGNLNLLIYGGMSGCRLGDLWLLETDSMTWSKPKTSGEAPLPRSLHSSTMIGNKMYVFGGWVPLVINDSKSTTEREWKCTNTLAVLDLETMTWENVTLDTVEENVPRARAGHCAVGIQSRLYVWSGRDGYRKAWNNQ 391          

HSP 2 Score: 175.637 bits (444), Expect = 4.982e-44
Identity = 84/147 (57.14%), Postives = 100/147 (68.03%), Query Frame = 2
Query: 2594 RVNLTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAIKVVK-VRNGAQLSWEPP--HNCHNISEYSIYLAVKNNNPSSGQQNKGFTFIRVYCGQEPKAIVTASFLTQAHLDNSSKPAVIFRIAARNELGYGPATQVRWL 3025
            R NL PGTAY+ R++AIN CGRG W E  +FKT LPGFPGAPSAIK+ K V+ GA L+WEPP       I EYS+YLAVK              F+RVY G   +  V  + L+ AH+D S+KPA+IFRIAARN+ GYGPATQVRWL
Sbjct: 1254 RTNLEPGTAYRFRLSAINSCGRGEWGEISSFKTCLPGFPGAPSAIKISKDVKEGAHLTWEPPPAQKTKEIIEYSVYLAVKPTAKDKALSTPQLAFVRVYVGAANQCTVPNASLSNAHVDCSNKPAIIFRIAARNQKGYGPATQVRWL 1400          
BLAST of host cell factor-1 vs. Ensembl Zebrafish
Match: hcfc1b (host cell factor C1b [Source:ZFIN;Acc:ZDB-GENE-030131-2411])

HSP 1 Score: 553.132 bits (1424), Expect = 7.644e-171
Identity = 236/400 (59.00%), Postives = 308/400 (77.00%), Query Frame = 2
Query:  119 TDSINPKWVKVIAATGNSPRARHGHKAVALKELIIIFGGGNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNR-NSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLWYLETSLPPSPSKIQLERAHDESLELTCNPVPTADYYMLQIRIYHIPQSNS 1315
            T  + P+W +V+  +G  PR RHGH+AVA+KEL+++FGGGNEGIVDELH YNT TNQWF+P++RG+IPPGCAA+G V D TRLL+FGGM+EYGKYS DLYEL ASRWEWK+L+PK P+ G  PC R+GHS +L+GNK YLFGGLANDSED K NIPRYLNDLY L+++       W+ P   G +P PRESH+AV Y   ++ S ++  +L++YGGM   R GD++ L++DT++W KP I G  P PRSLHSAT + NKM++FGGWVPLV+DD +  + EKEWKCTN++  L+L+++SW+ +  D  E  +PR RAGH +VA++ R+Y+WSGRDGYRKAWNNQVC KDLWYLET  P  PS++QL RA+  SLE++   VPTAD Y+LQ++ Y IP + +
Sbjct:    6 TSVLQPRWKRVLGWSGPVPRPRHGHRAVAIKELMVVFGGGNEGIVDELHVYNTATNQWFIPAVRGDIPPGCAAYGFVCDGTRLLVFGGMVEYGKYSNDLYELQASRWEWKRLKPKAPKNGPPPCPRLGHSFSLVGNKCYLFGGLANDSEDPKNNIPRYLNDLYTLELRPGSNVAGWDIPITYGVLPPPRESHTAVVY--TEKTSKKS--RLIIYGGMSGCRLGDLWTLDIDTLTWNKPAISGAAPLPRSLHSATTITNKMFVFGGWVPLVMDDVKVATHEKEWKCTNTLACLNLDSMSWETILMDTLEDNIPRARAGHCSVAINNRLYVWSGRDGYRKAWNNQVCCKDLWYLETDRPQPPSRVQLVRANTNSLEVSWGAVPTADTYLLQLQKYDIPAATA 401          

HSP 2 Score: 182.185 bits (461), Expect = 7.374e-46
Identity = 93/194 (47.94%), Postives = 123/194 (63.40%), Query Frame = 2
Query: 2474 WYDALITTQPKFTVTSYFAIPNTTGMPNLSLINETESEGL-------RVNLTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAIKVVKVRNGAQLSWEPPH-NCHNISEYSIYLAVKNNNPSSGQQN--KGFTFIRVYCGQEPKAIVTASFLTQAHLDNSSKPAVIFRIAARNELGYGPATQVRWL 3025
            W+D  I       VT Y+ +P      + S + + +S  +       ++ L+PGTAYK RVA IN CGRG +SE  AFKT LPGFPGAP AIK+ K  +GA L+WEPP      I EYS+YLA++++     + +      F+RVYCG  P  +V +S L+ AH+D ++KPA+IFRIAARNE GYGPATQVRWL
Sbjct: 1771 WFDVGIVKVTNMVVTHYY-VPA-----DDSAVTDDDSGAIPDYSRMKKIELSPGTAYKFRVAGINACGRGTFSEVSAFKTCLPGFPGAPCAIKISKSPDGAHLTWEPPSVTSGKIIEYSVYLAIQSSQTVEAKASAPAQLAFMRVYCGPNPSCLVQSSSLSNAHIDYTTKPAIIFRIAARNEKGYGPATQVRWL 1958          
BLAST of host cell factor-1 vs. Ensembl Zebrafish
Match: hcfc1a (host cell factor C1a [Source:ZFIN;Acc:ZDB-GENE-030912-10])

HSP 1 Score: 545.814 bits (1405), Expect = 1.695e-169
Identity = 239/393 (60.81%), Postives = 302/393 (76.84%), Query Frame = 2
Query:  128 INPKWVKVIAATGNSPRARHGHKAVALKELIIIFGGGNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAY-QLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNR-NSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLWYLETSLPPSPSKIQLERAHDESLELTCNPVPTADYYMLQIRIYHI 1300
            + P+W +V+  +G  PR RHGH+AVA+KEL+++FGGGNEGIVDELH YNT TNQWF+P++RG+IPPGCAA+G V D TRLL+FGGM+EYGKYS DLYEL ASRWEWKKL+PK P+ G  PC R+GHS +L+GNK YLFGGLANDSED K NIPRYLNDLY L+++       W+ P   G +P PRESH+AV Y + + + S     +L++YGGM   R GD++ L++DT++W KP I G  P PRSLHSAT + NKMY+FGGWVPLV+DD +  + EKEWKCTN++  L+L+TL+W+ V  D  E  +PR RAGH AVA++ R+YIWSGRDGYRKAWNNQVC KDLWYLET  P  PS++QL RA+  SLE++   V TAD Y+LQ++ Y I
Sbjct:   14 LQPRWKRVLGWSGPVPRPRHGHRAVAIKELMVVFGGGNEGIVDELHVYNTATNQWFIPAVRGDIPPGCAAYGFVCDGTRLLVFGGMVEYGKYSNDLYELQASRWEWKKLKPKAPKNGVPPCPRLGHSFSLVGNKCYLFGGLANDSEDPKNNIPRYLNDLYTLELRPGSSVAGWDVPVTYGVLPPPRESHTAVIYTEKVTKKS-----RLVIYGGMSGCRLGDLWTLDIDTLTWNKPAISGAAPLPRSLHSATTITNKMYVFGGWVPLVMDDVKVATHEKEWKCTNTLACLNLDTLAWETVLMDTLEDNIPRARAGHCAVAINNRLYIWSGRDGYRKAWNNQVCCKDLWYLETERPNPPSRVQLVRANTNSLEVSWGAVSTADTYLLQLQKYDI 401          

HSP 2 Score: 184.111 bits (466), Expect = 1.650e-46
Identity = 99/192 (51.56%), Postives = 127/192 (66.15%), Query Frame = 2
Query: 2474 WYDALITTQPKFTVTSYFAIP--NTTGMPNLSLINETESEGLRVNLTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAIKVVKVRNGAQLSWEPPH-NCHNISEYSIYLAVKNN-----NPSSGQQNKGFTFIRVYCGQEPKAIVTASFLTQAHLDNSSKPAVIFRIAARNELGYGPATQVRWL 3025
            W+D  I  +   TV ++F +P  ++  + N S      S+  RV L PGTAYK RVA IN CGRG +SE  AFKT LPGFPGAP AIK+ K  +GA L+WEPP      I+EYS+YLA++++      PS+  Q     F+RVYCG  P  +V +S L+ AH+D ++KPA+IFRIAARNE GYGPATQVRWL
Sbjct: 1554 WFDVGIV-KVTNTVVTHFYMPADDSAYVENDSGTAPDYSQMKRVELQPGTAYKFRVAGINTCGRGTFSEISAFKTCLPGFPGAPCAIKISKSPDGAHLTWEPPSVTSGKITEYSVYLAIQSSQTTEAKPSAPAQ---LAFMRVYCGPNPSCLVQSSSLSNAHIDYTTKPAIIFRIAARNEKGYGPATQVRWL 1741          
BLAST of host cell factor-1 vs. Ensembl Zebrafish
Match: hcfc1a (host cell factor C1a [Source:ZFIN;Acc:ZDB-GENE-030912-10])

HSP 1 Score: 546.199 bits (1406), Expect = 2.427e-169
Identity = 239/393 (60.81%), Postives = 302/393 (76.84%), Query Frame = 2
Query:  128 INPKWVKVIAATGNSPRARHGHKAVALKELIIIFGGGNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAY-QLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNR-NSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLWYLETSLPPSPSKIQLERAHDESLELTCNPVPTADYYMLQIRIYHI 1300
            + P+W +V+  +G  PR RHGH+AVA+KEL+++FGGGNEGIVDELH YNT TNQWF+P++RG+IPPGCAA+G V D TRLL+FGGM+EYGKYS DLYEL ASRWEWKKL+PK P+ G  PC R+GHS +L+GNK YLFGGLANDSED K NIPRYLNDLY L+++       W+ P   G +P PRESH+AV Y + + + S     +L++YGGM   R GD++ L++DT++W KP I G  P PRSLHSAT + NKMY+FGGWVPLV+DD +  + EKEWKCTN++  L+L+TL+W+ V  D  E  +PR RAGH AVA++ R+YIWSGRDGYRKAWNNQVC KDLWYLET  P  PS++QL RA+  SLE++   V TAD Y+LQ++ Y I
Sbjct:   14 LQPRWKRVLGWSGPVPRPRHGHRAVAIKELMVVFGGGNEGIVDELHVYNTATNQWFIPAVRGDIPPGCAAYGFVCDGTRLLVFGGMVEYGKYSNDLYELQASRWEWKKLKPKAPKNGVPPCPRLGHSFSLVGNKCYLFGGLANDSEDPKNNIPRYLNDLYTLELRPGSSVAGWDVPVTYGVLPPPRESHTAVIYTEKVTKKS-----RLVIYGGMSGCRLGDLWTLDIDTLTWNKPAISGAAPLPRSLHSATTITNKMYVFGGWVPLVMDDVKVATHEKEWKCTNTLACLNLDTLAWETVLMDTLEDNIPRARAGHCAVAINNRLYIWSGRDGYRKAWNNQVCCKDLWYLETERPNPPSRVQLVRANTNSLEVSWGAVSTADTYLLQLQKYDI 401          

HSP 2 Score: 184.496 bits (467), Expect = 1.342e-46
Identity = 99/192 (51.56%), Postives = 127/192 (66.15%), Query Frame = 2
Query: 2474 WYDALITTQPKFTVTSYFAIP--NTTGMPNLSLINETESEGLRVNLTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAIKVVKVRNGAQLSWEPPH-NCHNISEYSIYLAVKNN-----NPSSGQQNKGFTFIRVYCGQEPKAIVTASFLTQAHLDNSSKPAVIFRIAARNELGYGPATQVRWL 3025
            W+D  I  +   TV ++F +P  ++  + N S      S+  RV L PGTAYK RVA IN CGRG +SE  AFKT LPGFPGAP AIK+ K  +GA L+WEPP      I+EYS+YLA++++      PS+  Q     F+RVYCG  P  +V +S L+ AH+D ++KPA+IFRIAARNE GYGPATQVRWL
Sbjct: 1580 WFDVGIV-KVTNTVVTHFYMPADDSAYVENDSGTAPDYSQMKRVELQPGTAYKFRVAGINTCGRGTFSEISAFKTCLPGFPGAPCAIKISKSPDGAHLTWEPPSVTSGKITEYSVYLAIQSSQTTEAKPSAPAQ---LAFMRVYCGPNPSCLVQSSSLSNAHIDYTTKPAIIFRIAARNEKGYGPATQVRWL 1767          
BLAST of host cell factor-1 vs. Ensembl Zebrafish
Match: hcfc2 (host cell factor C2 [Source:ZFIN;Acc:ZDB-GENE-050417-203])

HSP 1 Score: 428.713 bits (1101), Expect = 1.247e-135
Identity = 198/397 (49.87%), Postives = 275/397 (69.27%), Query Frame = 2
Query:  131 NPKWVKVIAATGNSPRARHGHKAVALKELIIIFGGGNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQEK-EWKCTNSVHRLDLETLSWDR----------VCEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLWYLETSLPPSPSKIQLERAHDESLELTCNPVPTADYYMLQIR 1288
             P W +V +  G  PRARHGH+AVA++EL+++FGGGNEGI  +LH YN++T QWF+P++RG+IPPGCAA G V + TR+L+FGGM+E+G+Y+  LYEL ASRW WKKL+P+PP+ GSLPC RIGHS TL  NK YLFGG+ANDSED   NIPRYL+D Y L+++A  G   W  P  KG  P+ RESHS+V Y     +S     +L ++GGM   R  D++ L+++TM+W+ P   G++P PRSLH++ ++GNK+Y+FGGWVP+  ++   + +  +W CTNS+  L+ +TL+W            V +D + A+ PR RAGH AV V +R+ IWSGRDGY+K  N QVC KDLWYLET  P +P  + L ++    L +   P+  A+ Y+LQ++
Sbjct:    5 GPLWKRVRSYAGPVPRARHGHRAVAIRELLVVFGGGNEGIATDLHVYNSVTKQWFLPAVRGDIPPGCAAHGFVCEGTRILVFGGMVEFGQYTNSLYELQASRWLWKKLKPRPPKNGSLPCPRIGHSFTLHANKCYLFGGMANDSEDPNGNIPRYLDDFYELELQAQSGVKGWNVPETKGGGPSARESHSSVVYCGKGGSSP----RLYIFGGMCGDRLNDLWQLDIETMTWSLPPTRGQLPLPRSLHTSNVIGNKLYVFGGWVPIGEEEEALAADGVKWICTNSLSMLNFDTLTWHNLTPEEHQQGLVEQDENNADWPRARAGHCAVTVGSRLCIWSGRDGYKKYNNYQVCCKDLWYLETERPATPGAVFLVKSTISMLHVAWRPLLAAECYLLQLQ 397          

HSP 2 Score: 142.895 bits (359), Expect = 2.110e-34
Identity = 70/143 (48.95%), Postives = 95/143 (66.43%), Query Frame = 2
Query: 2603 LTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAIKVVKVRNGAQLSWEPPHNCH-NISEYSIYLAVKNNNPSSGQQNKG-FTFIRVYCGQEPKAIVTASFLTQAHLDNSSKPAVIFRIAARNELGYGPATQVRWL 3025
            L  G  Y+ RVA +N CG G +S    FKT  PGFPGAPSA+K+ K  +   +SWEPP +    I EYS+YLAV+ +  +S  +  G   FIR+Y G +    VT + L+ AH+D S++PA++FRIAA+N+ GYGPATQ+RWL
Sbjct:  539 LDSGITYRFRVAGLNSCGLGDFSPISEFKTCQPGFPGAPSAVKITKGTDSVHISWEPPTSVSGKIMEYSMYLAVRKSRGNSLVERPGELAFIRIYRGTKTSCTVTEAQLSNAHIDCSARPAIVFRIAAKNDQGYGPATQIRWL 681          
BLAST of host cell factor-1 vs. Ensembl Zebrafish
Match: hcfc2 (host cell factor C2 [Source:ZFIN;Acc:ZDB-GENE-050417-203])

HSP 1 Score: 145.206 bits (365), Expect = 3.094e-38
Identity = 70/146 (47.95%), Postives = 96/146 (65.75%), Query Frame = 2
Query: 2594 RVNLTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAIKVVKVRNGAQLSWEPPHNCH-NISEYSIYLAVKNNNPSSGQQNKG-FTFIRVYCGQEPKAIVTASFLTQAHLDNSSKPAVIFRIAARNELGYGPATQVRWL 3025
            +  L  G  Y+ RVA +N CG G +S    FKT  PGFPGAPSA+K+ K  +   +SWEPP +    I EYS+YLAV+ +  +S  +  G   FIR+Y G +    VT + L+ AH+D S++PA++FRIAA+N+ GYGPATQ+RWL
Sbjct:  103 KQELDSGITYRFRVAGLNSCGLGDFSPISEFKTCQPGFPGAPSAVKITKGTDSVHISWEPPTSVSGKIMEYSMYLAVRKSRGNSLVERPGELAFIRIYRGTKTSCTVTEAQLSNAHIDCSARPAIVFRIAAKNDQGYGPATQIRWL 248          
BLAST of host cell factor-1 vs. Ensembl Xenopus
Match: HCFC1 (host cell factor C1 [Source:NCBI gene;Acc:100485535])

HSP 1 Score: 566.614 bits (1459), Expect = 1.054e-176
Identity = 241/394 (61.17%), Postives = 312/394 (79.19%), Query Frame = 2
Query:  125 SINPKWVKVIAATGNSPRARHGHKAVALKELIIIFGGGNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNR-NSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLWYLETSLPPSPSKIQLERAHDESLELTCNPVPTADYYMLQIRIYHIP 1303
            ++ P+W +V+  +G  PR RHGH+AVA+KELI++FGGGNEGIVDELH YNT TNQWF+P++RG+IPPGCAA+G V D TRLL+FGGM+EYGKYS DLYEL ASRWEWK+L+ K P+ G  PC R+GHS +L+GNK YLFGGLANDSED K NIPRYLNDLY+L+++   G + W+ P   G +P PRESH+AV Y     + D  + +L++YGGM   R GD++IL++DT++W+KP++ G  P PRSLHSAT + NKMY+FGGWVPLV+DD +  + EKEWKCTN++  L+LE++SW+ +  D  E  +PR RAGH AVA++TR+YIWSGRDGYRKAWNNQVC KDLWYLET  PP+P+++QL RA+  SLE++   VPTAD Y+LQ++ Y IP
Sbjct:   12 ALQPRWKRVVGWSGPVPRPRHGHRAVAIKELIVVFGGGNEGIVDELHVYNTSTNQWFIPAVRGDIPPGCAAYGFVCDGTRLLVFGGMVEYGKYSNDLYELQASRWEWKRLKAKAPKNGPPPCPRLGHSFSLVGNKCYLFGGLANDSEDPKNNIPRYLNDLYILELRPGSGVVAWDVPITYGILPPPRESHTAVVY----TDKDNKKSRLVIYGGMSGCRLGDLWILDIDTLTWSKPSLNGVAPLPRSLHSATTILNKMYVFGGWVPLVMDDVKVATHEKEWKCTNTLACLNLESMSWEHIVMDTLEDNIPRARAGHCAVAINTRLYIWSGRDGYRKAWNNQVCCKDLWYLETEKPPAPARVQLVRANTNSLEVSWGAVPTADSYLLQLQKYDIP 401          

HSP 2 Score: 183.341 bits (464), Expect = 4.141e-46
Identity = 96/197 (48.73%), Postives = 124/197 (62.94%), Query Frame = 2
Query: 2474 WYDALITTQPKFTVTSYFAIPNTTG---------MPNLSLINETESEGLRVNLTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAIKVVKVRNGAQLSWEPPH-NCHNISEYSIYLAVKNNNPSSGQQNKG---FTFIRVYCGQEPKAIVTASFLTQAHLDNSSKPAVIFRIAARNELGYGPATQVRWL 3025
            W+D  +       VT Y+   + +          +P+ S + + E       L PGTAYK RVA IN CGRGP+SE  AFKT LPGFPGAP AIK+ K  +GA L+WEPP      I EYS+YLA++++  +SG+Q        F+RVYCG  P  +V +S L+ AH+D ++KPA+IFRIAARNE GYGPATQVRWL
Sbjct: 1577 WFDVGVIKATNMMVTHYYLQADDSNNDVSDDSGVLPDYSQLKKQE-------LQPGTAYKFRVAGINACGRGPFSEISAFKTCLPGFPGAPCAIKISKSPDGAHLTWEPPSVTSGKIIEYSVYLAIQSSQ-TSGEQKSTPAQLAFMRVYCGPNPSCLVQSSSLSNAHIDYTTKPAIIFRIAARNEKGYGPATQVRWL 1765          
BLAST of host cell factor-1 vs. Ensembl Xenopus
Match: HCFC1 (host cell factor C1 [Source:NCBI gene;Acc:100485535])

HSP 1 Score: 567 bits (1460), Expect = 1.940e-176
Identity = 241/394 (61.17%), Postives = 312/394 (79.19%), Query Frame = 2
Query:  125 SINPKWVKVIAATGNSPRARHGHKAVALKELIIIFGGGNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNR-NSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLWYLETSLPPSPSKIQLERAHDESLELTCNPVPTADYYMLQIRIYHIP 1303
            ++ P+W +V+  +G  PR RHGH+AVA+KELI++FGGGNEGIVDELH YNT TNQWF+P++RG+IPPGCAA+G V D TRLL+FGGM+EYGKYS DLYEL ASRWEWK+L+ K P+ G  PC R+GHS +L+GNK YLFGGLANDSED K NIPRYLNDLY+L+++   G + W+ P   G +P PRESH+AV Y     + D  + +L++YGGM   R GD++IL++DT++W+KP++ G  P PRSLHSAT + NKMY+FGGWVPLV+DD +  + EKEWKCTN++  L+LE++SW+ +  D  E  +PR RAGH AVA++TR+YIWSGRDGYRKAWNNQVC KDLWYLET  PP+P+++QL RA+  SLE++   VPTAD Y+LQ++ Y IP
Sbjct:   12 ALQPRWKRVVGWSGPVPRPRHGHRAVAIKELIVVFGGGNEGIVDELHVYNTSTNQWFIPAVRGDIPPGCAAYGFVCDGTRLLVFGGMVEYGKYSNDLYELQASRWEWKRLKAKAPKNGPPPCPRLGHSFSLVGNKCYLFGGLANDSEDPKNNIPRYLNDLYILELRPGSGVVAWDVPITYGILPPPRESHTAVVY----TDKDNKKSRLVIYGGMSGCRLGDLWILDIDTLTWSKPSLNGVAPLPRSLHSATTILNKMYVFGGWVPLVMDDVKVATHEKEWKCTNTLACLNLESMSWEHIVMDTLEDNIPRARAGHCAVAINTRLYIWSGRDGYRKAWNNQVCCKDLWYLETEKPPAPARVQLVRANTNSLEVSWGAVPTADSYLLQLQKYDIP 401          

HSP 2 Score: 185.267 bits (469), Expect = 1.025e-46
Identity = 95/188 (50.53%), Postives = 123/188 (65.43%), Query Frame = 2
Query: 2474 WYDALITTQPKFTVTSYFAIPNTTGMPNLSLINETESEGLRVNLTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAIKVVKVRNGAQLSWEPPH-NCHNISEYSIYLAVKNNNPSSGQQNKG---FTFIRVYCGQEPKAIVTASFLTQAHLDNSSKPAVIFRIAARNELGYGPATQVRWL 3025
            W+D  +       VT Y+   + +   + S +    S+  +  L PGTAYK RVA IN CGRGP+SE  AFKT LPGFPGAP AIK+ K  +GA L+WEPP      I EYS+YLA++++  +SG+Q        F+RVYCG  P  +V +S L+ AH+D ++KPA+IFRIAARNE GYGPATQVRWL
Sbjct: 1665 WFDVGVIKATNMMVTHYYLQADDSNNDDDSGVLPDYSQLKKQELQPGTAYKFRVAGINACGRGPFSEISAFKTCLPGFPGAPCAIKISKSPDGAHLTWEPPSVTSGKIIEYSVYLAIQSSQ-TSGEQKSTPAQLAFMRVYCGPNPSCLVQSSSLSNAHIDYTTKPAIIFRIAARNEKGYGPATQVRWL 1851          
BLAST of host cell factor-1 vs. Ensembl Xenopus
Match: HCFC1 (host cell factor C1 [Source:NCBI gene;Acc:100485535])

HSP 1 Score: 566.614 bits (1459), Expect = 3.074e-176
Identity = 241/394 (61.17%), Postives = 312/394 (79.19%), Query Frame = 2
Query:  125 SINPKWVKVIAATGNSPRARHGHKAVALKELIIIFGGGNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNR-NSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLWYLETSLPPSPSKIQLERAHDESLELTCNPVPTADYYMLQIRIYHIP 1303
            ++ P+W +V+  +G  PR RHGH+AVA+KELI++FGGGNEGIVDELH YNT TNQWF+P++RG+IPPGCAA+G V D TRLL+FGGM+EYGKYS DLYEL ASRWEWK+L+ K P+ G  PC R+GHS +L+GNK YLFGGLANDSED K NIPRYLNDLY+L+++   G + W+ P   G +P PRESH+AV Y     + D  + +L++YGGM   R GD++IL++DT++W+KP++ G  P PRSLHSAT + NKMY+FGGWVPLV+DD +  + EKEWKCTN++  L+LE++SW+ +  D  E  +PR RAGH AVA++TR+YIWSGRDGYRKAWNNQVC KDLWYLET  PP+P+++QL RA+  SLE++   VPTAD Y+LQ++ Y IP
Sbjct:   12 ALQPRWKRVVGWSGPVPRPRHGHRAVAIKELIVVFGGGNEGIVDELHVYNTSTNQWFIPAVRGDIPPGCAAYGFVCDGTRLLVFGGMVEYGKYSNDLYELQASRWEWKRLKAKAPKNGPPPCPRLGHSFSLVGNKCYLFGGLANDSEDPKNNIPRYLNDLYILELRPGSGVVAWDVPITYGILPPPRESHTAVVY----TDKDNKKSRLVIYGGMSGCRLGDLWILDIDTLTWSKPSLNGVAPLPRSLHSATTILNKMYVFGGWVPLVMDDVKVATHEKEWKCTNTLACLNLESMSWEHIVMDTLEDNIPRARAGHCAVAINTRLYIWSGRDGYRKAWNNQVCCKDLWYLETEKPPAPARVQLVRANTNSLEVSWGAVPTADSYLLQLQKYDIP 401          

HSP 2 Score: 185.652 bits (470), Expect = 8.803e-47
Identity = 95/188 (50.53%), Postives = 123/188 (65.43%), Query Frame = 2
Query: 2474 WYDALITTQPKFTVTSYFAIPNTTGMPNLSLINETESEGLRVNLTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAIKVVKVRNGAQLSWEPPH-NCHNISEYSIYLAVKNNNPSSGQQNKG---FTFIRVYCGQEPKAIVTASFLTQAHLDNSSKPAVIFRIAARNELGYGPATQVRWL 3025
            W+D  +       VT Y+   + +   + S +    S+  +  L PGTAYK RVA IN CGRGP+SE  AFKT LPGFPGAP AIK+ K  +GA L+WEPP      I EYS+YLA++++  +SG+Q        F+RVYCG  P  +V +S L+ AH+D ++KPA+IFRIAARNE GYGPATQVRWL
Sbjct: 1660 WFDVGVIKATNMMVTHYYLQADDSNNDDDSGVLPDYSQLKKQELQPGTAYKFRVAGINACGRGPFSEISAFKTCLPGFPGAPCAIKISKSPDGAHLTWEPPSVTSGKIIEYSVYLAIQSSQ-TSGEQKSTPAQLAFMRVYCGPNPSCLVQSSSLSNAHIDYTTKPAIIFRIAARNEKGYGPATQVRWL 1846          
BLAST of host cell factor-1 vs. Ensembl Xenopus
Match: HCFC1 (host cell factor C1 [Source:NCBI gene;Acc:100485535])

HSP 1 Score: 566.614 bits (1459), Expect = 3.992e-176
Identity = 241/394 (61.17%), Postives = 312/394 (79.19%), Query Frame = 2
Query:  125 SINPKWVKVIAATGNSPRARHGHKAVALKELIIIFGGGNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNR-NSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLWYLETSLPPSPSKIQLERAHDESLELTCNPVPTADYYMLQIRIYHIP 1303
            ++ P+W +V+  +G  PR RHGH+AVA+KELI++FGGGNEGIVDELH YNT TNQWF+P++RG+IPPGCAA+G V D TRLL+FGGM+EYGKYS DLYEL ASRWEWK+L+ K P+ G  PC R+GHS +L+GNK YLFGGLANDSED K NIPRYLNDLY+L+++   G + W+ P   G +P PRESH+AV Y     + D  + +L++YGGM   R GD++IL++DT++W+KP++ G  P PRSLHSAT + NKMY+FGGWVPLV+DD +  + EKEWKCTN++  L+LE++SW+ +  D  E  +PR RAGH AVA++TR+YIWSGRDGYRKAWNNQVC KDLWYLET  PP+P+++QL RA+  SLE++   VPTAD Y+LQ++ Y IP
Sbjct:   12 ALQPRWKRVVGWSGPVPRPRHGHRAVAIKELIVVFGGGNEGIVDELHVYNTSTNQWFIPAVRGDIPPGCAAYGFVCDGTRLLVFGGMVEYGKYSNDLYELQASRWEWKRLKAKAPKNGPPPCPRLGHSFSLVGNKCYLFGGLANDSEDPKNNIPRYLNDLYILELRPGSGVVAWDVPITYGILPPPRESHTAVVY----TDKDNKKSRLVIYGGMSGCRLGDLWILDIDTLTWSKPSLNGVAPLPRSLHSATTILNKMYVFGGWVPLVMDDVKVATHEKEWKCTNTLACLNLESMSWEHIVMDTLEDNIPRARAGHCAVAINTRLYIWSGRDGYRKAWNNQVCCKDLWYLETEKPPAPARVQLVRANTNSLEVSWGAVPTADSYLLQLQKYDIP 401          

HSP 2 Score: 185.652 bits (470), Expect = 9.271e-47
Identity = 95/188 (50.53%), Postives = 123/188 (65.43%), Query Frame = 2
Query: 2474 WYDALITTQPKFTVTSYFAIPNTTGMPNLSLINETESEGLRVNLTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAIKVVKVRNGAQLSWEPPH-NCHNISEYSIYLAVKNNNPSSGQQNKG---FTFIRVYCGQEPKAIVTASFLTQAHLDNSSKPAVIFRIAARNELGYGPATQVRWL 3025
            W+D  +       VT Y+   + +   + S +    S+  +  L PGTAYK RVA IN CGRGP+SE  AFKT LPGFPGAP AIK+ K  +GA L+WEPP      I EYS+YLA++++  +SG+Q        F+RVYCG  P  +V +S L+ AH+D ++KPA+IFRIAARNE GYGPATQVRWL
Sbjct: 1683 WFDVGVIKATNMMVTHYYLQADDSNNDDDSGVLPDYSQLKKQELQPGTAYKFRVAGINACGRGPFSEISAFKTCLPGFPGAPCAIKISKSPDGAHLTWEPPSVTSGKIIEYSVYLAIQSSQ-TSGEQKSTPAQLAFMRVYCGPNPSCLVQSSSLSNAHIDYTTKPAIIFRIAARNEKGYGPATQVRWL 1869          
BLAST of host cell factor-1 vs. Ensembl Xenopus
Match: HCFC1 (host cell factor C1 [Source:NCBI gene;Acc:100485535])

HSP 1 Score: 567 bits (1460), Expect = 5.151e-176
Identity = 241/394 (61.17%), Postives = 312/394 (79.19%), Query Frame = 2
Query:  125 SINPKWVKVIAATGNSPRARHGHKAVALKELIIIFGGGNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNR-NSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLWYLETSLPPSPSKIQLERAHDESLELTCNPVPTADYYMLQIRIYHIP 1303
            ++ P+W +V+  +G  PR RHGH+AVA+KELI++FGGGNEGIVDELH YNT TNQWF+P++RG+IPPGCAA+G V D TRLL+FGGM+EYGKYS DLYEL ASRWEWK+L+ K P+ G  PC R+GHS +L+GNK YLFGGLANDSED K NIPRYLNDLY+L+++   G + W+ P   G +P PRESH+AV Y     + D  + +L++YGGM   R GD++IL++DT++W+KP++ G  P PRSLHSAT + NKMY+FGGWVPLV+DD +  + EKEWKCTN++  L+LE++SW+ +  D  E  +PR RAGH AVA++TR+YIWSGRDGYRKAWNNQVC KDLWYLET  PP+P+++QL RA+  SLE++   VPTAD Y+LQ++ Y IP
Sbjct:   12 ALQPRWKRVVGWSGPVPRPRHGHRAVAIKELIVVFGGGNEGIVDELHVYNTSTNQWFIPAVRGDIPPGCAAYGFVCDGTRLLVFGGMVEYGKYSNDLYELQASRWEWKRLKAKAPKNGPPPCPRLGHSFSLVGNKCYLFGGLANDSEDPKNNIPRYLNDLYILELRPGSGVVAWDVPITYGILPPPRESHTAVVY----TDKDNKKSRLVIYGGMSGCRLGDLWILDIDTLTWSKPSLNGVAPLPRSLHSATTILNKMYVFGGWVPLVMDDVKVATHEKEWKCTNTLACLNLESMSWEHIVMDTLEDNIPRARAGHCAVAINTRLYIWSGRDGYRKAWNNQVCCKDLWYLETEKPPAPARVQLVRANTNSLEVSWGAVPTADSYLLQLQKYDIP 401          

HSP 2 Score: 185.652 bits (470), Expect = 9.663e-47
Identity = 95/188 (50.53%), Postives = 123/188 (65.43%), Query Frame = 2
Query: 2474 WYDALITTQPKFTVTSYFAIPNTTGMPNLSLINETESEGLRVNLTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAIKVVKVRNGAQLSWEPPH-NCHNISEYSIYLAVKNNNPSSGQQNKG---FTFIRVYCGQEPKAIVTASFLTQAHLDNSSKPAVIFRIAARNELGYGPATQVRWL 3025
            W+D  +       VT Y+   + +   + S +    S+  +  L PGTAYK RVA IN CGRGP+SE  AFKT LPGFPGAP AIK+ K  +GA L+WEPP      I EYS+YLA++++  +SG+Q        F+RVYCG  P  +V +S L+ AH+D ++KPA+IFRIAARNE GYGPATQVRWL
Sbjct: 1726 WFDVGVIKATNMMVTHYYLQADDSNNDDDSGVLPDYSQLKKQELQPGTAYKFRVAGINACGRGPFSEISAFKTCLPGFPGAPCAIKISKSPDGAHLTWEPPSVTSGKIIEYSVYLAIQSSQ-TSGEQKSTPAQLAFMRVYCGPNPSCLVQSSSLSNAHIDYTTKPAIIFRIAARNEKGYGPATQVRWL 1912          
BLAST of host cell factor-1 vs. Ensembl Mouse
Match: Hcfc1 (host cell factor C1 [Source:MGI Symbol;Acc:MGI:105942])

HSP 1 Score: 560.066 bits (1442), Expect = 8.132e-173
Identity = 238/392 (60.71%), Postives = 306/392 (78.06%), Query Frame = 2
Query:  128 INPKWVKVIAATGNSPRARHGHKAVALKELIIIFGGGNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNR-NSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLWYLETSLPPSPSKIQLERAHDESLELTCNPVPTADYYMLQIRIYHI 1300
            + P+W +V+  +G  PR RHGH+AVA+KELI++FGGGNEGIVDELH YNT TNQWF+P++RG+IPPGCAA+G V D TRLL+FGGM+EYGKYS DLYEL ASRWEWK+L+ K P+ G  PC R+GHS +L+GNK YLFGGLANDSED K NIPRYLNDLY+L+++   G + W+ P   G +P PRESH+AV Y       D  + KL++YGGM   R GD++ L+++T++W KP++ G  P PRSLHSAT +GNKMY+FGGWVPLV+DD +  + EKEWKCTN++  L+L+T++W+ +  D  E  +PR RAGH AVA++TR+YIWSGRDGYRKAWNNQVC KDLWYLET  PP P+++QL RA+  SLE++   V TAD Y+LQ++ Y I
Sbjct:   15 LQPRWKRVVGWSGPVPRPRHGHRAVAIKELIVVFGGGNEGIVDELHVYNTATNQWFIPAVRGDIPPGCAAYGFVCDGTRLLVFGGMVEYGKYSNDLYELQASRWEWKRLKAKTPKNGPPPCPRLGHSFSLVGNKCYLFGGLANDSEDPKNNIPRYLNDLYILELRPGSGVVAWDIPITYGVLPPPRESHTAVVY----TEKDNKKSKLVIYGGMSGCRLGDLWTLDIETLTWNKPSLSGVAPLPRSLHSATTIGNKMYVFGGWVPLVMDDVKVATHEKEWKCTNTLACLNLDTMAWETILMDTLEDNIPRARAGHCAVAINTRLYIWSGRDGYRKAWNNQVCCKDLWYLETEKPPPPARVQLVRANTNSLEVSWGAVATADSYLLQLQKYDI 402          

HSP 2 Score: 184.882 bits (468), Expect = 1.148e-46
Identity = 96/197 (48.73%), Postives = 124/197 (62.94%), Query Frame = 2
Query: 2474 WYDALITTQPKFTVTSYFAIPN--------TTGMPNLSLINETESEGLRVNLTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAIKVVKVRNGAQLSWEPPH-NCHNISEYSIYLAVKNNNPSSGQQNKG----FTFIRVYCGQEPKAIVTASFLTQAHLDNSSKPAVIFRIAARNELGYGPATQVRWL 3025
            W+D  +       VT YF  P+        +  +P+ + + + E       L PGTAYK RVA IN CGRGP+SE  AFKT LPGFPGAP AIK+ K  +GA L+WEPP      I EYS+YLA++++  +SG+          F+RVYCG  P  +V +S L+ AH+D ++KPA+IFRIAARNE GYGPATQVRWL
Sbjct: 1867 WFDVGVIKGTSVMVTHYFLPPDDAVQSDDDSGTVPDYNQLKKQE-------LQPGTAYKFRVAGINACGRGPFSEISAFKTCLPGFPGAPCAIKISKSPDGAHLTWEPPSVTSGKIIEYSVYLAIQSSQ-ASGEPKSSTPAQLAFMRVYCGPSPSCLVQSSSLSNAHIDYTTKPAIIFRIAARNEKGYGPATQVRWL 2055          
BLAST of host cell factor-1 vs. Ensembl Mouse
Match: Hcfc1 (host cell factor C1 [Source:MGI Symbol;Acc:MGI:105942])

HSP 1 Score: 559.296 bits (1440), Expect = 1.154e-172
Identity = 238/392 (60.71%), Postives = 306/392 (78.06%), Query Frame = 2
Query:  128 INPKWVKVIAATGNSPRARHGHKAVALKELIIIFGGGNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNR-NSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLWYLETSLPPSPSKIQLERAHDESLELTCNPVPTADYYMLQIRIYHI 1300
            + P+W +V+  +G  PR RHGH+AVA+KELI++FGGGNEGIVDELH YNT TNQWF+P++RG+IPPGCAA+G V D TRLL+FGGM+EYGKYS DLYEL ASRWEWK+L+ K P+ G  PC R+GHS +L+GNK YLFGGLANDSED K NIPRYLNDLY+L+++   G + W+ P   G +P PRESH+AV Y       D  + KL++YGGM   R GD++ L+++T++W KP++ G  P PRSLHSAT +GNKMY+FGGWVPLV+DD +  + EKEWKCTN++  L+L+T++W+ +  D  E  +PR RAGH AVA++TR+YIWSGRDGYRKAWNNQVC KDLWYLET  PP P+++QL RA+  SLE++   V TAD Y+LQ++ Y I
Sbjct:   15 LQPRWKRVVGWSGPVPRPRHGHRAVAIKELIVVFGGGNEGIVDELHVYNTATNQWFIPAVRGDIPPGCAAYGFVCDGTRLLVFGGMVEYGKYSNDLYELQASRWEWKRLKAKTPKNGPPPCPRLGHSFSLVGNKCYLFGGLANDSEDPKNNIPRYLNDLYILELRPGSGVVAWDIPITYGVLPPPRESHTAVVY----TEKDNKKSKLVIYGGMSGCRLGDLWTLDIETLTWNKPSLSGVAPLPRSLHSATTIGNKMYVFGGWVPLVMDDVKVATHEKEWKCTNTLACLNLDTMAWETILMDTLEDNIPRARAGHCAVAINTRLYIWSGRDGYRKAWNNQVCCKDLWYLETEKPPPPARVQLVRANTNSLEVSWGAVATADSYLLQLQKYDI 402          

HSP 2 Score: 184.496 bits (467), Expect = 1.596e-46
Identity = 96/197 (48.73%), Postives = 124/197 (62.94%), Query Frame = 2
Query: 2474 WYDALITTQPKFTVTSYFAIPN--------TTGMPNLSLINETESEGLRVNLTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAIKVVKVRNGAQLSWEPPH-NCHNISEYSIYLAVKNNNPSSGQQNKG----FTFIRVYCGQEPKAIVTASFLTQAHLDNSSKPAVIFRIAARNELGYGPATQVRWL 3025
            W+D  +       VT YF  P+        +  +P+ + + + E       L PGTAYK RVA IN CGRGP+SE  AFKT LPGFPGAP AIK+ K  +GA L+WEPP      I EYS+YLA++++  +SG+          F+RVYCG  P  +V +S L+ AH+D ++KPA+IFRIAARNE GYGPATQVRWL
Sbjct: 1822 WFDVGVIKGTSVMVTHYFLPPDDAVQSDDDSGTVPDYNQLKKQE-------LQPGTAYKFRVAGINACGRGPFSEISAFKTCLPGFPGAPCAIKISKSPDGAHLTWEPPSVTSGKIIEYSVYLAIQSSQ-ASGEPKSSTPAQLAFMRVYCGPSPSCLVQSSSLSNAHIDYTTKPAIIFRIAARNEKGYGPATQVRWL 2010          
BLAST of host cell factor-1 vs. Ensembl Mouse
Match: Hcfc2 (host cell factor C2 [Source:MGI Symbol;Acc:MGI:1915183])

HSP 1 Score: 458.759 bits (1179), Expect = 9.771e-147
Identity = 220/409 (53.79%), Postives = 294/409 (71.88%), Query Frame = 2
Query:  140 WVKVIAATGNSPRARHGHKAVALKELIIIFGGGNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNS-QEKEWKCTNSVHRLDLETLSWDRVCEDADEAE---MPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLWYLETSLPPSPSKIQLERAHDESLELTCNPVPTADYYMLQIRIYHIPQSNSTIQSQQSAAALSG 1354
            W +V + TG  PRARHGH+AVA++EL+IIFGGGNEGI DELH YNT+TNQWF+P++RG+IPPGCAA G V D TR+L+FGGM+EYG+YS +LYEL ASRW WKK++P+PP  G  PC R+GHS +L GNK YLFGGLAN+SED+  N+PRYLND Y L+++   G + W  P+ KG +P+PRESH+A+ Y       D    K+ V+GGM   R  D++ L+++TMSW+KP   G +P PRSLH+A+++GNKMYIFGGWVP   ++   S  + EW+CT+S   L+L+T  W  +  D+ E +    PRPRAGH AVA+ TR+Y WSGRDGY+KA N+QVC KDLWYL+T  PP+PS++QL +A   S  +  + VPT + Y+LQ+      Q+ S+  S  + + L G
Sbjct:    9 WRRVSSFTGPVPRARHGHRAVAIRELMIIFGGGNEGIADELHVYNTVTNQWFLPAVRGDIPPGCAAHGFVCDGTRILVFGGMVEYGRYSNELYELQASRWLWKKVKPQPPPSGFPPCPRLGHSFSLYGNKCYLFGGLANESEDSNNNVPRYLNDFYELELQHGSGVVGWSIPATKGVVPSPRESHTAIIY----CKKDSASPKMYVFGGMCGARLDDLWQLDLETMSWSKPETKGTVPLPRSLHTASVIGNKMYIFGGWVPHKGENPETSPHDCEWRCTSSFSYLNLDTAEWTTLVSDSQEDKKNSRPRPRAGHCAVAIGTRLYFWSGRDGYKKALNSQVCCKDLWYLDTEKPPAPSQVQLIKATTNSFHVKWDEVPTVEGYLLQLNTDLTYQATSS-DSSAAPSVLGG 412          

HSP 2 Score: 159.844 bits (403), Expect = 7.773e-40
Identity = 87/198 (43.94%), Postives = 115/198 (58.08%), Query Frame = 2
Query: 2474 WYDALITTQPKFTVTSYFAIPN---------TTGMPNLSLINETESEGLRVNLTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAIKVVKVRNGAQLSWEPPHN-CHNISEYSIYLAVKN----NNPSSGQQNKGFTFIRVYCGQEPKAIVTASFLTQAHLDNSSKPAVIFRIAARNELGYGPATQVRWL 3025
            W D  I       V+ ++ +P             +P+ SL+ + +       L PGT YK RVAAIN CG GP S+   FKT  PGFPGAPS +++ K  +G  LSWEPP +   NI EYS YLA++     +NPS         F+R+YCG +    VTA  L  AH+D +S+PA++FRI+A+NE GYGPATQVRWL
Sbjct:  527 WCDVGIFKNNTALVSQFYLLPKGKQSMSKVGNADVPDYSLLKKQD-------LVPGTVYKFRVAAINGCGIGPLSKVSEFKTCTPGFPGAPSTVRISKNVDGIHLSWEPPTSPSGNILEYSAYLAIRTAQMQDNPSQ------LVFMRIYCGLKTSCTVTAGQLANAHIDYTSRPAIVFRISAKNEKGYGPATQVRWL 711          
BLAST of host cell factor-1 vs. Ensembl Mouse
Match: Hcfc2 (host cell factor C2 [Source:MGI Symbol;Acc:MGI:1915183])

HSP 1 Score: 206.068 bits (523), Expect = 4.672e-61
Identity = 94/135 (69.63%), Postives = 116/135 (85.93%), Query Frame = 2
Query:  185 HGHKAVALKELIIIFGGGNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPR 589
            HGH+AVA++EL+IIFGGGNEGI DELH YNT+TNQWF+P++RG+IPPGCAA G V D TR+L+FGGM+EYG+YS +LYEL ASRW WKK++P+PP  G  PC R+GHS +L GNK YLFGGLAN+SED+  N+PR
Sbjct:    2 HGHRAVAIRELMIIFGGGNEGIADELHVYNTVTNQWFLPAVRGDIPPGCAAHGFVCDGTRILVFGGMVEYGRYSNELYELQASRWLWKKVKPQPPPSGFPPCPRLGHSFSLYGNKCYLFGGLANESEDSNNNVPR 136          
BLAST of host cell factor-1 vs. Ensembl Mouse
Match: Hcfc1 (host cell factor C1 [Source:MGI Symbol;Acc:MGI:105942])

HSP 1 Score: 189.119 bits (479), Expect = 4.506e-50
Identity = 96/197 (48.73%), Postives = 124/197 (62.94%), Query Frame = 2
Query: 2474 WYDALITTQPKFTVTSYFAIPN--------TTGMPNLSLINETESEGLRVNLTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAIKVVKVRNGAQLSWEPPH-NCHNISEYSIYLAVKNNNPSSGQQNKG----FTFIRVYCGQEPKAIVTASFLTQAHLDNSSKPAVIFRIAARNELGYGPATQVRWL 3025
            W+D  +       VT YF  P+        +  +P+ + + + E       L PGTAYK RVA IN CGRGP+SE  AFKT LPGFPGAP AIK+ K  +GA L+WEPP      I EYS+YLA++++  +SG+          F+RVYCG  P  +V +S L+ AH+D ++KPA+IFRIAARNE GYGPATQVRWL
Sbjct:  389 WFDVGVIKGTSVMVTHYFLPPDDAVQSDDDSGTVPDYNQLKKQE-------LQPGTAYKFRVAGINACGRGPFSEISAFKTCLPGFPGAPCAIKISKSPDGAHLTWEPPSVTSGKIIEYSVYLAIQSSQ-ASGEPKSSTPAQLAFMRVYCGPSPSCLVQSSSLSNAHIDYTTKPAIIFRIAARNEKGYGPATQVRWL 577          
BLAST of host cell factor-1 vs. UniProt/SwissProt
Match: sp|P51610|HCFC1_HUMAN (Host cell factor 1 OS=Homo sapiens OX=9606 GN=HCFC1 PE=1 SV=2)

HSP 1 Score: 561.222 bits (1445), Expect = 1.064e-172
Identity = 239/392 (60.97%), Postives = 306/392 (78.06%), Query Frame = 2
Query:  128 INPKWVKVIAATGNSPRARHGHKAVALKELIIIFGGGNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNR-NSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLWYLETSLPPSPSKIQLERAHDESLELTCNPVPTADYYMLQIRIYHI 1300
            + P+W +V+  +G  PR RHGH+AVA+KELI++FGGGNEGIVDELH YNT TNQWF+P++RG+IPPGCAA+G V D TRLL+FGGM+EYGKYS DLYEL ASRWEWK+L+ K P+ G  PC R+GHS +L+GNK YLFGGLANDSED K NIPRYLNDLY+L+++   G + W+ P   G +P PRESH+AV Y       D  + KL++YGGM   R GD++ L++DT++W KP++ G  P PRSLHSAT +GNKMY+FGGWVPLV+DD +  + EKEWKCTN++  L+L+T++W+ +  D  E  +PR RAGH AVA++TR+YIWSGRDGYRKAWNNQVC KDLWYLET  PP P+++QL RA+  SLE++   V TAD Y+LQ++ Y I
Sbjct:   15 LQPRWKRVVGWSGPVPRPRHGHRAVAIKELIVVFGGGNEGIVDELHVYNTATNQWFIPAVRGDIPPGCAAYGFVCDGTRLLVFGGMVEYGKYSNDLYELQASRWEWKRLKAKTPKNGPPPCPRLGHSFSLVGNKCYLFGGLANDSEDPKNNIPRYLNDLYILELRPGSGVVAWDIPITYGVLPPPRESHTAVVY----TEKDNKKSKLVIYGGMSGCRLGDLWTLDIDTLTWNKPSLSGVAPLPRSLHSATTIGNKMYVFGGWVPLVMDDVKVATHEKEWKCTNTLACLNLDTMAWETILMDTLEDNIPRARAGHCAVAINTRLYIWSGRDGYRKAWNNQVCCKDLWYLETEKPPPPARVQLVRANTNSLEVSWGAVATADSYLLQLQKYDI 402          

HSP 2 Score: 185.652 bits (470), Expect = 4.478e-46
Identity = 97/195 (49.74%), Postives = 126/195 (64.62%), Query Frame = 2
Query: 2474 WYDALITTQPKFTVTSYF-----AIPNTTGMPNLSLINETESEGLRVNLTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAIKVVKVRNGAQLSWEPPH-NCHNISEYSIYLAVKNNNPSSGQQNKGFT-----FIRVYCGQEPKAIVTASFLTQAHLDNSSKPAVIFRIAARNELGYGPATQVRWL 3025
            W+D  +       VT YF     A+P+   +  +   N+ + + L+    PGTAYK RVA IN CGRGP+SE  AFKT LPGFPGAP AIK+ K  +GA L+WEPP      I EYS+YLA++++   +G + K  T     F+RVYCG  P  +V +S L+ AH+D ++KPA+IFRIAARNE GYGPATQVRWL
Sbjct: 1812 WFDVGVIKGTNVMVTHYFLPPDDAVPSDDDLGTVPDYNQLKKQELQ----PGTAYKFRVAGINACGRGPFSEISAFKTCLPGFPGAPCAIKISKSPDGAHLTWEPPSVTSGKIIEYSVYLAIQSSQ--AGGELKSSTPAQLAFMRVYCGPSPSCLVQSSSLSNAHIDYTTKPAIIFRIAARNEKGYGPATQVRWL 2000          
BLAST of host cell factor-1 vs. UniProt/SwissProt
Match: sp|P51611|HCFC1_MESAU (Host cell factor 1 OS=Mesocricetus auratus OX=10036 GN=HCFC1 PE=1 SV=1)

HSP 1 Score: 560.066 bits (1442), Expect = 6.103e-172
Identity = 238/392 (60.71%), Postives = 306/392 (78.06%), Query Frame = 2
Query:  128 INPKWVKVIAATGNSPRARHGHKAVALKELIIIFGGGNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNR-NSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLWYLETSLPPSPSKIQLERAHDESLELTCNPVPTADYYMLQIRIYHI 1300
            + P+W +V+  +G  PR RHGH+AVA+KELI++FGGGNEGIVDELH YNT TNQWF+P++RG+IPPGCAA+G V D TRLL+FGGM+EYGKYS DLYEL ASRWEWK+L+ K P+ G  PC R+GHS +L+GNK YLFGGLANDSED K NIPRYLNDLY+L+++   G + W+ P   G +P PRESH+AV Y       D  + KL++YGGM   R GD++ L+++T++W KP++ G  P PRSLHSAT +GNKMY+FGGWVPLV+DD +  + EKEWKCTN++  L+L+T++W+ +  D  E  +PR RAGH AVA++TR+YIWSGRDGYRKAWNNQVC KDLWYLET  PP P+++QL RA+  SLE++   V TAD Y+LQ++ Y I
Sbjct:   15 LQPRWKRVVGWSGPVPRPRHGHRAVAIKELIVVFGGGNEGIVDELHVYNTATNQWFIPAVRGDIPPGCAAYGFVCDGTRLLVFGGMVEYGKYSNDLYELQASRWEWKRLKAKTPKNGPPPCPRLGHSFSLVGNKCYLFGGLANDSEDPKNNIPRYLNDLYILELRPGSGVVAWDIPITYGVLPPPRESHTAVVY----TEKDNKKSKLVIYGGMSGCRLGDLWTLDIETLTWNKPSLSGVAPLPRSLHSATTIGNKMYVFGGWVPLVMDDVKVATHEKEWKCTNTLACLNLDTMAWETILMDTLEDNIPRARAGHCAVAINTRLYIWSGRDGYRKAWNNQVCCKDLWYLETEKPPPPARVQLVRANTNSLEVSWGAVATADSYLLQLQKYDI 402          

HSP 2 Score: 184.496 bits (467), Expect = 1.048e-45
Identity = 97/198 (48.99%), Postives = 125/198 (63.13%), Query Frame = 2
Query: 2474 WYDALITTQPKFTVTSYFAIPN--------TTGMPNLSLINETESEGLRVNLTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAIKVVKVRNGAQLSWEPPH-NCHNISEYSIYLAVKNNNPSSGQQNKGFT-----FIRVYCGQEPKAIVTASFLTQAHLDNSSKPAVIFRIAARNELGYGPATQVRWL 3025
            W+D  +       VT YF  P+        +  +P+ + + + E       L PGTAYK RVA IN CGRGP+SE  AFKT LPGFPGAP AIK+ K  +GA L+WEPP      I EYS+YLA++++   +G + K  T     F+RVYCG  P  +V +S L+ AH+D ++KPA+IFRIAARNE GYGPATQVRWL
Sbjct: 1867 WFDVGVIKGTSVMVTHYFLPPDDAVQSDDDSGTIPDYNQLKKQE-------LQPGTAYKFRVAGINACGRGPFSEISAFKTCLPGFPGAPCAIKISKSPDGAHLTWEPPSVTSGKIIEYSVYLAIQSSQ--AGGEPKSSTPAQLAFMRVYCGPSPSCLVQSSSLSNAHIDYTTKPAIIFRIAARNEKGYGPATQVRWL 2055          
BLAST of host cell factor-1 vs. UniProt/SwissProt
Match: sp|Q61191|HCFC1_MOUSE (Host cell factor 1 OS=Mus musculus OX=10090 GN=Hcfc1 PE=1 SV=2)

HSP 1 Score: 559.296 bits (1440), Expect = 8.069e-172
Identity = 238/392 (60.71%), Postives = 306/392 (78.06%), Query Frame = 2
Query:  128 INPKWVKVIAATGNSPRARHGHKAVALKELIIIFGGGNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNR-NSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLWYLETSLPPSPSKIQLERAHDESLELTCNPVPTADYYMLQIRIYHI 1300
            + P+W +V+  +G  PR RHGH+AVA+KELI++FGGGNEGIVDELH YNT TNQWF+P++RG+IPPGCAA+G V D TRLL+FGGM+EYGKYS DLYEL ASRWEWK+L+ K P+ G  PC R+GHS +L+GNK YLFGGLANDSED K NIPRYLNDLY+L+++   G + W+ P   G +P PRESH+AV Y       D  + KL++YGGM   R GD++ L+++T++W KP++ G  P PRSLHSAT +GNKMY+FGGWVPLV+DD +  + EKEWKCTN++  L+L+T++W+ +  D  E  +PR RAGH AVA++TR+YIWSGRDGYRKAWNNQVC KDLWYLET  PP P+++QL RA+  SLE++   V TAD Y+LQ++ Y I
Sbjct:   15 LQPRWKRVVGWSGPVPRPRHGHRAVAIKELIVVFGGGNEGIVDELHVYNTATNQWFIPAVRGDIPPGCAAYGFVCDGTRLLVFGGMVEYGKYSNDLYELQASRWEWKRLKAKTPKNGPPPCPRLGHSFSLVGNKCYLFGGLANDSEDPKNNIPRYLNDLYILELRPGSGVVAWDIPITYGVLPPPRESHTAVVY----TEKDNKKSKLVIYGGMSGCRLGDLWTLDIETLTWNKPSLSGVAPLPRSLHSATTIGNKMYVFGGWVPLVMDDVKVATHEKEWKCTNTLACLNLDTMAWETILMDTLEDNIPRARAGHCAVAINTRLYIWSGRDGYRKAWNNQVCCKDLWYLETEKPPPPARVQLVRANTNSLEVSWGAVATADSYLLQLQKYDI 402          

HSP 2 Score: 184.496 bits (467), Expect = 1.117e-45
Identity = 96/197 (48.73%), Postives = 124/197 (62.94%), Query Frame = 2
Query: 2474 WYDALITTQPKFTVTSYFAIPN--------TTGMPNLSLINETESEGLRVNLTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAIKVVKVRNGAQLSWEPPH-NCHNISEYSIYLAVKNNNPSSGQQNKG----FTFIRVYCGQEPKAIVTASFLTQAHLDNSSKPAVIFRIAARNELGYGPATQVRWL 3025
            W+D  +       VT YF  P+        +  +P+ + + + E       L PGTAYK RVA IN CGRGP+SE  AFKT LPGFPGAP AIK+ K  +GA L+WEPP      I EYS+YLA++++  +SG+          F+RVYCG  P  +V +S L+ AH+D ++KPA+IFRIAARNE GYGPATQVRWL
Sbjct: 1822 WFDVGVIKGTSVMVTHYFLPPDDAVQSDDDSGTVPDYNQLKKQE-------LQPGTAYKFRVAGINACGRGPFSEISAFKTCLPGFPGAPCAIKISKSPDGAHLTWEPPSVTSGKIIEYSVYLAIQSSQ-ASGEPKSSTPAQLAFMRVYCGPSPSCLVQSSSLSNAHIDYTTKPAIIFRIAARNEKGYGPATQVRWL 2010          
BLAST of host cell factor-1 vs. UniProt/SwissProt
Match: sp|Q9V4C8|HCF_DROME (Host cell factor OS=Drosophila melanogaster OX=7227 GN=Hcf PE=1 SV=2)

HSP 1 Score: 497.278 bits (1279), Expect = 1.448e-152
Identity = 212/395 (53.67%), Postives = 286/395 (72.41%), Query Frame = 2
Query:  137 KWVKVIAATGNSPRARHGHKAVALKELIIIFGGGNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQG-TMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLWYLETSLPPSPSKIQLERAHDESLELTCNPVPTADYYMLQIRIYHIPQSNST 1318
            +W +V+  TG  PR RHGH+A+ +KEL+++FGGGNEGIVDELH YNT+TNQW+VP L+G++P GCAA+G V + TR+ +FGGM+EYGKYS +LYEL A++WEW+K+ P+ P  G  PC R+GHS T++G K++LFGGLAN+S+D K NIP+YLNDLY+LD +        W  P   G  P PRESH+ +++             LL+YGGM   R GD+++L  D+M+W+KP   GE P PRSLHS+T++GNKMY+FGGWVPLV++D++++ E+EWKCTN++  LDLET++W+ V  D  E  +PR RAGH AV + +R+Y+WSGRDGYRKAWNNQVC KDLWYLE S P    K+ L RA   +LEL+      A  Y+LQI+    P + S+
Sbjct:   59 RWKRVLNPTGPQPRPRHGHRAINIKELMVVFGGGNEGIVDELHVYNTVTNQWYVPVLKGDVPNGCAAYGFVVEGTRMFVFGGMIEYGKYSNELYELQATKWEWRKMYPESPDSGLSPCPRLGHSFTMVGEKIFLFGGLANESDDPKNNIPKYLNDLYILDTRGVHSHNGKWIVPKTYGDSPPPRESHTGISF----ATKSNGNLNLLIYGGMSGCRLGDLWLLETDSMTWSKPKTSGEAPLPRSLHSSTMIGNKMYVFGGWVPLVINDSKSTTEREWKCTNTLAVLDLETMTWENVTLDTVEENVPRARAGHCAVGIQSRLYVWSGRDGYRKAWNNQVCCKDLWYLEVSKPLYAVKVALVRASTHALELSWTATTFAAAYVLQIQKIEQPLNTSS 449          

HSP 2 Score: 172.94 bits (437), Expect = 2.939e-42
Identity = 84/147 (57.14%), Postives = 100/147 (68.03%), Query Frame = 2
Query: 2594 RVNLTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAIKVVK-VRNGAQLSWEPP--HNCHNISEYSIYLAVKNNNPSSGQQNKGFTFIRVYCGQEPKAIVTASFLTQAHLDNSSKPAVIFRIAARNELGYGPATQVRWL 3025
            R NL PGTAY+ R++AIN CGRG W E  +FKT LPGFPGAPSAIK+ K V+ GA L+WEPP       I EYS+YLAVK              F+RVY G   +  V  + L+ AH+D S+KPA+IFRIAARN+ GYGPATQVRWL
Sbjct: 1306 RTNLEPGTAYRFRLSAINSCGRGEWGEISSFKTCLPGFPGAPSAIKISKDVKEGAHLTWEPPPAQKTKEIIEYSVYLAVKPTAKDKALSTPQLAFVRVYVGAANQCTVPNASLSNAHVDCSNKPAIIFRIAARNQKGYGPATQVRWL 1452          
BLAST of host cell factor-1 vs. UniProt/SwissProt
Match: sp|Q5RKG2|HCFC2_RAT (Host cell factor 2 OS=Rattus norvegicus OX=10116 GN=Hcfc2 PE=2 SV=1)

HSP 1 Score: 460.299 bits (1183), Expect = 1.573e-146
Identity = 216/386 (55.96%), Postives = 286/386 (74.09%), Query Frame = 2
Query:  140 WVKVIAATGNSPRARHGHKAVALKELIIIFGGGNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNS-QEKEWKCTNSVHRLDLETLSWDRVCEDADEAE---MPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLWYLETSLPPSPSKIQLERAHDESLELTCNPVPTADYYMLQI 1285
            W +V + TG  PRARHGH+AVA++EL+IIFGGGNEGI DELH YNT+TNQWF+P++RG+IPPGCAA G V D TR+L+FGGM+EYG+YS +LYEL ASRW WKK++P+PP  G  PC R+GHS +L GNK YLF GLAN+SED+  N+PRYLND Y L+++   G + W  P+ KG++P+PRESH+AV Y       D    K+ V+GGM   R  D++ L+++TMSW+KP   G +P PRSLH+A+++GNKMYIFGGWVP   ++  NS  + EW+CT+S   L+L+T  W  +  D+ E +    PRPRAGH AVA+ TR+Y WSGRDGY+KA N+QVC KDLWYL+T  PP+PS++QL +A   S  +  + VPT + Y+LQ+
Sbjct:    9 WRRVSSFTGPVPRARHGHRAVAIRELMIIFGGGNEGIADELHVYNTVTNQWFLPAVRGDIPPGCAAHGFVCDGTRILVFGGMVEYGRYSNELYELQASRWLWKKVKPQPPPSGLPPCPRLGHSFSLYGNKCYLFAGLANESEDSNNNVPRYLNDFYELELQHGSGVVGWSVPATKGTVPSPRESHTAVIY----CKRDSGSPKMYVFGGMCGARLDDLWQLDLETMSWSKPETKGTVPLPRSLHTASVIGNKMYIFGGWVPHKGENTENSPHDCEWRCTSSFSYLNLDTAEWTTLVSDSQEDKKNSRPRPRAGHCAVAIGTRLYFWSGRDGYKKALNSQVCCKDLWYLDTEKPPAPSQVQLIKATTNSFHVKWDEVPTVEGYLLQL 390          

HSP 2 Score: 163.31 bits (412), Expect = 4.671e-40
Identity = 88/198 (44.44%), Postives = 117/198 (59.09%), Query Frame = 2
Query: 2474 WYDALITTQPKFTVTSYFAIPN---------TTGMPNLSLINETESEGLRVNLTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAIKVVKVRNGAQLSWEPPHN-CHNISEYSIYLAVK----NNNPSSGQQNKGFTFIRVYCGQEPKAIVTASFLTQAHLDNSSKPAVIFRIAARNELGYGPATQVRWL 3025
            W D  I       V+ ++ +P             +P+ SL+ + +       L PGT YK RVAAIN CG GP+S+   FKT +PGFPGAPS +++ K   G  LSWEPP +   NI EYS YLA++     +NPS         F+R+YCG +   IVTA  L  AH+D +S+PA++FRI+A+NE GYGPATQVRWL
Sbjct:  529 WCDVGIFKNNTALVSQFYLLPKGKQSMSKVGNADVPDYSLLKKQD-------LVPGTVYKFRVAAINGCGIGPFSKLSEFKTCIPGFPGAPSTVRISKNVEGIHLSWEPPTSPSGNILEYSAYLAIRTAQVQDNPSQ------LVFMRIYCGLKTSCIVTAGQLANAHIDYTSRPAIVFRISAKNEKGYGPATQVRWL 713          
BLAST of host cell factor-1 vs. TrEMBL
Match: I1ZI98 (Host cell factor-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1895.17 bits (4908), Expect = 0.000e+0
Identity = 1039/1039 (100.00%), Postives = 1039/1039 (100.00%), Query Frame = 2
Query:  113 MLTDSINPKWVKVIAATGNSPRARHGHKAVALKELIIIFGGGNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLWYLETSLPPSPSKIQLERAHDESLELTCNPVPTADYYMLQIRIYHIPQSNSTIQSQQSAAALSGIDAAPKXXXXXXXXXXXXXXXXXXXXXXXXXFNTSEPTHLQPDTSPMVPVQHKIIRFAAVEGXXXXXXXXXXXXXXXXRISLNSASKIRFSTVPTTQKPAASIKPQVINLNSSIVPTSNTPVALLKPGSNQVTRPVLRIVSNKTFTCVNQPVNAVNQPGKIVKTVMMQQPSSQPGTVQIRPTHRVLVSQTQPNIVRAGSTDQVHSIRMISTDQLNRIQSREHEPHPDQYDGADTDEDSEKNIDMXXXXXXXXXXXXXXXXXXXYSAKDESKEETSNSRLSMTDTEDPLETLAIVATSQRXXXXXXXXXXXXXXXXXLSKIGQSNIGNIGLSDSINHYMPVGNSSAYINGNNNSSTQEPQDKQNLINSNTDEVVWYDALITTQPKFTVTSYFAIPNTTGMPNLSLINETESEGLRVNLTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAIKVVKVRNGAQLSWEPPHNCHNISEYSIYLAVKNNNPSSGQQNKGFTFIRVYCGQEPKAIVTASFLTQAHLDNSSKPAVIFRIAARNELGYGPATQVRWLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXINVGNNFSCAPPGVKRQPSNIDDWSANKKSKPSI 3229
            MLTDSINPKWVKVIAATGNSPRARHGHKAVALKELIIIFGGGNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLWYLETSLPPSPSKIQLERAHDESLELTCNPVPTADYYMLQIRIYHIPQSNSTIQSQQSAAALSGIDAAPKSESSTSIIPTTVITTPTVSEPITVSFNTSEPTHLQPDTSPMVPVQHKIIRFAAVEGINQSSASNIQSNPNIQRISLNSASKIRFSTVPTTQKPAASIKPQVINLNSSIVPTSNTPVALLKPGSNQVTRPVLRIVSNKTFTCVNQPVNAVNQPGKIVKTVMMQQPSSQPGTVQIRPTHRVLVSQTQPNIVRAGSTDQVHSIRMISTDQLNRIQSREHEPHPDQYDGADTDEDSEKNIDMAKLAQAAAAELLADDDENEYSAKDESKEETSNSRLSMTDTEDPLETLAIVATSQREHSNISSSSHNIHPSEHLSKIGQSNIGNIGLSDSINHYMPVGNSSAYINGNNNSSTQEPQDKQNLINSNTDEVVWYDALITTQPKFTVTSYFAIPNTTGMPNLSLINETESEGLRVNLTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAIKVVKVRNGAQLSWEPPHNCHNISEYSIYLAVKNNNPSSGQQNKGFTFIRVYCGQEPKAIVTASFLTQAHLDNSSKPAVIFRIAARNELGYGPATQVRWLQDSTQQQHYQQQMSNPSVPVVSSNSNLQSSVRPSINVGNNFSCAPPGVKRQPSNIDDWSANKKSKPSI
Sbjct:    1 MLTDSINPKWVKVIAATGNSPRARHGHKAVALKELIIIFGGGNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLWYLETSLPPSPSKIQLERAHDESLELTCNPVPTADYYMLQIRIYHIPQSNSTIQSQQSAAALSGIDAAPKSESSTSIIPTTVITTPTVSEPITVSFNTSEPTHLQPDTSPMVPVQHKIIRFAAVEGINQSSASNIQSNPNIQRISLNSASKIRFSTVPTTQKPAASIKPQVINLNSSIVPTSNTPVALLKPGSNQVTRPVLRIVSNKTFTCVNQPVNAVNQPGKIVKTVMMQQPSSQPGTVQIRPTHRVLVSQTQPNIVRAGSTDQVHSIRMISTDQLNRIQSREHEPHPDQYDGADTDEDSEKNIDMAKLAQAAAAELLADDDENEYSAKDESKEETSNSRLSMTDTEDPLETLAIVATSQREHSNISSSSHNIHPSEHLSKIGQSNIGNIGLSDSINHYMPVGNSSAYINGNNNSSTQEPQDKQNLINSNTDEVVWYDALITTQPKFTVTSYFAIPNTTGMPNLSLINETESEGLRVNLTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAIKVVKVRNGAQLSWEPPHNCHNISEYSIYLAVKNNNPSSGQQNKGFTFIRVYCGQEPKAIVTASFLTQAHLDNSSKPAVIFRIAARNELGYGPATQVRWLQDSTQQQHYQQQMSNPSVPVVSSNSNLQSSVRPSINVGNNFSCAPPGVKRQPSNIDDWSANKKSKPSI 1039          
BLAST of host cell factor-1 vs. TrEMBL
Match: L0H759 (Hcf1 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 739.954 bits (1909), Expect = 0.000e+0
Identity = 424/424 (100.00%), Postives = 424/424 (100.00%), Query Frame = 2
Query: 1457 SEPTHLQPDTSPMVPVQHKIIRFAAVEGXXXXXXXXXXXXXXXXRISLNSASKIRFSTVPTTQKPAASIKPQVINLNSSIVPTSNTPVALLKPGSNQVTRPVLRIVSNKTFTCVNQPVNAVNQPGKIVKTVMMQQPSSQPGTVQIRPTHRVLVSQTQPNIVRAGSTDQVHSIRMISTDQLNRIQSREHEPHPDQYDGADTDEDSEKNIDMXXXXXXXXXXXXXXXXXXXYSAKDESKEETSNSRLSMTDTEDPLETLAIVATSQRXXXXXXXXXXXXXXXXXLSKIGQSNIGNIGLSDSINHYMPVGNSSAYINGNNNSSTQEPQDKQNLINSNTDEVVWYDALITTQPKFTVTSYFAIPNTTGMPNLSLINETESEGLRVNLTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAI 2728
            SEPTHLQPDTSPMVPVQHKIIRFAAVEGINQSSASNIQSNPNIQRISLNSASKIRFSTVPTTQKPAASIKPQVINLNSSIVPTSNTPVALLKPGSNQVTRPVLRIVSNKTFTCVNQPVNAVNQPGKIVKTVMMQQPSSQPGTVQIRPTHRVLVSQTQPNIVRAGSTDQVHSIRMISTDQLNRIQSREHEPHPDQYDGADTDEDSEKNIDMAKLAQAAAAELLADDDENEYSAKDESKEETSNSRLSMTDTEDPLETLAIVATSQREHSNISSSSHNIHPSEHLSKIGQSNIGNIGLSDSINHYMPVGNSSAYINGNNNSSTQEPQDKQNLINSNTDEVVWYDALITTQPKFTVTSYFAIPNTTGMPNLSLINETESEGLRVNLTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAI
Sbjct:    1 SEPTHLQPDTSPMVPVQHKIIRFAAVEGINQSSASNIQSNPNIQRISLNSASKIRFSTVPTTQKPAASIKPQVINLNSSIVPTSNTPVALLKPGSNQVTRPVLRIVSNKTFTCVNQPVNAVNQPGKIVKTVMMQQPSSQPGTVQIRPTHRVLVSQTQPNIVRAGSTDQVHSIRMISTDQLNRIQSREHEPHPDQYDGADTDEDSEKNIDMAKLAQAAAAELLADDDENEYSAKDESKEETSNSRLSMTDTEDPLETLAIVATSQREHSNISSSSHNIHPSEHLSKIGQSNIGNIGLSDSINHYMPVGNSSAYINGNNNSSTQEPQDKQNLINSNTDEVVWYDALITTQPKFTVTSYFAIPNTTGMPNLSLINETESEGLRVNLTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAI 424          
BLAST of host cell factor-1 vs. TrEMBL
Match: A0A0R3TXZ0 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS12713 PE=4 SV=1)

HSP 1 Score: 585.874 bits (1509), Expect = 0.000e+0
Identity = 252/396 (63.64%), Postives = 323/396 (81.57%), Query Frame = 2
Query:  137 KWVKVIAATGNSPRARHGHKAVALKELIIIFGGGNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRVCEDA-DEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLWYLETSLPPSPSKIQLERAHDESLELTCNPVPTADYYMLQIRIYHIPQSNSTI 1321
            KW KV  A+GN PR+RHGH+AVA+K+LI+IFGGGNEGIVDELH +NT  NQW +P++RG+IPPGCAAFG++ADN+R+L+FGGMLEYGKYS DLYEL A++WEW++L+PKPPR G LPC RIGHS TL+G K +LFGG+ NDSED K NIPRYLNDLY L+++     M W+ P+  G +PTPRESH+AVAYQ++   S   +W+LLVYGGM+  R GD+Y+L+ DTM+WT+P I G  PQPRSLHSAT++GN+MY+FGGWVPL+ DD + + EKEWKCTNS+  L+L+T+SW+ +  D  D++++PR RAGHSAVAVSTR+YIWSGRDGYRKAWNNQVCFKDLW+LET  P +PS++ L RA   SL+++  PVPTAD Y+LQI+ Y +  ++  I
Sbjct:    9 KWKKVTTASGNVPRSRHGHRAVAIKDLIVIFGGGNEGIVDELHVFNTAMNQWHLPAVRGDIPPGCAAFGMIADNSRILLFGGMLEYGKYSNDLYELQATKWEWRRLKPKPPRNGPLPCPRIGHSFTLVGQKAFLFGGITNDSEDPKNNIPRYLNDLYALELRPNSSAMCWDIPACYGGLPTPRESHTAVAYQVMDGVSK--KWRLLVYGGMNGTRLGDIYLLDFDTMNWTQPIISGIPPQPRSLHSATVIGNRMYVFGGWVPLISDDMKATVEKEWKCTNSLASLNLDTMSWESIQMDVYDDSQVPRARAGHSAVAVSTRLYIWSGRDGYRKAWNNQVCFKDLWFLETDKPAAPSRVSLVRAGTTSLDVSWGPVPTADAYILQIQKYEVSATSGAI 402          

HSP 2 Score: 192.2 bits (487), Expect = 5.671e-46
Identity = 104/203 (51.23%), Postives = 125/203 (61.58%), Query Frame = 2
Query: 2474 WYDALITTQPKFTVTSYFAIPNTTGMPNLSL----------INETESEGLRVNLTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAIKVVKVRNGAQLSWEPPH-NCHNISEYSIYLAVKNNNPSSGQQNK--------GFTFIRVYCGQEPKAIVTASFLTQAHLDNSSKPAVIFRIAARNELGYGPATQVRWL 3025
            W+D  I    K TV+ Y A  N  G+   +L           N    +G ++ L PGTAYK RVA +N CGRGPWSE  AFKT +PGFPGAPSAIK+     GAQL+WEPP      I EYS+YLAVK+      +Q +        G  F+RVY G +P A+V  S LT+AHLD ++KPAVIFRIAA NE GYGPATQVRWL
Sbjct:  866 WHDVGIIKGSKCTVSVYSANTNDAGVSVEALEALQGVNGIGANGISPQGPKMGLVPGTAYKFRVAGLNACGRGPWSEISAFKTCVPGFPGAPSAIKITTNDQGAQLTWEPPQTTAGRIVEYSVYLAVKSQPGIVKEQQESKLGTVPSGMAFVRVYAGSQPIALVPHSVLTKAHLDMNAKPAVIFRIAACNEKGYGPATQVRWL 1068          
BLAST of host cell factor-1 vs. TrEMBL
Match: A0A068YEI7 (Host cell factor 1 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000836500 PE=4 SV=1)

HSP 1 Score: 583.178 bits (1502), Expect = 0.000e+0
Identity = 252/395 (63.80%), Postives = 323/395 (81.77%), Query Frame = 2
Query:  137 KWVKVIAATGNSPRARHGHKAVALKELIIIFGGGNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRV-CEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLWYLETSLPPSPSKIQLERAHDESLELTCNPVPTADYYMLQIRIYHIPQSNST 1318
            KW KV  A+GN PR+RHGHKAVALK+LI+IFGGGNEGIVDELH +NT  NQWF+P++RG+IPPGCAAFG++++NTR+L+FGGMLEYGKYS +LYEL AS+WEWK+L+PKPPR G LPC RIGHS TL+G + +LFGG+ NDSED K NIPRYLNDLY L+++     M W+ P   G  P+PRESH+AVAYQ++  +    +W+LLVYGGM   R GD++ L +DTM+WTKP+I G++P PRSLHSAT++GN+M++FGGWVPLV+DD + + EKEWKCTN++  L+L+T+SW+ +  E  D++ +PR RAGH AVAVSTR+YIWSGRDGYRKAWNNQVCFKDLW+LET  PP+PS++QL RA  +SL++T   VPTAD Y+LQI+ Y +   +ST
Sbjct:    9 KWKKVTTASGNVPRSRHGHKAVALKDLIVIFGGGNEGIVDELHVFNTSLNQWFLPAVRGDIPPGCAAFGMISENTRVLLFGGMLEYGKYSNELYELQASKWEWKRLKPKPPRNGPLPCPRIGHSFTLVGQRAFLFGGITNDSEDPKNNIPRYLNDLYTLELRPNSSAMCWDIPITYGQPPSPRESHTAVAYQVM--DGLIKKWRLLVYGGMTGCRLGDLWQLEIDTMTWTKPSISGDLPAPRSLHSATVIGNRMFVFGGWVPLVMDDMKTTVEKEWKCTNTLASLNLDTMSWEPIQMEVFDDSLVPRARAGHCAVAVSTRLYIWSGRDGYRKAWNNQVCFKDLWFLETDKPPAPSRVQLVRAGTQSLDVTWGSVPTADAYILQIQKYDVSTPSST 401          

HSP 2 Score: 206.453 bits (524), Expect = 2.703e-50
Identity = 109/213 (51.17%), Postives = 134/213 (62.91%), Query Frame = 2
Query: 2444 LINSNTDEVVWYDALITTQPKFTVTSYFAIPNTTGM----------PNLSLINETESEGLRVNLTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAIKVVKVRNGAQLSWEPPHN-CHNISEYSIYLAVKNNNPSS--------GQQNKGFTFIRVYCGQEPKAIVTASFLTQAHLDNSSKPAVIFRIAARNELGYGPATQVRWL 3025
            ++ S +D   W+D  +  QPK++V+ Y A  N  G+          PN    N    +G ++ LTPGTAYK RVA +N CGRGPWSE  AFKT LPGFPGAPSAIK+     GAQL+WEPP N    I EYS+YLAV++ + +         G    G  F+RVY G +P A+V  + L +AHLD SSKPAVIFRIAA NE GYGPATQVRWL
Sbjct:  946 MLTSRSDSA-WHDVGVIKQPKYSVSMYSANTNDAGISVEALDALQGPNGIGPNGIPPQGPKIALTPGTAYKFRVAGLNACGRGPWSEISAFKTCLPGFPGAPSAIKITTNEQGAQLTWEPPQNTAGRIIEYSVYLAVRSQSGTGKELQEVKMGTVPSGMAFVRVYAGPQPSALVMHTVLAKAHLDVSSKPAVIFRIAACNEKGYGPATQVRWL 1157          
BLAST of host cell factor-1 vs. TrEMBL
Match: U6J0K8 (Host cell factor OS=Echinococcus granulosus OX=6210 GN=EGR_01412 PE=4 SV=1)

HSP 1 Score: 583.178 bits (1502), Expect = 0.000e+0
Identity = 252/395 (63.80%), Postives = 323/395 (81.77%), Query Frame = 2
Query:  137 KWVKVIAATGNSPRARHGHKAVALKELIIIFGGGNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRV-CEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLWYLETSLPPSPSKIQLERAHDESLELTCNPVPTADYYMLQIRIYHIPQSNST 1318
            KW KV  A+GN PR+RHGHKAVALK+LI+IFGGGNEGIVDELH +NT  NQWF+P++RG+IPPGCAAFG++++NTR+L+FGGMLEYGKYS +LYEL AS+WEWK+L+PKPPR G LPC RIGHS TL+G + +LFGG+ NDSED K NIPRYLNDLY L+++     M W+ P   G  P+PRESH+AVAYQ++  +    +W+LLVYGGM   R GD++ L +DTM+WTKP+I G++P PRSLHSAT++GN+M++FGGWVPLV+DD + + EKEWKCTN++  L+L+T+SW+ +  E  D++ +PR RAGH AVAVSTR+YIWSGRDGYRKAWNNQVCFKDLW+LET  PP+PS++QL RA  +SL++T   VPTAD Y+LQI+ Y +   +ST
Sbjct:    9 KWKKVTTASGNVPRSRHGHKAVALKDLIVIFGGGNEGIVDELHVFNTSLNQWFLPAVRGDIPPGCAAFGMISENTRVLLFGGMLEYGKYSNELYELQASKWEWKRLKPKPPRNGPLPCPRIGHSFTLVGQRAFLFGGITNDSEDPKNNIPRYLNDLYTLELRPNSSAMCWDIPITYGQPPSPRESHTAVAYQVM--DGLIKKWRLLVYGGMTGCRLGDLWQLEIDTMTWTKPSISGDLPAPRSLHSATVIGNRMFVFGGWVPLVMDDMKTTVEKEWKCTNTLASLNLDTMSWESIQMEIFDDSLVPRARAGHCAVAVSTRLYIWSGRDGYRKAWNNQVCFKDLWFLETDKPPAPSRVQLVRAGTQSLDVTWGSVPTADAYILQIQKYDVSTPSST 401          

HSP 2 Score: 206.068 bits (523), Expect = 2.950e-50
Identity = 109/213 (51.17%), Postives = 134/213 (62.91%), Query Frame = 2
Query: 2444 LINSNTDEVVWYDALITTQPKFTVTSYFAIPNTTGM----------PNLSLINETESEGLRVNLTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAIKVVKVRNGAQLSWEPPHN-CHNISEYSIYLAVKNNNPSS--------GQQNKGFTFIRVYCGQEPKAIVTASFLTQAHLDNSSKPAVIFRIAARNELGYGPATQVRWL 3025
            ++ S +D   W+D  +  QPK++V+ Y A  N  G+          PN    N    +G ++ LTPGTAYK RVA +N CGRGPWSE  AFKT LPGFPGAPSAIK+     GAQL+WEPP N    I EYS+YLAV++ + +         G    G  F+RVY G +P A+V  + L +AHLD SSKPAVIFRIAA NE GYGPATQVRWL
Sbjct:  946 MLTSRSDSA-WHDVGVIKQPKYSVSMYSANTNDAGISVEALDALQGPNGIGPNGIPPQGPKIALTPGTAYKFRVAGLNACGRGPWSEISAFKTCLPGFPGAPSAIKITTNEQGAQLTWEPPQNTAGRIIEYSVYLAVRSQSGTGKELQEAKMGTVPSGMAFVRVYAGPQPSALVMHTVLAKAHLDVSSKPAVIFRIAACNEKGYGPATQVRWL 1157          
BLAST of host cell factor-1 vs. Ensembl Cavefish
Match: hcfc1b (host cell factor C1 [Source:NCBI gene;Acc:103044501])

HSP 1 Score: 553.132 bits (1424), Expect = 7.804e-172
Identity = 234/397 (58.94%), Postives = 310/397 (78.09%), Query Frame = 2
Query:  128 INPKWVKVIAATGNSPRARHGHKAVALKELIIIFGGGNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNR-NSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLWYLETSLPPSPSKIQLERAHDESLELTCNPVPTADYYMLQIRIYHIPQSNS 1315
            + P+W +V+  +G  PR RHGH+AVA+KEL+++FGGGNEGIVDELH YNT TNQWF+P++RG++PPGCAA+G V D TRLL+FGGM+EYGKYS DLYEL ASRWEWK+L+PK P+ G  PC R+GHS +L+GNK YLFGGLANDSED K NIPRYLNDLY L+++       W+ P   G +P PRESH+AV Y   ++ S ++  +L++YGGM   R GD++ L++DT++W KP+I G  P PRSLHSAT + NKMY+FGGWVPLV+DD +  + EKEWKCTN++  L+L++++W+ +  D  E  +PR RAGH +VA+++R+Y+WSGRDGYRKAWNNQVC KDLWYLET  P +PS++QL RA+  SLE++   VPTAD Y+LQ++ Y IP + +
Sbjct:   13 LQPRWKRVLGWSGPVPRPRHGHRAVAIKELMVVFGGGNEGIVDELHVYNTATNQWFIPAVRGDVPPGCAAYGFVCDGTRLLVFGGMVEYGKYSNDLYELQASRWEWKRLKPKAPKNGPPPCPRLGHSFSLVGNKCYLFGGLANDSEDPKNNIPRYLNDLYTLELRPGSNVAGWDIPITYGVLPPPRESHTAVVY--TEKTSKKS--RLVIYGGMSGCRLGDLWTLDIDTLTWNKPSISGTAPLPRSLHSATTITNKMYVFGGWVPLVMDDVKVATHEKEWKCTNTLACLNLDSMTWESILMDTLEDNIPRARAGHCSVAINSRLYVWSGRDGYRKAWNNQVCCKDLWYLETDRPHAPSRVQLVRANTSSLEVSWGAVPTADTYLLQLQKYDIPAATA 405          

HSP 2 Score: 182.57 bits (462), Expect = 4.018e-46
Identity = 95/195 (48.72%), Postives = 123/195 (63.08%), Query Frame = 2
Query: 2474 WYDALITTQPKFTVTSYFAIPNTTGMP-NLSLINETESEGL-------RVNLTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAIKVVKVRNGAQLSWEPPH-NCHNISEYSIYLAVKNNNPSSGQQN--KGFTFIRVYCGQEPKAIVTASFLTQAHLDNSSKPAVIFRIAARNELGYGPATQVRWL 3025
            W+D  I       VT Y+       MP + S + + +S  +       +V L+PGTAYK RVA IN CGRG +SE  AFKT LPGFPGAP AIK+ K  +GA L+WEPP      I EYS+YLA++++  +  + +      F+RVYCG  P  +V  S L+ AH+D ++KPA+IFRIAARNE GYGPATQVRWL
Sbjct: 1597 WFDVGIVKVTNMVVTHYY-------MPADDSEVTDDDSGTIPDYNQMKKVELSPGTAYKFRVAGINACGRGTFSEVSAFKTCLPGFPGAPCAIKISKSPDGAHLTWEPPSVTSGKIIEYSVYLAIQSSQTTEAKASAPAQLAFMRVYCGPNPSCLVQTSSLSNAHIDYTTKPAIIFRIAARNEKGYGPATQVRWL 1784          
BLAST of host cell factor-1 vs. Ensembl Cavefish
Match: hcfc2 (host cell factor C2 [Source:NCBI gene;Acc:103047617])

HSP 1 Score: 436.802 bits (1122), Expect = 1.430e-138
Identity = 203/411 (49.39%), Postives = 272/411 (66.18%), Query Frame = 2
Query:  113 MLTDSINPKWVKVIAATGNSPRARHGHKAVALKELIIIFGGGNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRV-------------------CEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLWYLETSLPPSPSKIQLERAHDESLELTCNPVPTADYYMLQIR 1288
            M+ D   P W +V + TG  PRARHGH+A A++ELI++FGGGNEGI +ELH YNT++ QWF+P++RG+IPPGCAA G V + TR+L+FGGM+E+GKY+  LYEL ASRW WKKL+P+ PR    PC R+GHS TL GNK YLFGGLANDSED   N+PRYL+D Y L+++A  G   W  P  +G  P+ RESH+ VAY      S     KL ++GGM   R  D++ L+++TM+W+ P   G  P PRSLHSA ++GN+MY+FGGWVP    +   +   EW CTNS+  L+L+ ++W  +                    E+      P+ RAGH A  + TR+YIWSGRDGYRK+W+ QVC KDLWYLET  P +PS + L ++    L +   P+PTA+ Y+LQ++
Sbjct:    1 MVVD--GPVWRRVQSFTGPIPRARHGHRAAAIRELIVVFGGGNEGIAEELHVYNTVSKQWFLPAVRGDIPPGCAAHGFVCEGTRILVFGGMVEFGKYTSSLYELQASRWLWKKLKPRSPRNAPPPCPRLGHSFTLHGNKCYLFGGLANDSEDPNGNVPRYLDDFYELELQAQSGVKGWSVPETRGRGPSARESHTCVAYGGKGGGSP----KLYIFGGMCGKRLSDLWQLDIETMTWSIPQATGPCPLPRSLHSANVIGNQMYVFGGWVPA---EESETSGVEWMCTNSLSVLNLDKMAWRNLNPERRQQQQQHSGTAVQSDGEEEGSRNWPKARAGHCAATIGTRLYIWSGRDGYRKSWSYQVCCKDLWYLETEKPSTPSAVFLVKSTISMLHVAWRPIPTAECYLLQLQ 402          

HSP 2 Score: 144.821 bits (364), Expect = 4.636e-35
Identity = 80/201 (39.80%), Postives = 115/201 (57.21%), Query Frame = 2
Query: 2462 DEVVWYDALITTQPKFTVTSYFAIPNTTGM-PNLSLINETESEGL-----------RVNLTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAIKVVKVRNGAQLSWEPPHN-CHNISEYSIYLAVKNNNPSSGQQNKGFTFIRVYCGQEPKAIVTASFLTQAHLDNSSKPAVIFRIAARNELGYGPATQVRWL 3025
            +E  W+D  I       VT Y+   +  G+ P+LS    ++ E             +  L  G  Y+ RVA +N  G+G +S    FKT  PGFPGAPSA+K+ K  +   ++WE P +    I EYS+YLAV+       ++ +  TFIR+Y G +   IV+A+ L  AH+D +++PAV+FRIAA+NE GYGPATQ+RWL
Sbjct:  487 EESAWHDVGIFKTLFSEVTQYYLPSDGDGITPSLSRRISSDGEWKMPGPHSFKEREKQELASGICYRFRVAGLNSRGQGDFSPVSEFKTCQPGFPGAPSAVKITKASDSVHITWESPTSPSGKIQEYSMYLAVRKCRGGGVEKPEELTFIRIYRGIKTSCIVSAAHLANAHIDCTARPAVVFRIAAKNEQGYGPATQIRWL 687          
BLAST of host cell factor-1 vs. Ensembl Cavefish
Match: klhdc3 (kelch domain containing 3 [Source:ZFIN;Acc:ZDB-GENE-040426-2426])

HSP 1 Score: 101.679 bits (252), Expect = 1.070e-22
Identity = 70/253 (27.67%), Postives = 115/253 (45.45%), Query Frame = 2
Query:  173 PRARHGHKAVALKELIIIFGGGN--EGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGK-YSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMH---KFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGG 913
            P  R+GH AV + + I I+GG N  EG  + L+A++   ++W+ P + G +P              + +FGG  +    +S D+++L  +   W  +       G+    R  HS T+IG KM++FGG A+       N   Y N + V D +    T  W        +P  R SHSA +Y            +L ++GG +      + D++  N +  SW K    G+ P PR      +VG+++ +FGG
Sbjct:   74 PYMRYGHTAVLVDDTIYIWGGRNDTEGACNVLYAFDVNNHRWYTPKISGTVPGARDGHSACVLGKSMYIFGGYEQLADCFSNDIHKLDTTTMSWSLINAT----GTPARWRDFHSATIIGTKMFVFGGRADRFGPFHSNNEIYCNKIKVFDTE----TNSWLNTPSTPLLPEGRRSHSAFSYNG----------ELYIFGGYNARLDRHFNDLWKFNPEVFSWKKVEPKGKGPCPRRRQCCCMVGDRIVLFGG 308          

HSP 2 Score: 77.7962 bits (190), Expect = 9.538e-15
Identity = 94/365 (25.75%), Postives = 146/365 (40.00%), Query Frame = 2
Query:  173 PRARHGHKAVALKELIIIFGGGNEGIVDE------LHAYNTLTNQWF-VPSLRG-------EIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYG------DVY-----ILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKD----LWYLETS 1180
            PR R  H AVA+   +  FGG   G   E      +H +NT++ +W  +P +R        E+P        V  +  + ++GG  +       LY    +   W      P   G++P AR GHS  ++G  MY+FGG    ++        + ND++ LD      TM W   +  G+    R+ HSA               K+ V+GG    R+G      ++Y     + + +T SW        +P+ R  HSA     ++YIFGG+    LD + N     WK        + E  SW +V     + + P PR       V  RI ++ G        +N V   D    +W L+ S
Sbjct:   12 PR-RVNHAAVAVSHKVYSFGGYCSGEDYETLRQIDVHVFNTVSLRWMKLPPVRTGGREHVREVPYMRYGHTAVLVDDTIYIWGGRNDTEGACNVLYAFDVNNHRWYT----PKISGTVPGARDGHSACVLGKSMYIFGGYEQLAD-------CFSNDIHKLDTT----TMSWSLINATGTPARWRDFHSATIIGT----------KMFVFGGRAD-RFGPFHSNNEIYCNKIKVFDTETNSWLNTPSTPLLPEGRRSHSAFSYNGELYIFGGYNAR-LDRHFNDL---WK-------FNPEVFSWKKV---EPKGKGPCPRRRQCCCMVGDRIVLFGGTSSVHSDLSNSVWILDQSNSVWILDQS 335          

HSP 3 Score: 64.6994 bits (156), Expect = 2.109e-10
Identity = 46/176 (26.14%), Postives = 77/176 (43.75%), Query Frame = 2
Query:  122 DSINPKWVKVIAATGNSPRARHGHKAVALKELIIIFGG----------GNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGM-LEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLD 616
            D+    W  +I ATG   R R  H A  +   + +FGG           NE   +++  ++T TN W        +P G  +    + N  L +FGG      ++  DL++ +   + WKK+ PK    G  PC R      ++G+++ LFGG ++   D         N +++LD
Sbjct:  161 DTTTMSW-SLINATGTPARWRDFHSATIIGTKMFVFGGRADRFGPFHSNNEIYCNKIKVFDTETNSWLNTPSTPLLPEGRRSHSAFSYNGELYIFGGYNARLDRHFNDLWKFNPEVFSWKKVEPK----GKGPCPRRRQCCCMVGDRIVLFGGTSSVHSDLS-------NSVWILD 324          
BLAST of host cell factor-1 vs. Ensembl Cavefish
Match: krcp (rab9 effector protein with kelch motifs-like [Source:NCBI gene;Acc:103045721])

HSP 1 Score: 78.1814 bits (191), Expect = 2.074e-14
Identity = 68/252 (26.98%), Postives = 106/252 (42.06%), Query Frame = 2
Query:  158 ATGNSPRARHGHKAVALKE--LIIIFGGG-NEGIVDELHAYNTLTNQWFVPSLRGEIPP----GCAAFGLVADNTRLLMFGGML-----EYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMH-KFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHS 874
            A G +P AR GH A    E   I +FGG  ++   +++H  +T + +W +   +G++PP     C  F        L +FGG+      E    S  LY  +     W +    P   G+ P  R GHS  ++  K+++F G         ++ P   ND++ LD+      M +      GS P+PR  H   A             + LV+GG +      D +I + DT  WT  T+      PR+ HS
Sbjct:  260 AEGPTPEARMGHTATYDPESKRIFVFGGSKHKKWFNDVHILDTESWRWTMVEAQGKVPPLAYHSCTLF-----RGELFVFGGVFPRPHPEPDGCSDSLYIFNPEMAIWYQ----PIVNGNKPAPRSGHSACVMQGKIFIFAG---------WDTPVCFNDMFQLDL----CLMEFSAVQTSGSAPSPRSWHDCAALNDT---------RFLVHGGYNGNDALSDTFIFDTDTSCWTSLTLPQLTTVPRAGHS 480          

HSP 2 Score: 77.0258 bits (188), Expect = 5.933e-14
Identity = 51/175 (29.14%), Postives = 88/175 (50.29%), Query Frame = 2
Query:  662 KGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGG-MHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLWYLETSL 1183
            +G  P  R  H+A          D    ++ V+GG  HK  + DV+IL+ ++  WT     G++P P + HS TL   ++++FGG  P      R   E +  C++S++  + E   W +   + ++   P PR+GHSA  +  +I+I++G       W+  VCF D++ L+  L
Sbjct:  261 EGPTPEARMGHTATY--------DPESKRIFVFGGSKHKKWFNDVHILDTESWRWTMVEAQGKVP-PLAYHSCTLFRGELFVFGGVFP------RPHPEPD-GCSDSLYIFNPEMAIWYQPIVNGNK---PAPRSGHSACVMQGKIFIFAG-------WDTPVCFNDMFQLDLCL 409          

HSP 3 Score: 75.485 bits (184), Expect = 1.596e-13
Identity = 59/225 (26.22%), Postives = 101/225 (44.89%), Query Frame = 2
Query:  476 GSLPCARIGHSLTLI--GNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGD-------VYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVS-TRIYIWSGRDG 1120
            G  P AR+GH+ T      ++++FGG  +          ++ ND+++LD ++ + TM+      +G +P P   HS   ++           +L V+GG+    + +       +YI N +   W +P + G  P PRS HSA ++  K++IF GW   V             C N + +LDL  + +  V         P PR+ H   A++ TR  +  G +G
Sbjct:  262 GPTPEARMGHTATYDPESKRIFVFGGSKHK---------KWFNDVHILDTESWRWTMV----EAQGKVP-PLAYHSCTLFR----------GELFVFGGVFPRPHPEPDGCSDSLYIFNPEMAIWYQPIVNGNKPAPRSGHSACVMQGKIFIFAGWDTPV-------------CFNDMFQLDLCLMEFSAV---QTSGSAPSPRSWHDCAALNDTRFLVHGGYNG 446          

HSP 4 Score: 68.9366 bits (167), Expect = 1.627e-11
Identity = 79/333 (23.72%), Postives = 128/333 (38.44%), Query Frame = 2
Query:  155 AATGNSPRARHGHKAVALKELIIIFGGGN----EGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVA----DNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPR-------YLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHK-FRYGDVYILNVDTMSWTKPTIGGEIPQPRSLH-SATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPR----PRAGHSAVAVST 1090
            AA+ +SP  R G     +     I  GG     +   D +    T    W       E P   A  G  A    ++ R+ +FGG  ++ K+  D++ L    W W  +  +   G   P A   HS TL   ++++FGG+           PR         + LY+ + + A    +W  P + G+ P PR  HSA   Q           K+ ++ G      + D++ L++  M ++     G  P PRS H  A L   +  + GG+       N N         +     D +T  W  +        +P+    PRAGHS + ++T
Sbjct:  204 AASADSPSGRWGQTLCPIDPQTAILIGGQGARMQFCKDPIWKLCTEDLSWVPAETLAEGPTPEARMGHTATYDPESKRIFVFGGS-KHKKWFNDVHILDTESWRWTMVEAQ---GKVPPLAY--HSCTLFRGELFVFGGV----------FPRPHPEPDGCSDSLYIFNPEMA----IWYQPIVNGNKPAPRSGHSACVMQ----------GKIFIFAGWDTPVCFNDMFQLDLCLMEFSAVQTSGSAPSPRSWHDCAALNDTRFLVHGGY-------NGNDA------LSDTFIFDTDTSCWTSL-------TLPQLTTVPRAGHSIITMAT 486          
BLAST of host cell factor-1 vs. Ensembl Cavefish
Match: klhdc2 (kelch domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-070410-69])

HSP 1 Score: 74.7146 bits (182), Expect = 1.312e-13
Identity = 71/292 (24.32%), Postives = 125/292 (42.81%), Query Frame = 2
Query:  164 GNSPRARHGHKAVALKELIIIFGGGN----EGIVD------ELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYE--LHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQG-----------TMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMH-KFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNK-MYIFGGWVPLVLDDNRNSQEKEW 964
            G++P  R GH AV  +  + ++GG         VD      E+  YN  T +W +   +GE+P   +    V  +  L +FGG    G  +  +Y   L +S   W++++      G  P  +      +  N++  FGG  + ++         L++  ++   AA+G           T  W  P+ KG+ PTPR +H+                +  V+GG +   R  D+Y +N+D+  W++ ++  + P  RS HS   V N  +++FGG+       NR +    W
Sbjct:   60 GDTPAERSGHVAVVDRNCMYVWGGYKVTTATAFVDLYLPKKEVWIYNMETGRWRMQLSKGELPAAMSGSCGVCIDGILYVFGGHYARGN-TNLVYRLPLRSSSLVWERMKDLK---GLAPTCKDKLGCWVYKNRLVYFGGYGHVAQAGHLGAFE-LDENSLMGNHAARGWNNHIHILNLETSTWSQPATKGNAPTPRAAHACATIGN----------RGFVFGGRYMDHRLNDLYCINMDSWEWSEMSVPQQGPVGRSWHSFIPVSNDHIFLFGGFTT-----NRETLSDAW 331          

HSP 2 Score: 56.6102 bits (135), Expect = 8.492e-8
Identity = 65/266 (24.44%), Postives = 114/266 (42.86%), Query Frame = 2
Query:  413 LYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWE-TPSMKGSIPTPRE-----------------SHSAVAYQLIQQNSDQTQWKLLVYGGMHKFR--YGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVST-RIYIWSG----RDGYRKAW 1135
            +Y +   RW  +  +      G LP A  G     I   +Y+FGG       A+ N     N +Y L ++++  +++WE    +KG  PT ++                  H A A  L     D+    L+   G H  R     ++ILN++T +W++P   G  P PR+ H+   +GN+ ++FGG       D+R          N ++ +++++  W    E +   + P  R+ HS + VS   I+++ G    R+    AW
Sbjct:  104 IYNMETGRWRMQLSK------GELPAAMSGSCGVCIDGILYVFGG-----HYARGNT----NLVYRLPLRSS--SLVWERMKDLKGLAPTCKDKLGCWVYKNRLVYFGGYGHVAQAGHLGAFELDEN--SLM---GNHAARGWNNHIHILNLETSTWSQPATKGNAPTPRAAHACATIGNRGFVFGG----RYMDHR---------LNDLYCINMDSWEWS---EMSVPQQGPVGRSWHSFIPVSNDHIFLFGGFTTNRETLSDAW 331          
BLAST of host cell factor-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003143.1 (pep scaffold:Pmarinus_7.0:GL476673:191963:200990:-1 gene:ENSPMAG00000002873.1 transcript:ENSPMAT00000003143.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 507.679 bits (1306), Expect = 1.954e-170
Identity = 246/421 (58.43%), Postives = 314/421 (74.58%), Query Frame = 2
Query:  137 KWVKVIAATGNSPRARHGHKAVALKELIIIFGGGNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWK------------LLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNR-NSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLWYLETSLPPSPSKIQLERAHDESLELTCNPVPTADYYMLQIRIYHIPQSNSTIQSQQSAAALSGID 1360
            KW ++  +TG  PR RHGH+AV +KEL+++FGGGNEGIVDELH YNT TNQWF+P++RGEIPPGCAA+G V D TRLL+FGGM+EYGKYS DLYEL ASRWEWK+L+PKPP+ G  PC R+GHS +LIGNK YLFGGLANDSED K NIPRYLNDLYVL++K   G M W+ P  +G+ P PRESH+AV Y    + S  T  +            L++YGGM   R GD++ L+VDTM+W++P + G  P PRSLHSAT++G KM++FGGWVPLVL+D +  + EKEWKCT+++  L+LET++W  V  D  E   PRPRAGH AV++++R+++WSGRDGYRKAWNNQVC KDLWYLET  PP+P ++QL RA  +SLE++   V TAD Y+LQ++ Y IP         Q+ A +S +D
Sbjct:    7 KWKRITGSTGPVPRPRHGHRAVTIKELMVVFGGGNEGIVDELHVYNTATNQWFIPAVRGEIPPGCAAYGFVCDGTRLLVFGGMVEYGKYSNDLYELQASRWEWKRLKPKPPKHGPPPCPRLGHSFSLIGNKCYLFGGLANDSEDPKNNIPRYLNDLYVLELKPGSGVMGWDIPVTQGAPPPPRESHTAVVYPQPPEASPGTPTQPALTQPLGRRPMLVIYGGMSGCRLGDLWTLDVDTMTWSQPMMSGIAPLPRSLHSATVIGPKMFVFGGWVPLVLEDAKVATHEKEWKCTSNLACLNLETMTWQSVPTDTSEDNNPRPRAGHCAVSINSRLFVWSGRDGYRKAWNNQVCCKDLWYLETERPPAPGRVQLVRASTDSLEVSWGAVSTADAYLLQLQKYDIPPPAGATPV-QAPAGVSAMD 426          
BLAST of host cell factor-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003151.1 (pep scaffold:Pmarinus_7.0:GL476673:235484:236360:-1 gene:ENSPMAG00000002882.1 transcript:ENSPMAT00000003151.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.5969 bits (244), Expect = 1.323e-24
Identity = 54/104 (51.92%), Postives = 64/104 (61.54%), Query Frame = 2
Query: 2750 GAQLSWEPPH-NCHNISEYSIYLAVKN-NNPSSGQQNKGFT----------FIRVYCGQEPKAIVTASFLTQAHLDNSSKPAVIFRIAARNELGYGPATQVRWL 3025
            GA L+WEPP      I EY++YLAVK  N P +     G T          F RVYCG EP  +V  + L  AHLD  +KPA+IFRI+ARN+ GYGPATQVRWL
Sbjct:    2 GAHLTWEPPALKFGRILEYAVYLAVKRPNQPPAQAAGDGKTGAPAAAAQLAFARVYCGAEPSCLVANASLAGAHLDTGAKPAIIFRISARNQKGYGPATQVRWL 105          
BLAST of host cell factor-1 vs. Ensembl Sea Lamprey
Match: zgc:163014 (zgc:163014 [Source:ZFIN;Acc:ZDB-GENE-070424-100])

HSP 1 Score: 92.8189 bits (229), Expect = 8.529e-20
Identity = 75/248 (30.24%), Postives = 117/248 (47.18%), Query Frame = 2
Query:  158 ATGNSPRARHGHKAVALKEL--IIIFGGGNEGI-VDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGML-----EYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFR-YGDVYILNVDTMSWTKPTIGGEIPQPRSLHS 874
            ATG +P  R GH A    E+  I +FGG   G    ++H  +  T +W +   +G++PP  A          L +FGG+      +    S  LY  +     W +    P   G LPC R GHS+ L+ NK+ +FGG         ++ P   +DL+VLD+    G M +    ++G++P+PR  H++         SD    +++++GG +  R   D +I NVDT  WT+ T       PR+ HS
Sbjct:  220 ATGKTPECRIGHTATFDSEMRRIYVFGGSKNGKWFSDMHILDMATWKWQLVEAKGKVPP-LAYHSSTLFRHELFVFGGVFPLPNPQPDGCSNQLYIFNPQHSIWYQ----PIVVGDLPCPRSGHSMILLKNKLVIFGG---------WDAPMCFSDLHVLDL----GFMEYAPVQVQGAVPSPRCWHASAPV------SDN---RMIIHGGYNGQRALTDTHIFNVDTSEWTQLTSDPFGSVPRAGHS 440          

HSP 2 Score: 84.3445 bits (207), Expect = 4.801e-17
Identity = 73/277 (26.35%), Postives = 120/277 (43.32%), Query Frame = 2
Query:  353 DNTRLLMFGGMLEYGKYSGD-LYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGN--KMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKF-------RYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGW-VPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVS-TRIYIWSGRDGYRKAWNNQV 1147
            D   +++ GG      +  D +++LH     W  L  +    G  P  RIGH+ T      ++Y+FGG  N          ++ +D+++LD+     T  W+    KG +P P   HS+  ++           +L V+GG+              +YI N     W +P + G++P PRS HS  L+ NK+ IFGGW  P+              C + +H LDL  + +  V     +  +P PR  H++  VS  R+ I  G +G R   +  +
Sbjct:  182 DPQTVILIGGQGHRMTFCKDPIWKLHIENNSW--LPAETVATGKTPECRIGHTATFDSEMRRIYVFGGSKNG---------KWFSDMHILDM----ATWKWQLVEAKGKVP-PLAYHSSTLFRH----------ELFVFGGVFPLPNPQPDGCSNQLYIFNPQHSIWYQPIVVGDLPCPRSGHSMILLKNKLVIFGGWDAPM--------------CFSDLHVLDLGFMEYAPV---QVQGAVPSPRCWHASAPVSDNRMIIHGGYNGQRALTDTHI 415          

HSP 3 Score: 82.4185 bits (202), Expect = 2.047e-16
Identity = 83/321 (25.86%), Postives = 145/321 (45.17%), Query Frame = 2
Query:  173 PRARHGHKAVALK-ELIIIFGGGNEGIV---DELHAYNTLTNQWF-VPSLRGEIPPGC-----AAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGG---LANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHK-FRYGDVYILNVDTMSWTKPTIGGEIPQPRSLH-SATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVST 1090
            P AR GH    +  + +I+ GG    +    D +   +   N W    ++     P C     A F   ++  R+ +FGG  + GK+  D++ L  + W+W+ +  K   G   P A   HS TL  +++++FGG   L N   D         N LY+ + + +    +W  P + G +P PR  HS +   L++        KL+++GG      + D+++L++  M +    + G +P PR  H SA +  N+M I GG+         N Q    +     H  +++T  W ++  D   +    PRAGHS +A+++
Sbjct:  170 PSARWGHSLCLIDPQTVILIGGQGHRMTFCKDPIWKLHIENNSWLPAETVATGKTPECRIGHTATFD--SEMRRIYVFGGS-KNGKWFSDMHILDMATWKWQLVEAK---GKVPPLAY--HSSTLFRHELFVFGGVFPLPNPQPDG------CSNQLYIFNPQHS----IWYQPIVVGDLPCPRSGHSMI---LLKN-------KLVIFGGWDAPMCFSDLHVLDLGFMEYAPVQVQGAVPSPRCWHASAPVSDNRMIIHGGY---------NGQ----RALTDTHIFNVDTSEWTQLTSDPFGSV---PRAGHSILALAS 446          

HSP 4 Score: 68.5514 bits (166), Expect = 4.001e-12
Identity = 62/234 (26.50%), Postives = 106/234 (45.30%), Query Frame = 2
Query:  479 SLPCARIGHSLTLIG-NKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFR-YGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLWYLE 1174
            +LP AR GHSL LI    + L GG  +     K       + ++ L I+    + +       G  P  R  H+A          D    ++ V+GG    + + D++IL++ T  W      G++P P + HS+TL  +++++FGG  PL      N Q     C+N ++  + +   W +     D   +P PR+GHS + +  ++ I+ G       W+  +CF DL  L+
Sbjct:  168 ALPSARWGHSLCLIDPQTVILIGGQGHRMTFCK-------DPIWKLHIE--NNSWLPAETVATGKTPECRIGHTATF--------DSEMRRIYVFGGSKNGKWFSDMHILDMATWKWQLVEAKGKVP-PLAYHSSTLFRHELFVFGGVFPL-----PNPQPD--GCSNQLYIFNPQHSIWYQPIVVGD---LPCPRSGHSMILLKNKLVIFGG-------WDAPMCFSDLHVLD 366          

HSP 5 Score: 50.8322 bits (120), Expect = 1.596e-6
Identity = 53/235 (22.55%), Postives = 104/235 (44.26%), Query Frame = 2
Query:  116 LTDSINPKWVKVIAATGNSPRARHGHKAVALKELIIIFGG-------GNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGH-SLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSD----------QTQWKLLVYGG 766
            + D    KW +++ A G  P   + H +   +  + +FGG         +G  ++L+ +N   + W+ P + G++P   +   ++    +L++FGG      +S DL+ L     E+  ++ +    G++P  R  H S  +  N+M + GG         +N  R L D ++ ++  ++ T +   P   GS+  PR  HS +A   +   ++          +    LLV+GG
Sbjct:  259 ILDMATWKW-QLVEAKGKVPPLAY-HSSTLFRHELFVFGGVFPLPNPQPDGCSNQLYIFNPQHSIWYQPIVVGDLPCPRSGHSMILLKNKLVIFGGWDAPMCFS-DLHVLDLGFMEYAPVQVQ----GAVPSPRCWHASAPVSDNRMIIHGG---------YNGQRALTDTHIFNVDTSEWTQLTSDPF--GSV--PRAGHSILALASLDGGAEAKREGATGGHEVLSTLLVFGG 473          
BLAST of host cell factor-1 vs. Ensembl Sea Lamprey
Match: zgc:163014 (zgc:163014 [Source:ZFIN;Acc:ZDB-GENE-070424-100])

HSP 1 Score: 92.8189 bits (229), Expect = 9.106e-20
Identity = 77/258 (29.84%), Postives = 120/258 (46.51%), Query Frame = 2
Query:  131 NPKWVKV-IAATGNSPRARHGHKAVALKEL--IIIFGGGNEGI-VDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGML-----EYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFR-YGDVYILNVDTMSWTKPTIGGEIPQPRSLHS 874
            N  W+     ATG +P  R GH A    E+  I +FGG   G    ++H  +  T +W +   +G++PP  A          L +FGG+      +    S  LY  +     W +    P   G LPC R GHS+ L+ NK+ +FGG         ++ P   +DL+VLD+    G M +    ++G++P+PR  H++         SD    +++++GG +  R   D +I NVDT  WT+ T       PR+ HS
Sbjct:  218 NNSWLPAETVATGKTPECRIGHTATFDSEMRRIYVFGGSKNGKWFSDMHILDMATWKWQLVEAKGKVPP-LAYHSSTLFRHELFVFGGVFPLPNPQPDGCSNQLYIFNPQHSIWYQ----PIVVGDLPCPRSGHSMILLKNKLVIFGG---------WDAPMCFSDLHVLDL----GFMEYAPVQVQGAVPSPRCWHASAPV------SDN---RMIIHGGYNGQRALTDTHIFNVDTSEWTQLTSDPFGSVPRAGHS 448          

HSP 2 Score: 84.3445 bits (207), Expect = 4.327e-17
Identity = 73/277 (26.35%), Postives = 120/277 (43.32%), Query Frame = 2
Query:  353 DNTRLLMFGGMLEYGKYSGD-LYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGN--KMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKF-------RYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGW-VPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVS-TRIYIWSGRDGYRKAWNNQV 1147
            D   +++ GG      +  D +++LH     W  L  +    G  P  RIGH+ T      ++Y+FGG  N          ++ +D+++LD+     T  W+    KG +P P   HS+  ++           +L V+GG+              +YI N     W +P + G++P PRS HS  L+ NK+ IFGGW  P+              C + +H LDL  + +  V     +  +P PR  H++  VS  R+ I  G +G R   +  +
Sbjct:  190 DPQTVILIGGQGHRMTFCKDPIWKLHIENNSW--LPAETVATGKTPECRIGHTATFDSEMRRIYVFGGSKNG---------KWFSDMHILDM----ATWKWQLVEAKGKVP-PLAYHSSTLFRH----------ELFVFGGVFPLPNPQPDGCSNQLYIFNPQHSIWYQPIVVGDLPCPRSGHSMILLKNKLVIFGGWDAPM--------------CFSDLHVLDLGFMEYAPV---QVQGAVPSPRCWHASAPVSDNRMIIHGGYNGQRALTDTHI 423          

HSP 3 Score: 82.0333 bits (201), Expect = 2.415e-16
Identity = 83/321 (25.86%), Postives = 145/321 (45.17%), Query Frame = 2
Query:  173 PRARHGHKAVALK-ELIIIFGGGNEGIV---DELHAYNTLTNQWF-VPSLRGEIPPGC-----AAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGG---LANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHK-FRYGDVYILNVDTMSWTKPTIGGEIPQPRSLH-SATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVST 1090
            P AR GH    +  + +I+ GG    +    D +   +   N W    ++     P C     A F   ++  R+ +FGG  + GK+  D++ L  + W+W+ +  K   G   P A   HS TL  +++++FGG   L N   D         N LY+ + + +    +W  P + G +P PR  HS +   L++        KL+++GG      + D+++L++  M +    + G +P PR  H SA +  N+M I GG+         N Q    +     H  +++T  W ++  D   +    PRAGHS +A+++
Sbjct:  178 PSARWGHSLCLIDPQTVILIGGQGHRMTFCKDPIWKLHIENNSWLPAETVATGKTPECRIGHTATFD--SEMRRIYVFGGS-KNGKWFSDMHILDMATWKWQLVEAK---GKVPPLAY--HSSTLFRHELFVFGGVFPLPNPQPDG------CSNQLYIFNPQHS----IWYQPIVVGDLPCPRSGHSMI---LLKN-------KLVIFGGWDAPMCFSDLHVLDLGFMEYAPVQVQGAVPSPRCWHASAPVSDNRMIIHGGY---------NGQ----RALTDTHIFNVDTSEWTQLTSDPFGSV---PRAGHSILALAS 454          

HSP 4 Score: 68.9366 bits (167), Expect = 3.347e-12
Identity = 62/234 (26.50%), Postives = 106/234 (45.30%), Query Frame = 2
Query:  479 SLPCARIGHSLTLIG-NKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFR-YGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLWYLE 1174
            +LP AR GHSL LI    + L GG  +     K       + ++ L I+    + +       G  P  R  H+A          D    ++ V+GG    + + D++IL++ T  W      G++P P + HS+TL  +++++FGG  PL      N Q     C+N ++  + +   W +     D   +P PR+GHS + +  ++ I+ G       W+  +CF DL  L+
Sbjct:  176 ALPSARWGHSLCLIDPQTVILIGGQGHRMTFCK-------DPIWKLHIE--NNSWLPAETVATGKTPECRIGHTATF--------DSEMRRIYVFGGSKNGKWFSDMHILDMATWKWQLVEAKGKVP-PLAYHSSTLFRHELFVFGGVFPL-----PNPQPD--GCSNQLYIFNPQHSIWYQPIVVGD---LPCPRSGHSMILLKNKLVIFGG-------WDAPMCFSDLHVLD 374          

HSP 5 Score: 50.447 bits (119), Expect = 1.819e-6
Identity = 52/228 (22.81%), Postives = 102/228 (44.74%), Query Frame = 2
Query:  137 KWVKVIAATGNSPRARHGHKAVALKELIIIFGG-------GNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGH-SLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSD----------QTQWKLLVYGG 766
            KW +++ A G  P   + H +   +  + +FGG         +G  ++L+ +N   + W+ P + G++P   +   ++    +L++FGG      +S DL+ L     E+  ++ +    G++P  R  H S  +  N+M + GG         +N  R L D ++ ++  ++ T +   P   GS+  PR  HS +A   +   ++          +    LLV+GG
Sbjct:  274 KW-QLVEAKGKVPPLAY-HSSTLFRHELFVFGGVFPLPNPQPDGCSNQLYIFNPQHSIWYQPIVVGDLPCPRSGHSMILLKNKLVIFGGWDAPMCFS-DLHVLDLGFMEYAPVQVQ----GAVPSPRCWHASAPVSDNRMIIHGG---------YNGQRALTDTHIFNVDTSEWTQLTSDPF--GSV--PRAGHSILALASLDGGAEAKREGATGGHEVLSTLLVFGG 481          
BLAST of host cell factor-1 vs. Ensembl Sea Lamprey
Match: KLHDC2 (kelch domain containing 2 [Source:HGNC Symbol;Acc:HGNC:20231])

HSP 1 Score: 72.7886 bits (177), Expect = 1.448e-13
Identity = 68/278 (24.46%), Postives = 119/278 (42.81%), Query Frame = 2
Query:  167 NSPRARHGHKAVALKELIIIFGGGNEGIV---DELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYEL----HASRWEWKKLR---PKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKF-------------NIPR-YLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMH-KFRYGDVYILNVDTMSWTKP-TIGGEIPQPRSLHSATLVG-NKMYIFGGWV 919
            + P  R GH AV     + I    +  +     E+  Y+T T  W    L GE+PP  +    V  + R  MFGG    G  S + Y +        ++W+++     +PP     P  ++G      GNK+  FGG      +A               N+ R + N +++ D++    T  W  P   G+ P PR +H+   +            +  ++GG +   R  D++ LN+D  +W+ P  + GE+P  RS H+ T    ++++++GG+ 
Sbjct:   24 SEPEERSGHVAVFCGTRLFIQADNSVDLYLPSSEMWIYDTETQVWHRRELGGELPPPMSGSCAVCVDRRFYMFGGHHNRGN-SNEFYTMDLCPRGDSYKWERISNYTGQPPS----PKDKLG--CWTHGNKLVFFGGYGYQPREAHRGTFEFDETSLWGPNVSRGWNNHVHIFDLE----TYSWSQPLTTGTPPLPRAAHACATHGN----------RGYLFGGRYLGARMNDLHYLNLDNWAWSGPIAVRGEVPVGRSWHTLTAASDDQLFLYGGFT 280          

HSP 2 Score: 58.9214 bits (141), Expect = 3.141e-9
Identity = 57/249 (22.89%), Postives = 99/249 (39.76%), Query Frame = 2
Query:  413 LYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPS-MKGSIPTPRES------------HSAVAYQLIQQNSDQTQWKLLVYGGMHKFR--YGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVS-TRIYIWSG 1111
            +Y+     W  ++L      GG LP    G     +  + Y+FGG  N             N+ Y +D+     +  WE  S   G  P+P++                  YQ  + +    ++      G +  R     V+I +++T SW++P   G  P PR+ H+    GN+ Y+FGG         R    +     N +H L+L+  +W      A   E+P  R+ H+  A S  +++++ G
Sbjct:   60 IYDTETQVWHRREL------GGELPPPMSGSCAVCVDRRFYMFGGHHNRGNS---------NEFYTMDLCPRGDSYKWERISNYTGQPPSPKDKLGCWTHGNKLVFFGGYGYQPREAHRGTFEFDETSLWGPNVSRGWNNHVHIFDLETYSWSQPLTTGTPPLPRAAHACATHGNRGYLFGG---------RYLGAR----MNDLHYLNLDNWAWSGPI--AVRGEVPVGRSWHTLTAASDDQLFLYGG 278          

HSP 3 Score: 55.0694 bits (131), Expect = 5.338e-8
Identity = 57/240 (23.75%), Postives = 96/240 (40.00%), Query Frame = 2
Query:  458 PKPPRGG---SLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMH-KFRYGDVYILNV----DTMSWTK-PTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQE------------KEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGR 1114
            P+P   G   S P  R GH     G ++++    A++S D    +P   +++++ D +    T +W    + G +P P     AV              +  ++GG H +    + Y +++    D+  W +     G+ P P+        GNK+  FGG+     + +R + E            + W   N VH  DLET SW    +       P PRA H+      R Y++ GR
Sbjct:   14 PEPDDAGQPRSEPEERSGHVAVFCGTRLFI---QADNSVD--LYLPS--SEMWIYDTE----TQVWHRRELGGELPPPMSGSCAVCVDR----------RFYMFGGHHNRGNSNEFYTMDLCPRGDSYKWERISNYTGQPPSPKDKLGCWTHGNKLVFFGGYGYQPREAHRGTFEFDETSLWGPNVSRGWN--NHVHIFDLETYSWS---QPLTTGTPPLPRAAHACATHGNRGYLFGGR 227          
BLAST of host cell factor-1 vs. Ensembl Yeast
Match: KEL2 (Protein that negatively regulates mitotic exit; forms a complex with Kel1p and Bud14p that regulates Bnr1p (formin) to affect actin cable assembly, cytokinesis, and polarized growth; functions in a complex with Kel1p, interacts with Tem1p and Lte1p; localizes to regions of polarized growth; potential Cdc28p substrate [Source:SGD;Acc:S000003470])

HSP 1 Score: 89.3521 bits (220), Expect = 1.959e-18
Identity = 78/276 (28.26%), Postives = 119/276 (43.12%), Query Frame = 2
Query:  146 KVIAATGNSPRARHGHKAVALKELIIIFGGG------NEGIVDELHAYNTLTNQWFVPSLRGEIPPG--CAAFGLVADN---TRLLMFGGMLEYGKYSG----DLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYL-NDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGG--MHKFRYGDVYILNVDTMSWTK-PTIGGEIPQPRSLHSATLVGN-KMYIFGG 913
            K I    N+P  R GH +       ++FGG       N  + D+L+ +N  + +W +P   G  P G       ++A N   T+L +FGG ++   ++     DL         W+ L P     G LP     H++    NK+++FGG            P+ + ND Y  D   ++    W      G  P P + H++V Y+ +          + V GG   H     DVY LN+ ++ W K P +   IPQ RS HS TL+ N K+ I GG
Sbjct:  130 KRIDIDQNTPPPRVGHASTICGNAYVVFGGDTHKLNKNGLLDDDLYLFNINSYKWTIPQPIGRRPLGRYGHKISIIASNPMQTKLYLFGGQVDETYFNDLVVFDLSSFRRPNSHWEFLEP----VGDLPPPLTNHTMVAYDNKLWVFGG----------ETPKTISNDTYRYDPAQSE----WSKVKTTGEKPPPIQEHASVVYKHL----------MCVLGGKDTHNAYSNDVYFLNLLSLKWYKLPRMKEGIPQERSGHSLTLMKNEKLLIMGG 377          

HSP 2 Score: 73.9442 bits (180), Expect = 9.960e-14
Identity = 75/303 (24.75%), Postives = 131/303 (43.23%), Query Frame = 2
Query:  344 LVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLND-LYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGG-MHKFRYGDVYILNVDTMS-----WTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDL----WYLETSLPPSPSKIQLERA 1219
            +V ++ R+ + GG+ +   Y GD++++ A+         +     + P  R+GH+ T+ GN   +FGG     +  K N    L+D LY+ +I + +    W  P   G  P  R  H      +I  N  QT  KL ++GG + +  + D+ + ++ +       W      G++P P + H+     NK+++FGG  P  +             +N  +R D     W +V       E P P   H++V     + +  G+D +  A++N V F +L    WY    LP     I  ER+
Sbjct:   93 IVTNDNRIFVTGGLHDQSVY-GDVWQIAANADGTSFTSKRIDIDQNTPPPRVGHASTICGNAYVVFGG-----DTHKLNKNGLLDDDLYLFNINSYK----WTIPQPIGRRPLGRYGHKI---SIIASNPMQT--KLYLFGGQVDETYFNDLVVFDLSSFRRPNSHWEFLEPVGDLPPPLTNHTMVAYDNKLWVFGGETPKTI-------------SNDTYRYDPAQSEWSKV---KTTGEKPPPIQEHASVVYKHLMCVLGGKDTHN-AYSNDVYFLNLLSLKWY---KLPRMKEGIPQERS 360          

HSP 3 Score: 60.077 bits (144), Expect = 1.768e-9
Identity = 50/174 (28.74%), Postives = 79/174 (45.40%), Query Frame = 2
Query:  131 NPKWVKVIAATGNSPRARHGHKAVALKELIIIFGGGN-EGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGN-KMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMW 646
            N  W + +   G+ P     H  VA    + +FGG   + I ++ + Y+   ++W      GE PP       V     + + GG   +  YS D+Y L+    +W KL P+   G  +P  R GHSLTL+ N K+ + GG   D   A  NI    +DL   +    +GT+++
Sbjct:  241 NSHW-EFLEPVGDLPPPLTNHTMVAYDNKLWVFGGETPKTISNDTYRYDPAQSEWSKVKTTGEKPPPIQEHASVVYKHLMCVLGGKDTHNAYSNDVYFLNLLSLKWYKL-PRMKEG--IPQERSGHSLTLMKNEKLLIMGGDKTDY--ASPNI----HDLQTSETDQGEGTLLY 404          

HSP 4 Score: 58.5362 bits (140), Expect = 4.739e-9
Identity = 78/335 (23.28%), Postives = 137/335 (40.90%), Query Frame = 2
Query:    8 NTYNFFTINFVLINKKNIIQTTIFVYLKF*IIVI*MLTDSINP-KWVKVIAATGNSPRARHGHK-----AVALKELIIIFGGG------NEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGK-YSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGG---------MHKFRYGD--------VYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVP 922
            N Y  F  +   +NK  ++   ++++             +IN  KW  +    G  P  R+GHK     +  ++  + +FGG       N+ +V +L ++    + W      G++PP      +VA + +L +FGG  E  K  S D Y    ++ EW K++      G  P     H+  +  + M + GG   D+ +A      Y ND+Y L++ + +    ++ P MK  IP  R  HS    +           KLL+ GG         +H  +  +        +Y L++ +++   P I  E     SLH+     N +   GG+ P
Sbjct:  152 NAYVVFGGDTHKLNKNGLLDDDLYLF-------------NINSYKWT-IPQPIGRRPLGRYGHKISIIASNPMQTKLYLFGGQVDETYFNDLVVFDLSSFRRPNSHWEFLEPVGDLPPPLTNHTMVAYDNKLWVFGG--ETPKTISNDTYRYDPAQSEWSKVKT----TGEKPPPIQEHASVVYKHLMCVLGG--KDTHNA------YSNDVYFLNLLSLK---WYKLPRMKEGIPQERSGHSLTLMK---------NEKLLIMGGDKTDYASPNIHDLQTSETDQGEGTLLYTLDLSSLNELCPGIMCE-----SLHAGESFSNSLS--GGFTP 439          
BLAST of host cell factor-1 vs. Ensembl Yeast
Match: KEL1 (Protein required for proper cell fusion and cell morphology; forms a complex with Bud14p and Kel2p that regulates Bnr1p (formin) to affect actin cable assembly, cytokinesis, and polarized growth; functions in a complex with Kel2p to negatively regulate mitotic exit, interacts with Tem1p and Lte1p; localizes to regions of polarized growth; potential Cdc28p substrate [Source:SGD;Acc:S000001201])

HSP 1 Score: 73.1738 bits (178), Expect = 1.704e-13
Identity = 76/273 (27.84%), Postives = 114/273 (41.76%), Query Frame = 2
Query:  170 SPRARHGHKAVALKELIIIFGG-----GNEGIV-DELHAYNTLTNQWFVPSLRGEIPPG-----CAAFGLVADNTRLLMFGGMLEYGKYSGDL--YELHASRW---EWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFG-----GLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGM--HKFRYGDVYILNVDTMSWTK-PTIGGEIPQPRSLHSATLVGN-KMYIFGG 913
            +P  R GH AV      ++FGG       EG++ D+++  N  + +W VP+  G  P G      +        T+L +FGG  +   Y  DL  Y+L + R     W+ L+P+       P      ++    +K+++FG     GL ND     F     +ND +++D                G  P P + H+ V Y  +          + V GG   H      VY LN+ +  W K P     IPQ RS HS TL+ N K+ I GG
Sbjct:  178 TPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMDDDIYLLNINSYKWTVPAPVGPRPLGRYGHKISIIATTQMKTKLYVFGGQFD-DTYFNDLAVYDLSSFRRPDSHWEFLKPR----TFTPPPITNFTMISYDSKLWVFGGDTLQGLVNDV----FMYDPAINDWFIID--------------TTGEKPPPVQEHATVVYNDL----------MCVVGGKDEHDAYLNSVYFLNLKSRKWFKLPVFTAGIPQGRSGHSLTLLKNDKILIMGG 417          

HSP 2 Score: 72.7886 bits (177), Expect = 2.372e-13
Identity = 46/144 (31.94%), Postives = 70/144 (48.61%), Query Frame = 2
Query:  224 IFGGGN-EGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGN-KMYLFGGLANDSEDAKFNIPRYLN-DLYVLDIKAAQGTMMW 646
            +FGG   +G+V+++  Y+   N WF+    GE PP       V  N  + + GG  E+  Y   +Y L+    +W KL   P     +P  R GHSLTL+ N K+ + GG        KF+  R    DL+  DI   +GT+++
Sbjct:  311 VFGGDTLQGLVNDVFMYDPAINDWFIIDTTGEKPPPVQEHATVVYNDLMCVVGGKDEHDAYLNSVYFLNLKSRKWFKL---PVFTAGIPQGRSGHSLTLLKNDKILIMGG-------DKFDYARVEEYDLHTSDIDMQRGTIVY 444          

HSP 3 Score: 53.1434 bits (126), Expect = 2.646e-7
Identity = 63/247 (25.51%), Postives = 103/247 (41.70%), Query Frame = 2
Query:  137 KWVKVIAATGNSPRARHGHK-----AVALKELIIIFGGG------NEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDV--YILNVDTMSWTKPTI 838
            KW  V A  G  P  R+GHK        +K  + +FGG       N+  V +L ++    + W     R   PP    F +++ +++L +FGG    G    D++    +  +W  +       G  P     H+  +  + M + GG   D  DA      YLN +Y L++K+ +    ++ P     IP  R  HS     L++ +      K+L+ GG  KF Y  V  Y L+   +   + TI
Sbjct:  223 KWT-VPAPVGPRPLGRYGHKISIIATTQMKTKLYVFGGQFDDTYFNDLAVYDLSSFRRPDSHWEFLKPRTFTPPPITNFTMISYDSKLWVFGGDTLQG-LVNDVFMYDPAINDWFII----DTTGEKPPPVQEHATVVYNDLMCVVGG--KDEHDA------YLNSVYFLNLKSRK---WFKLPVFTAGIPQGRSGHSLT---LLKND------KILIMGG-DKFDYARVEEYDLHTSDIDMQRGTI 442          

HSP 4 Score: 52.7582 bits (125), Expect = 3.412e-7
Identity = 52/186 (27.96%), Postives = 79/186 (42.47%), Query Frame = 2
Query:  641 MWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMH-KFRYGDVYIL----NVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRP--RAGH-----SAVAVSTRIYIWSGRDGYRKAWNNQVCFKDL 1162
            +W    ++ S P PR  H A AY      +D+ Q  + V GG+H +  YGD +IL    N    S T   I    P PR  H+A L GN   +FGG    V         KE    + ++ L++ +  W            PRP  R GH     +   + T++Y++ G+  +   + N +   DL
Sbjct:  112 VWNRIKLQNS-PFPRYRHVASAYV-----TDKNQ--IYVIGGLHDQSVYGDTWILTAFDNATRFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKV--------NKEGLMDDDIYLLNINSYKWTVPAPVG-----PRPLGRYGHKISIIATTQMKTKLYVFGGQ--FDDTYFNDLAVYDL 274          

HSP 5 Score: 50.8322 bits (120), Expect = 1.300e-6
Identity = 71/294 (24.15%), Postives = 123/294 (41.84%), Query Frame = 2
Query:  332 AAFGLVADNTRLLMFGGMLEYGKYSGDLYEL----HASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYL-NDLYVLDIKAAQGTMMWETPSMKGSIPTPRESH--SAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNV---DTMSWTKPTIGGEIPQPRS-----LHSATLVG--NKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDL 1162
             A   V D  ++ + GG+ +   Y GD + L    +A+R+    +        + P  R+GH+  L GN   +FGG     +  K N    + +D+Y+L+I + +    W  P+  G  P  R  H  S +A       + Q + KL V+GG    ++ D Y  ++   D  S+ +P    E  +PR+     + + T++   +K+++FGG     L              N V   D     W  +       E P P   H+ V  +  + +  G+D +  A+ N V F +L
Sbjct:  129 VASAYVTDKNQIYVIGGLHDQSVY-GDTWILTAFDNATRFSTTTIDI----SEATPPPRVGHAAVLCGNAFVVFGG-----DTHKVNKEGLMDDDIYLLNINSYK----WTVPAPVGPRPLGRYGHKISIIA-------TTQMKTKLYVFGG----QFDDTYFNDLAVYDLSSFRRPDSHWEFLKPRTFTPPPITNFTMISYDSKLWVFGGDTLQGL-------------VNDVFMYDPAINDWFII---DTTGEKPPPVQEHATVVYNDLMCVVGGKDEH-DAYLNSVYFLNL 380          
BLAST of host cell factor-1 vs. Ensembl Yeast
Match: KEL3 (Cytoplasmic protein of unknown function [Source:SGD;Acc:S000006184])

HSP 1 Score: 59.3066 bits (142), Expect = 2.271e-9
Identity = 68/313 (21.73%), Postives = 127/313 (40.58%), Query Frame = 2
Query:  116 LTDSINPKWVKV-IAATGNSPRARHGHKAVALKELIIIFGG------GNEGIVDELHAYNTLTNQW----------------FVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHAS----RWEWKKLRPKPPRGGSLPCARIGHSLTL-IGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLL-------------------VYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGG 913
            L D +  K+ K+      +SP AR GH+ +A K   I+FGG      G    +++L  ++  T +W                F+P+    I  G     ++A N + LM G +L       D ++L+ +    +W+W+KL+       + P  R+G+S  L   NK   FGG+ +  E  +     + NDLY+  ++  +    W    +K    T  ++  A + +   ++ ++    LL                      G +     +    + D  +    TI  ++P PR   +  +VG+ ++I+ G
Sbjct:  174 LFDCVERKFTKLEFGGRDSSPSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWTKLETNSKPDARSGHCFIPTDNSAILMGGYC-KIIAKNNKNLMKGKIL------NDAWKLNLTPDPKKWQWEKLK----NFKNQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFHLELNK----WSKLRIKPQRQTNSKNSPATSKRKSNKDQEKELQDLLNSILAKSNLNDDDDDNDDNSTTGPNSIDDDEDNEDDSDLDNQEDITISNQLPHPRFNAATCVVGDSLFIYSG 471          
BLAST of host cell factor-1 vs. Ensembl Nematostella
Match: EDO49657 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFT3])

HSP 1 Score: 504.597 bits (1298), Expect = 1.652e-169
Identity = 236/396 (59.60%), Postives = 312/396 (78.79%), Query Frame = 2
Query:  137 KWVKVIAATGNSPRARHGHKAVALKELIIIFGGGNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSL--PCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQ-EKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLWYLETSLPPSPSKIQLERAHDESLELTCNPVPTADYYMLQIRIYHIPQSNS 1315
            KW K+  +TG  PR RHGH+AVA++EL+++FGGGNEGIVDELH YNT TNQWFVP++RG+IPPGCAA+G + D TRL++FGGM+EYG+YS ++YEL ASRWEWKKL+PKPP+   +  PC R+GHS TLIG+K YLF GLANDS+D K NIPRYLNDLY++D++    ++ WE P   G+IP+PRESH+ VA+     +SD  + +L+VYGGM   R GD+Y L++D+M W+KPT+ G +P PRSLHSAT  G+KMY+FGGWVPLV+DD + +Q EKEWKCTNS+  L+++T++W+ +  D  +  +PR RAGH +V++STR+YIWSGRDGYRKAWNNQVC KDLW+LET  PP+PS++QL RA   +LE+    V TAD Y+LQ++ Y +P + S
Sbjct:    6 KWKKITNSTGPMPRPRHGHRAVAIRELMVVFGGGNEGIVDELHVYNTATNQWFVPAVRGDIPPGCAAYGFICDGTRLILFGGMVEYGRYSNEMYELQASRWEWKKLKPKPPKTAGVPPPCPRLGHSFTLIGHKAYLFAGLANDSDDPKNNIPRYLNDLYIIDVR-PNSSLHWECPQTFGTIPSPRESHTCVAH----THSDGKKARLIVYGGMSGCRLGDLYQLDIDSMVWSKPTVKGAVPLPRSLHSATTCGSKMYVFGGWVPLVIDDVKGTQHEKEWKCTNSLACLNMDTMTWENITVDQYDESIPRARAGHCSVSMSTRLYIWSGRDGYRKAWNNQVCCKDLWFLETEKPPAPSRVQLVRASTTTLEVCWGSVSTADAYILQLQKYELPPAPS 396          
BLAST of host cell factor-1 vs. Ensembl Nematostella
Match: EDO27574 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T8W0])

HSP 1 Score: 203.756 bits (517), Expect = 1.960e-58
Identity = 88/142 (61.97%), Postives = 115/142 (80.99%), Query Frame = 2
Query:  815 MSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQ-EKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLWYLETSLPPSPSKIQLERAHDESLE 1237
            M W+KPT+ G +P PRSLHSAT  G+KMY+FGGWVPLV+DD + +Q EKEWKCTNS+  L+++T++W+ +  D  +  +PR RAGH +V++STR+YIWSGRDGYRKAWNNQVC KDLW+LET  PP+PS++QL RA   +LE
Sbjct:    2 MVWSKPTVKGAVPLPRSLHSATTCGSKMYVFGGWVPLVIDDVKGTQHEKEWKCTNSLACLNMDTMTWENITVDQYDESIPRARAGHCSVSMSTRLYIWSGRDGYRKAWNNQVCCKDLWFLETEKPPAPSRVQLVRASTTTLE 143          

HSP 2 Score: 100.523 bits (249), Expect = 6.656e-23
Identity = 50/106 (47.17%), Postives = 67/106 (63.21%), Query Frame = 2
Query: 2750 GAQLSWEPPHNCH-NISEYSIYLAVKNNNPSSGQQNKG-------------FTFIRVYCGQEPKAIVTASFLTQAHLDNSSKPAVIFRIAARNELGYGPATQVRWL 3025
            GA LSWE P N   N++EYS+YLA+++   ++G   K                F+RVYCG +P   V+ + L  AH+D S+K A+IFRIAA+N+ GYGPATQVRWL
Sbjct:  191 GAHLSWEAPSNASGNVTEYSVYLAIRSQ--AAGHDIKDVAALSNPPNAPVQLAFVRVYCGAQPTCTVSLATLQSAHIDYSTKAAIIFRIAAKNDKGYGPATQVRWL 294          
BLAST of host cell factor-1 vs. Ensembl Nematostella
Match: EDO49658 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFT4])

HSP 1 Score: 184.111 bits (466), Expect = 3.291e-53
Identity = 95/198 (47.98%), Postives = 122/198 (61.62%), Query Frame = 2
Query: 2474 WYDALITTQPKFTVTSYFAIPNTTGMPNLSLINETESEGLRVNLTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAIKVVKVRNGAQLSWEPPHNCH-NISEYSIYLAVKNNNPSSGQQNKG-------------FTFIRVYCGQEPKAIVTASFLTQAHLDNSSKPAVIFRIAARNELGYGPATQVRWL 3025
            WYD  I       VT Y      T    + +++  ++   R+ L PGTAYK RVAAIN CGRGP+S+  AFKT LPGFPGAPSAIK+ K   GA LSWE P N   N++EYS+YLA+++   ++G   K                F+RVYCG +P   V+ + L  AH+D S+K A+IFRIAA+N+ GYGPATQVRWL
Sbjct:    1 WYDVGIVKTTSMLVTHYHLASENTNK-EIDVVSTEQTSTKRLELQPGTAYKFRVAAINVCGRGPFSDVSAFKTCLPGFPGAPSAIKISKNTEGAHLSWEAPSNASGNVTEYSVYLAIRSQ--AAGHDIKDVAALSNPPNAPVQLAFVRVYCGAQPTCTVSLATLQSAHIDYSTKAAIIFRIAAKNDKGYGPATQVRWL 195          
BLAST of host cell factor-1 vs. Ensembl Nematostella
Match: EDO29541 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T3C4])

HSP 1 Score: 120.939 bits (302), Expect = 1.518e-31
Identity = 67/119 (56.30%), Postives = 89/119 (74.79%), Query Frame = 2
Query:  410 DLYELHASRWEWKKLRPKPPRGGSLP--CARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVY 760
            ++YEL ASRWEWKKL+PKPP+   +P  C R+GHS TLIG+K YLF GLANDS+D K NIPRYLNDLY++D++    ++ WE P   G+IP+PRESH+ VA+     +SD  + +L+VY
Sbjct:   55 EMYELQASRWEWKKLKPKPPKTAGVPPPCPRLGHSFTLIGHKAYLFAGLANDSDDPKNNIPRYLNDLYIIDVR-PNSSLHWECPQTFGTIPSPRESHTCVAH----THSDGKKARLIVY 168          
BLAST of host cell factor-1 vs. Ensembl Nematostella
Match: EDO34324 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPL1])

HSP 1 Score: 111.309 bits (277), Expect = 4.902e-25
Identity = 78/283 (27.56%), Postives = 123/283 (43.46%), Query Frame = 2
Query:  116 LTDSINPKWVKVIAATGNSPRARHGHKAVALKELIIIFGG-------GNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSED-------AKFNIPRYLNDLYVLDIKAAQGTMMWET--PSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKF-RYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGG 913
            L + +  +W +       SPR   GH A ++   + +FGG       G    ++E+  Y+  +  W  P  RG+ P   ++  + +    L MFGG+     +  DLY  +    +WK +  K    G+ P  R       +G KM +FGG     +D       A+F    + ND++  D +     + W+    +  GS PTPR +H   A            +K++++GG     R  D +ILN + M W      G  P PRS HS   VGN+M +FGG
Sbjct:   15 LLNDVKVEWKRSGKDCVYSPR--DGHCAASVGSKLYVFGGVAWNVTIGEVSEMNEMLVYDLESQTWSKPVTRGDTPSSRSSATMCSVGNTLFMFGGLSRDSGWLNDLYAFNTDSMQWKAIEAK----GTYPSPRDKLGSVAMGTKMLIFGGFGPKEDDEMAGPGEAEFT---WFNDIFAFDTE----NLTWKKFMVTTVGS-PTPRAAHCMCA----------VGFKVVIFGGKDSIARRHDTHILNTENMKWETVKTSGRQPSPRSFHSCAAVGNRMVVFGG 273          

HSP 2 Score: 93.9745 bits (232), Expect = 1.457e-19
Identity = 78/299 (26.09%), Postives = 132/299 (44.15%), Query Frame = 2
Query:  329 CAAFGLVADNTRLLMFGGM---LEYGKYSGD----LYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGM-------------HKFR-YGDVYILNVDTMSWTK---PTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCF 1153
            CAA    +  ++L +FGG+   +  G+ S      +Y+L +  W       KP   G  P +R   ++  +GN +++FGGL+ DS         +LNDLY  +      +M W+    KG+ P+PR+   +VA             K+L++GG               +F  + D++  + + ++W K    T+G   P PR+ H    VG K+ IFGG         ++S  +     +  H L+ E + W+ V         P PR+ HS  AV  R+ ++ GR    + +N+   F
Sbjct:   39 CAA----SVGSKLYVFGGVAWNVTIGEVSEMNEMLVYDLESQTWS------KPVTRGDTPSSRSSATMCSVGNTLFMFGGLSRDS--------GWLNDLYAFNTD----SMQWKAIEAKGTYPSPRDKLGSVAMGT----------KMLIFGGFGPKEDDEMAGPGEAEFTWFNDIFAFDTENLTWKKFMVTTVGS--PTPRAAHCMCAVGFKVVIFGG---------KDSIARR----HDTHILNTENMKWETV---KTSGRQPSPRSFHSCAAVGNRMVVFGGRGLANQHFNDLHIF 287          

HSP 3 Score: 92.8189 bits (229), Expect = 3.372e-19
Identity = 58/210 (27.62%), Postives = 94/210 (44.76%), Query Frame = 2
Query:  494 RIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFR--YGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGRD 1117
            R GH    +G+K+Y+FGG+A +    + +    +N++ V D++    +  W  P  +G  P+ R S +  +              L ++GG+ +      D+Y  N D+M W      G  P PR    +  +G KM IFGG+ P   D+     E E+   N +   D E L+W +          P PRA H   AV  ++ I+ G+D
Sbjct:   35 RDGHCAASVGSKLYVFGGVAWNVTIGEVS---EMNEMLVYDLE----SQTWSKPVTRGDTPSSRSSATMCS----------VGNTLFMFGGLSRDSGWLNDLYAFNTDSMQWKAIEAKGTYPSPRDKLGSVAMGTKMLIFGGFGPKEDDEMAGPGEAEFTWFNDIFAFDTENLTWKKFM--VTTVGSPTPRAAHCMCAVGFKVVIFGGKD 225          

HSP 4 Score: 53.9138 bits (128), Expect = 3.639e-7
Identity = 58/220 (26.36%), Postives = 97/220 (44.09%), Query Frame = 2
Query:  119 TDSINPKWVKVIAATGNSPRARHGHKAVALKELIIIFGGGNEGIVDEL--------------HAYNTLTNQW--FVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFG--GLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQ 724
            TDS+  +W K I A G  P  R    +VA+   ++IFGG      DE+               A++T    W  F+ +  G   P  AA  + A   ++++FGG     +   D + L+    +W+ ++      G  P  R  HS   +GN+M +FG  GLAN          ++ NDL++ D+     +  + + +MK  +  P  S   V ++L+ Q
Sbjct:  124 TDSM--QW-KAIEAKGTYPSPRDKLGSVAMGTKMLIFGGFGPKEDDEMAGPGEAEFTWFNDIFAFDTENLTWKKFMVTTVGSPTPR-AAHCMCAVGFKVVIFGGKDSIARRH-DTHILNTENMKWETVKTS----GRQPSPRSFHSCAAVGNRMVVFGGRGLAN----------QHFNDLHIFDVAMLSASADF-SEAMK-DVYEPDWSGRDVVFKLLDQ 322          
BLAST of host cell factor-1 vs. Ensembl Medaka
Match: hcfc1a (host cell factor C1 [Source:NCBI gene;Acc:101157935])

HSP 1 Score: 544.273 bits (1401), Expect = 1.913e-169
Identity = 233/392 (59.44%), Postives = 305/392 (77.81%), Query Frame = 2
Query:  128 INPKWVKVIAATGNSPRARHGHKAVALKELIIIFGGGNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNR-NSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLWYLETSLPPSPSKIQLERAHDESLELTCNPVPTADYYMLQIRIYHI 1300
            + P+W +V+  +G  PR RHGH+AVA+KEL+++FGGGNEGIVDELH YNT TNQWF+P++RG+IPPGCAA+G V D TRLL+FGGM+EYGKYS DLYEL ASRWEWKKL+ K P+ G  PC R+GHS +L+GNK YLFGGLANDSED K NIPRYLNDLY L+++     + W+ P   G +P PRESH+AV Y   ++ S ++  +L++YGGM   R GD++ L+++T++W KP +GG  P PRSLHSAT + NKMY+FGGWVPLV+DD +  + EKEWKCTN++  L+L+++ W+ V  D  E  +PR RAGH AVA+++R+Y+WSGRDGYRKAWNNQVC KDLWYLET  P +P+++QL RA+  SLE++   V TAD Y+LQ++ Y I
Sbjct:   16 LQPRWKRVLGWSGPVPRPRHGHRAVAIKELMVVFGGGNEGIVDELHVYNTATNQWFIPAVRGDIPPGCAAYGFVCDGTRLLVFGGMVEYGKYSNDLYELQASRWEWKKLKAKNPKNGPPPCPRLGHSFSLVGNKCYLFGGLANDSEDPKNNIPRYLNDLYTLELRPGSSVVGWDIPITYGVLPPPRESHTAVVY--TEKTSRKS--RLIIYGGMSGCRLGDLWTLDIETLTWNKPAVGGTAPLPRSLHSATTITNKMYVFGGWVPLVMDDVKVATHEKEWKCTNTLACLNLDSMCWETVLMDTLEDNIPRARAGHCAVAINSRLYVWSGRDGYRKAWNNQVCCKDLWYLETERPHAPARVQLVRANTNSLEVSWGAVSTADTYLLQLQKYDI 403          

HSP 2 Score: 184.882 bits (468), Expect = 7.866e-47
Identity = 93/187 (49.73%), Postives = 121/187 (64.71%), Query Frame = 2
Query: 2474 WYDALITTQPKFTVTSYFAIPNTTGMPNLSLINETESEGLRVNLTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAIKVVKVRNGAQLSWEPPH-NCHNISEYSIYLAVKNNNPSSGQQNK--GFTFIRVYCGQEPKAIVTASFLTQAHLDNSSKPAVIFRIAARNELGYGPATQVRWL 3025
            W+D  I       VT ++   + +   + S I    S+  ++ L PGTAYK RVA IN CGRG +SE  AFKT LPGFPGAP AIK+ K  +GA L+WEPP      I EYS+YLA+++N  +  + +      F+RVYCG  P  +V +S L+ AH+D ++KPA+IFRIAARNE GYGPATQVRWL
Sbjct: 1470 WFDVGIVKVTNMVVTHFYVPADDSQGDDDSGIVPDYSQMKKMELQPGTAYKFRVAGINACGRGSFSEISAFKTCLPGFPGAPCAIKISKSPDGAHLTWEPPSVTSGKIIEYSVYLAIQSNQTAEAKASSPAQLAFMRVYCGPNPSCLVQSSSLSNAHIDYTTKPAIIFRIAARNEKGYGPATQVRWL 1656          
BLAST of host cell factor-1 vs. Ensembl Medaka
Match: hcfc2 (host cell factor C2 [Source:NCBI gene;Acc:101161597])

HSP 1 Score: 450.669 bits (1158), Expect = 2.375e-143
Identity = 210/410 (51.22%), Postives = 273/410 (66.59%), Query Frame = 2
Query:  113 MLTDSINPKWVKVIAATGNSPRARHGHKAVALKELIIIFGGGNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRV------------------CEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLWYLETSLPPSPSKIQLERAHDESLELTCNPVPTADYYMLQIR 1288
            M T    P+W KV + TG  PR+RHGH+A A++ELI++FGGGNEGI ++LH YNT++ QWF+P++RG+IPPGCAA GLV + TR+L+FGGM+EYG+Y+  +YEL ASRW WKKL+P+ PR G+ PC RIGHS TL+GNK YLFGG+ANDSED   N+PRYL+DLY L+++   G   W  P  KGS P  RESH+AVAY  +         KL ++GGM   R  D++ L++D+M W+ P   G    PRSLHSA ++GNKMYIFGGWVP            +W CTNS+  L+L+ + W  +                  C+D   A  PR RAGH + AV +R+Y+WSGRDGYRK+WN QVC KDLWYLET LP +P  + L ++    L +   PV  AD Y+LQIR
Sbjct:    1 MSTRVEEPQWRKVHSVTGVIPRSRHGHRAAAIRELILVFGGGNEGIAEDLHVYNTVSKQWFLPAVRGDIPPGCAAHGLVCEGTRVLIFGGMVEYGRYTNSVYELQASRWLWKKLKPRAPRNGAAPCPRIGHSFTLVGNKCYLFGGMANDSEDPNGNVPRYLDDLYELELQTLSGARAWNIPEAKGSAPPARESHTAVAYSGLGSP------KLYIFGGMQGNRLNDIWQLDLDSMVWSTPEPKGPPSLPRSLHSANVIGNKMYIFGGWVPAPESQRHTDSAVKWVCTNSLSVLNLDAMCWQNLGPEHQEDVESQLQSQGPACDDP-YACRPRARAGHCSTAVGSRLYVWSGRDGYRKSWNYQVCCKDLWYLETDLPAAPEAVMLIKSTVSMLHVAWRPVAAADCYILQIR 403          

HSP 2 Score: 142.124 bits (357), Expect = 3.600e-34
Identity = 71/147 (48.30%), Postives = 97/147 (65.99%), Query Frame = 2
Query: 2594 RVNLTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAIKVVKVRNGAQLSWEPPHN-CHNISEYSIYLAVKNNNPSSGQQNKGFTFIRVYCGQEPKAIVTASFLTQAHLDNSS--KPAVIFRIAARNELGYGPATQVRWL 3025
            R  L PG AY+ RVA IN  G+G +S    FKT  PGFPGAPSA+++ K  +  Q++WE P +    I EYS+YLAVK N  +  ++     FIR+Y G +    V +S L  AH+D+S+  +PA++FRIAA+NE GYGPATQ+RW+
Sbjct:  585 RRELLPGQAYRFRVAGINCFGQGDFSPCSEFKTCQPGFPGAPSAVRISKASDSVQITWEAPSSPSGRILEYSMYLAVKKNRSACSERPGQMAFIRIYRGTKTSCSVNSSNLENAHIDSSASNRPAIVFRIAAKNEQGYGPATQIRWI 731          
BLAST of host cell factor-1 vs. Ensembl Medaka
Match: klhdc3 (kelch domain containing 3 [Source:NCBI gene;Acc:101171027])

HSP 1 Score: 102.449 bits (254), Expect = 6.058e-23
Identity = 74/254 (29.13%), Postives = 120/254 (47.24%), Query Frame = 2
Query:  173 PRARHGHKAVALKELIIIFGGGN--EGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGK-YSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMW-ETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMH---KFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGG 913
            P  R+GH AV L++ I ++GG N  EG  + L+A++  T++W+ P + G +P              + +FGG  +    +S D+++L  +   W  +  K    GS    R  HS T+IG KM++FGG A+       N   Y N + V D +    T  W  TP+ + S P  R SHSA  Y+           +L ++GG +      + D++  N +   W K    G+ P  R      +VG+++ +FGG
Sbjct:   74 PYMRYGHTAVLLEDTIFLWGGRNDTEGACNVLYAFDVNTHRWYTPKVSGTVPGARDGHSACVLGKSMYIFGGYEQLADCFSNDIHKLDTTAMVWSLINAK----GSPARWRDFHSATIIGAKMFVFGGRADRFGPFHSNNEIYCNKIKVFDTE----TNCWLSTPTTQPS-PEGRRSHSAFCYKG----------ELYIFGGYNARLDRHFNDLWKFNPEAFMWKKIEPKGKGPCSRRRQCCCMVGDRIILFGG 308          

HSP 2 Score: 84.3445 bits (207), Expect = 6.591e-17
Identity = 77/284 (27.11%), Postives = 114/284 (40.14%), Query Frame = 2
Query:  347 VADNTRLLMFGGMLEYGKYSG----DLYELHASRWEWKKLRP----KPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFR---YGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLW 1165
            VA   ++  FGG      Y      D++  +     W KL P       R   +P  R GH+  L+ + ++L+GG  ND+E A        N LY  D+     T  W TP + G++P  R+ HSA                + ++GG  +       D++ L+   M W+     G   + R  HSAT++G KM++FGG        + N+   E  C N +   D ET  W            P  R  HSA      +YI+    GY    +    F DLW
Sbjct:   20 VAVGHKVYSFGGYCSGEDYETLRQIDVHVFNTVSLRWTKLPPVKTVAHQRAREVPYMRYGHTAVLLEDTIFLWGG-RNDTEGA-------CNVLYAFDVN----THRWYTPKVSGTVPGARDGHSACVLGK----------SMYIFGGYEQLADCFSNDIHKLDTTAMVWSLINAKGSPARWRDFHSATIIGAKMFVFGGRADRFGPFHSNN---EIYC-NKIKVFDTETNCW---LSTPTTQPSPEGRRSHSAFCYKGELYIFG---GYNARLDRH--FNDLW 269          

HSP 3 Score: 71.633 bits (174), Expect = 1.140e-12
Identity = 85/338 (25.15%), Postives = 134/338 (39.64%), Query Frame = 2
Query:  173 PRARHGHKAVALKELIIIFGGGNEGIVDE------LHAYNTLTNQWF-VPSLRG-------EIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYG------DVY-----ILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSG 1111
            PR R  H AVA+   +  FGG   G   E      +H +NT++ +W  +P ++        E+P        V     + ++GG  +       LY    +   W      P   G++P AR GHS  ++G  MY+FGG    ++        + ND++ LD  A    M+W   + KGS    R+ HSA               K+ V+GG    R+G      ++Y     + + +T  W         P+ R  HSA     ++YIFGG+    LD + N     WK        + E   W ++     + + P  R       V  RI ++ G
Sbjct:   12 PR-RVNHAAVAVGHKVYSFGGYCSGEDYETLRQIDVHVFNTVSLRWTKLPPVKTVAHQRAREVPYMRYGHTAVLLEDTIFLWGGRNDTEGACNVLYAFDVNTHRWYT----PKVSGTVPGARDGHSACVLGKSMYIFGGYEQLADC-------FSNDIHKLDTTA----MVWSLINAKGSPARWRDFHSATIIGA----------KMFVFGGRAD-RFGPFHSNNEIYCNKIKVFDTETNCWLSTPTTQPSPEGRRSHSAFCYKGELYIFGGYNAR-LDRHFNDL---WK-------FNPEAFMWKKI---EPKGKGPCSRRRQCCCMVGDRIILFGG 308          

HSP 4 Score: 70.8626 bits (172), Expect = 1.728e-12
Identity = 55/217 (25.35%), Postives = 98/217 (45.16%), Query Frame = 2
Query:  494 RIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKG-------SIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFR--YGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKC-TNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGR 1114
            R+ H+   +G+K+Y FGG  +  +   +   R + D++V +  + + T +   P +K         +P  R  H+AV   L++         + ++GG +        +Y  +V+T  W  P + G +P  R  HSA ++G  MYIFGG+  L              C +N +H+LD   + W  +      A   R R  HSA  +  +++++ GR
Sbjct:   14 RVNHAAVAVGHKVYSFGGYCSGED---YETLRQI-DVHVFNTVSLRWTKL---PPVKTVAHQRAREVPYMRYGHTAV---LLEDT-------IFLWGGRNDTEGACNVLYAFDVNTHRWYTPKVSGTVPGARDGHSACVLGKSMYIFGGYEQLA------------DCFSNDIHKLDTTAMVWSLINAKGSPA---RWRDFHSATIIGAKMFVFGGR 198          

HSP 5 Score: 59.3066 bits (142), Expect = 1.145e-8
Identity = 39/154 (25.32%), Postives = 68/154 (44.16%), Query Frame = 2
Query:  149 VIAATGNSPRARHGHKAVALKELIIIFGG----------GNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGM-LEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKF 577
            +I A G+  R R  H A  +   + +FGG           NE   +++  ++T TN W         P G  +         L +FGG      ++  DL++ +   + WKK+ PK    G  PC+R      ++G+++ LFGG ++ +   +F
Sbjct:  169 LINAKGSPARWRDFHSATIIGAKMFVFGGRADRFGPFHSNNEIYCNKIKVFDTETNCWLSTPTTQPSPEGRRSHSAFCYKGELYIFGGYNARLDRHFNDLWKFNPEAFMWKKIEPK----GKGPCSRRRQCCCMVGDRIILFGGTSSRAAVLQF 318          
BLAST of host cell factor-1 vs. Ensembl Medaka
Match: klhdc3 (kelch domain containing 3 [Source:NCBI gene;Acc:101171027])

HSP 1 Score: 102.834 bits (255), Expect = 7.787e-23
Identity = 75/258 (29.07%), Postives = 121/258 (46.90%), Query Frame = 2
Query:  173 PRARHGHKAVALKELIIIFGGGN--EGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGK-YSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMW-ETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMH---KFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPL 925
            P  R+GH AV L++ I ++GG N  EG  + L+A++  T++W+ P + G +P              + +FGG  +    +S D+++L  +   W  +  K    GS    R  HS T+IG KM++FGG A+       N   Y N + V D +    T  W  TP+ + S P  R SHSA  Y+           +L ++GG +      + D++  N +   W K    G+ P  R      +VG+++ +FGG  P 
Sbjct:   74 PYMRYGHTAVLLEDTIFLWGGRNDTEGACNVLYAFDVNTHRWYTPKVSGTVPGARDGHSACVLGKSMYIFGGYEQLADCFSNDIHKLDTTAMVWSLINAK----GSPARWRDFHSATIIGAKMFVFGGRADRFGPFHSNNEIYCNKIKVFDTE----TNCWLSTPTTQPS-PEGRRSHSAFCYK----------GELYIFGGYNARLDRHFNDLWKFNPEAFMWKKIEPKGKGPCSRRRQCCCMVGDRIILFGGTSPC 312          

HSP 2 Score: 85.1149 bits (209), Expect = 6.562e-17
Identity = 77/284 (27.11%), Postives = 114/284 (40.14%), Query Frame = 2
Query:  347 VADNTRLLMFGGMLEYGKYSG----DLYELHASRWEWKKLRP----KPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFR---YGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLW 1165
            VA   ++  FGG      Y      D++  +     W KL P       R   +P  R GH+  L+ + ++L+GG  ND+E A        N LY  D+     T  W TP + G++P  R+ HSA                + ++GG  +       D++ L+   M W+     G   + R  HSAT++G KM++FGG        + N+   E  C N +   D ET  W            P  R  HSA      +YI+    GY    +    F DLW
Sbjct:   20 VAVGHKVYSFGGYCSGEDYETLRQIDVHVFNTVSLRWTKLPPVKTVAHQRAREVPYMRYGHTAVLLEDTIFLWGG-RNDTEGA-------CNVLYAFDVN----THRWYTPKVSGTVPGARDGHSACVLGK----------SMYIFGGYEQLADCFSNDIHKLDTTAMVWSLINAKGSPARWRDFHSATIIGAKMFVFGGRADRFGPFHSNN---EIYC-NKIKVFDTETNCW---LSTPTTQPSPEGRRSHSAFCYKGELYIFG---GYNARLDRH--FNDLW 269          

HSP 3 Score: 71.633 bits (174), Expect = 1.386e-12
Identity = 85/338 (25.15%), Postives = 134/338 (39.64%), Query Frame = 2
Query:  173 PRARHGHKAVALKELIIIFGGGNEGIVDE------LHAYNTLTNQWF-VPSLRG-------EIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYG------DVY-----ILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSG 1111
            PR R  H AVA+   +  FGG   G   E      +H +NT++ +W  +P ++        E+P        V     + ++GG  +       LY    +   W      P   G++P AR GHS  ++G  MY+FGG    ++        + ND++ LD  A    M+W   + KGS    R+ HSA               K+ V+GG    R+G      ++Y     + + +T  W         P+ R  HSA     ++YIFGG+    LD + N     WK        + E   W ++     + + P  R       V  RI ++ G
Sbjct:   12 PR-RVNHAAVAVGHKVYSFGGYCSGEDYETLRQIDVHVFNTVSLRWTKLPPVKTVAHQRAREVPYMRYGHTAVLLEDTIFLWGGRNDTEGACNVLYAFDVNTHRWYT----PKVSGTVPGARDGHSACVLGKSMYIFGGYEQLADC-------FSNDIHKLDTTA----MVWSLINAKGSPARWRDFHSATIIGA----------KMFVFGGRAD-RFGPFHSNNEIYCNKIKVFDTETNCWLSTPTTQPSPEGRRSHSAFCYKGELYIFGGYNAR-LDRHFNDL---WK-------FNPEAFMWKKI---EPKGKGPCSRRRQCCCMVGDRIILFGG 308          

HSP 4 Score: 70.4774 bits (171), Expect = 3.292e-12
Identity = 55/217 (25.35%), Postives = 98/217 (45.16%), Query Frame = 2
Query:  494 RIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKG-------SIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFR--YGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKC-TNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGR 1114
            R+ H+   +G+K+Y FGG  +  +   +   R + D++V +  + + T +   P +K         +P  R  H+AV   L++         + ++GG +        +Y  +V+T  W  P + G +P  R  HSA ++G  MYIFGG+  L              C +N +H+LD   + W  +      A   R R  HSA  +  +++++ GR
Sbjct:   14 RVNHAAVAVGHKVYSFGGYCSGED---YETLRQI-DVHVFNTVSLRWTKL---PPVKTVAHQRAREVPYMRYGHTAV---LLEDT-------IFLWGGRNDTEGACNVLYAFDVNTHRWYTPKVSGTVPGARDGHSACVLGKSMYIFGGYEQLA------------DCFSNDIHKLDTTAMVWSLINAKGSPA---RWRDFHSATIIGAKMFVFGGR 198          

HSP 5 Score: 64.6994 bits (156), Expect = 2.603e-10
Identity = 46/171 (26.90%), Postives = 77/171 (45.03%), Query Frame = 2
Query:  149 VIAATGNSPRARHGHKAVALKELIIIFGG----------GNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGM-LEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDA---KFNIPRYLNDLYVLDI 619
            +I A G+  R R  H A  +   + +FGG           NE   +++  ++T TN W         P G  +         L +FGG      ++  DL++ +   + WKK+ PK    G  PC+R      ++G+++ LFGG +   E     +FN+  + +DLY+LD 
Sbjct:  169 LINAKGSPARWRDFHSATIIGAKMFVFGGRADRFGPFHSNNEIYCNKIKVFDTETNCWLSTPTTQPSPEGRRSHSAFCYKGELYIFGGYNARLDRHFNDLWKFNPEAFMWKKIEPK----GKGPCSRRRQCCCMVGDRIILFGGTSPCPEQGMGDEFNLIDH-SDLYILDF 334          
BLAST of host cell factor-1 vs. Ensembl Medaka
Match: krcp (tip elongation aberrant protein 1-like [Source:NCBI gene;Acc:101172770])

HSP 1 Score: 78.5666 bits (192), Expect = 1.971e-14
Identity = 87/323 (26.93%), Postives = 128/323 (39.63%), Query Frame = 2
Query:  170 SPRARHGHKAVALKELIIIFGGGN----EGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVA----DNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGL---ANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHK-FRYGDVYILNVDTMSWTKPTIGGEIPQPRSLH-SATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPR---PRAGHSAVAVST 1090
            SP AR G     +     I  GG     +   D +    T    W       E P      G  A    D+ R+ +FGG     K+  D++ L    W W  +  +   G   P A   HS ++   ++++ GG+    N   D         + LY+ D + +    +W  P + G  P+PR  HSA   Q         Q  + V+GG      Y D+Y+L++  M ++     G+ P PRS H SA L   K  I GG+       N N+              D+ET SW        EA +P+   PRAGHS +A+ T
Sbjct:  236 SPSARWGQTLCPIDAQTAILIGGQGARMQFCKDPMWKLCTEDMSWMAAETLAEGPTPETRIGHTATFDPDSKRIFVFGGSKNR-KWFNDVHILDTQTWRWSMVEAQ---GKVPPLAY--HSCSMFRGELFVLGGVFPRPNPEPDG------CSDSLYIFDPQLS----IWYQPIVTGDKPSPRSGHSACVIQ---------QRYIYVFGGWDTPVCYNDMYMLDLGLMEFSAVKTTGKAPSPRSWHGSAVLSDTKFLIHGGY-------NGNN------ALGDAFIFDIETNSW-------TEAALPQLSVPRAGHSIIAMET 513          

HSP 2 Score: 66.6254 bits (161), Expect = 1.074e-10
Identity = 50/186 (26.88%), Postives = 86/186 (46.24%), Query Frame = 2
Query:  638 MMWETPSMKGSIPTP--RESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFR-YGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTR-IYIWSGRDGYRKAWNNQVCFKDLWYLETSL 1183
            M W         PTP  R  H+A          D    ++ V+GG    + + DV+IL+  T  W+     G++P P + HS ++   ++++ GG  P      R + E +  C++S++  D +   W +     D+   P PR+GHSA  +  R IY++ G       W+  VC+ D++ L+  L
Sbjct:  278 MSWMAAETLAEGPTPETRIGHTATF--------DPDSKRIFVFGGSKNRKWFNDVHILDTQTWRWSMVEAQGKVP-PLAYHSCSMFRGELFVLGGVFP------RPNPEPD-GCSDSLYIFDPQLSIWYQPIVTGDK---PSPRSGHSACVIQQRYIYVFGG-------WDTPVCYNDMYMLDLGL 437          
BLAST of host cell factor-1 vs. Planmine SMEST
Match: SMESG000068250.1 (SMESG000068250.1)

HSP 1 Score: 1895.17 bits (4908), Expect = 0.000e+0
Identity = 1039/1039 (100.00%), Postives = 1039/1039 (100.00%), Query Frame = 2
Query:  113 MLTDSINPKWVKVIAATGNSPRARHGHKAVALKELIIIFGGGNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLWYLETSLPPSPSKIQLERAHDESLELTCNPVPTADYYMLQIRIYHIPQSNSTIQSQQSAAALSGIDAAPKXXXXXXXXXXXXXXXXXXXXXXXXXFNTSEPTHLQPDTSPMVPVQHKIIRFAAVEGXXXXXXXXXXXXXXXXRISLNSASKIRFSTVPTTQKPAASIKPQVINLNSSIVPTSNTPVALLKPGSNQVTRPVLRIVSNKTFTCVNQPVNAVNQPGKIVKTVMMQQPSSQPGTVQIRPTHRVLVSQTQPNIVRAGSTDQVHSIRMISTDQLNRIQSREHEPHPDQYDGADTDEDSEKNIDMXXXXXXXXXXXXXXXXXXXYSAKDESKEETSNSRLSMTDTEDPLETLAIVATSQRXXXXXXXXXXXXXXXXXLSKIGQSNIGNIGLSDSINHYMPVGNSSAYINGNNNSSTQEPQDKQNLINSNTDEVVWYDALITTQPKFTVTSYFAIPNTTGMPNLSLINETESEGLRVNLTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAIKVVKVRNGAQLSWEPPHNCHNISEYSIYLAVKNNNPSSGQQNKGFTFIRVYCGQEPKAIVTASFLTQAHLDNSSKPAVIFRIAARNELGYGPATQVRWLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXINVGNNFSCAPPGVKRQPSNIDDWSANKKSKPSI 3229
            MLTDSINPKWVKVIAATGNSPRARHGHKAVALKELIIIFGGGNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLWYLETSLPPSPSKIQLERAHDESLELTCNPVPTADYYMLQIRIYHIPQSNSTIQSQQSAAALSGIDAAPKSESSTSIIPTTVITTPTVSEPITVSFNTSEPTHLQPDTSPMVPVQHKIIRFAAVEGINQSSASNIQSNPNIQRISLNSASKIRFSTVPTTQKPAASIKPQVINLNSSIVPTSNTPVALLKPGSNQVTRPVLRIVSNKTFTCVNQPVNAVNQPGKIVKTVMMQQPSSQPGTVQIRPTHRVLVSQTQPNIVRAGSTDQVHSIRMISTDQLNRIQSREHEPHPDQYDGADTDEDSEKNIDMAKLAQAAAAELLADDDENEYSAKDESKEETSNSRLSMTDTEDPLETLAIVATSQREHSNISSSSHNIHPSEHLSKIGQSNIGNIGLSDSINHYMPVGNSSAYINGNNNSSTQEPQDKQNLINSNTDEVVWYDALITTQPKFTVTSYFAIPNTTGMPNLSLINETESEGLRVNLTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAIKVVKVRNGAQLSWEPPHNCHNISEYSIYLAVKNNNPSSGQQNKGFTFIRVYCGQEPKAIVTASFLTQAHLDNSSKPAVIFRIAARNELGYGPATQVRWLQDSTQQQHYQQQMSNPSVPVVSSNSNLQSSVRPSINVGNNFSCAPPGVKRQPSNIDDWSANKKSKPSI
Sbjct:    1 MLTDSINPKWVKVIAATGNSPRARHGHKAVALKELIIIFGGGNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLWYLETSLPPSPSKIQLERAHDESLELTCNPVPTADYYMLQIRIYHIPQSNSTIQSQQSAAALSGIDAAPKSESSTSIIPTTVITTPTVSEPITVSFNTSEPTHLQPDTSPMVPVQHKIIRFAAVEGINQSSASNIQSNPNIQRISLNSASKIRFSTVPTTQKPAASIKPQVINLNSSIVPTSNTPVALLKPGSNQVTRPVLRIVSNKTFTCVNQPVNAVNQPGKIVKTVMMQQPSSQPGTVQIRPTHRVLVSQTQPNIVRAGSTDQVHSIRMISTDQLNRIQSREHEPHPDQYDGADTDEDSEKNIDMAKLAQAAAAELLADDDENEYSAKDESKEETSNSRLSMTDTEDPLETLAIVATSQREHSNISSSSHNIHPSEHLSKIGQSNIGNIGLSDSINHYMPVGNSSAYINGNNNSSTQEPQDKQNLINSNTDEVVWYDALITTQPKFTVTSYFAIPNTTGMPNLSLINETESEGLRVNLTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAIKVVKVRNGAQLSWEPPHNCHNISEYSIYLAVKNNNPSSGQQNKGFTFIRVYCGQEPKAIVTASFLTQAHLDNSSKPAVIFRIAARNELGYGPATQVRWLQDSTQQQHYQQQMSNPSVPVVSSNSNLQSSVRPSINVGNNFSCAPPGVKRQPSNIDDWSANKKSKPSI 1039          
BLAST of host cell factor-1 vs. Planmine SMEST
Match: SMESG000068250.1 (SMESG000068250.1)

HSP 1 Score: 1878.99 bits (4866), Expect = 0.000e+0
Identity = 1035/1039 (99.62%), Postives = 1035/1039 (99.62%), Query Frame = 2
Query:  113 MLTDSINPKWVKVIAATGNSPRARHGHKAVALKELIIIFGGGNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLWYLETSLPPSPSKIQLERAHDESLELTCNPVPTADYYMLQIRIYHIPQSNSTIQSQQSAAALSGIDAAPKXXXXXXXXXXXXXXXXXXXXXXXXXFNTSEPTHLQPDTSPMVPVQHKIIRFAAVEGXXXXXXXXXXXXXXXXRISLNSASKIRFSTVPTTQKPAASIKPQVINLNSSIVPTSNTPVALLKPGSNQVTRPVLRIVSNKTFTCVNQPVNAVNQPGKIVKTVMMQQPSSQPGTVQIRPTHRVLVSQTQPNIVRAGSTDQVHSIRMISTDQLNRIQSREHEPHPDQYDGADTDEDSEKNIDMXXXXXXXXXXXXXXXXXXXYSAKDESKEETSNSRLSMTDTEDPLETLAIVATSQRXXXXXXXXXXXXXXXXXLSKIGQSNIGNIGLSDSINHYMPVGNSSAYINGNNNSSTQEPQDKQNLINSNTDEVVWYDALITTQPKFTVTSYFAIPNTTGMPNLSLINETESEGLRVNLTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAIKVVKVRNGAQLSWEPPHNCHNISEYSIYLAVKNNNPSSGQQNKGFTFIRVYCGQEPKAIVTASFLTQAHLDNSSKPAVIFRIAARNELGYGPATQVRWLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXINVGNNFSCAPPGVKRQPSNIDDWSANKKSKPSI 3229
            MLTDSINPKWVKVIAATGNSPRARHGHKAVALKELIIIFGGGNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQ    DLWYLETSLPPSPSKIQLERAHDESLELTCNPVPTADYYMLQIRIYHIPQSNSTIQSQQSAAALSGIDAAPKSESSTSIIPTTVITTPTVSEPITVSFNTSEPTHLQPDTSPMVPVQHKIIRFAAVEGINQSSASNIQSNPNIQRISLNSASKIRFSTVPTTQKPAASIKPQVINLNSSIVPTSNTPVALLKPGSNQVTRPVLRIVSNKTFTCVNQPVNAVNQPGKIVKTVMMQQPSSQPGTVQIRPTHRVLVSQTQPNIVRAGSTDQVHSIRMISTDQLNRIQSREHEPHPDQYDGADTDEDSEKNIDMAKLAQAAAAELLADDDENEYSAKDESKEETSNSRLSMTDTEDPLETLAIVATSQREHSNISSSSHNIHPSEHLSKIGQSNIGNIGLSDSINHYMPVGNSSAYINGNNNSSTQEPQDKQNLINSNTDEVVWYDALITTQPKFTVTSYFAIPNTTGMPNLSLINETESEGLRVNLTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAIKVVKVRNGAQLSWEPPHNCHNISEYSIYLAVKNNNPSSGQQNKGFTFIRVYCGQEPKAIVTASFLTQAHLDNSSKPAVIFRIAARNELGYGPATQVRWLQDSTQQQHYQQQMSNPSVPVVSSNSNLQSSVRPSINVGNNFSCAPPGVKRQPSNIDDWSANKKSKPSI
Sbjct:    1 MLTDSINPKWVKVIAATGNSPRARHGHKAVALKELIIIFGGGNEGIVDELHAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGDLYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDSEDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQ----DLWYLETSLPPSPSKIQLERAHDESLELTCNPVPTADYYMLQIRIYHIPQSNSTIQSQQSAAALSGIDAAPKSESSTSIIPTTVITTPTVSEPITVSFNTSEPTHLQPDTSPMVPVQHKIIRFAAVEGINQSSASNIQSNPNIQRISLNSASKIRFSTVPTTQKPAASIKPQVINLNSSIVPTSNTPVALLKPGSNQVTRPVLRIVSNKTFTCVNQPVNAVNQPGKIVKTVMMQQPSSQPGTVQIRPTHRVLVSQTQPNIVRAGSTDQVHSIRMISTDQLNRIQSREHEPHPDQYDGADTDEDSEKNIDMAKLAQAAAAELLADDDENEYSAKDESKEETSNSRLSMTDTEDPLETLAIVATSQREHSNISSSSHNIHPSEHLSKIGQSNIGNIGLSDSINHYMPVGNSSAYINGNNNSSTQEPQDKQNLINSNTDEVVWYDALITTQPKFTVTSYFAIPNTTGMPNLSLINETESEGLRVNLTPGTAYKVRVAAINKCGRGPWSEEGAFKTSLPGFPGAPSAIKVVKVRNGAQLSWEPPHNCHNISEYSIYLAVKNNNPSSGQQNKGFTFIRVYCGQEPKAIVTASFLTQAHLDNSSKPAVIFRIAARNELGYGPATQVRWLQDSTQQQHYQQQMSNPSVPVVSSNSNLQSSVRPSINVGNNFSCAPPGVKRQPSNIDDWSANKKSKPSI 1035          
BLAST of host cell factor-1 vs. Planmine SMEST
Match: SMESG000077083.1 (SMESG000077083.1)

HSP 1 Score: 53.1434 bits (126), Expect = 1.056e-6
Identity = 72/320 (22.50%), Postives = 118/320 (36.88%), Query Frame = 2
Query:  167 NSPRARHGHKAVALKELIIIFGG--------------------GNEGIVDELHAYNTLTNQWF---VPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGK--YSGDLYELHASRWEWKKLRPKPPRGGSL-PCARIGHSLTLIGNKMYLFGGLANDSEDA-KFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSI--------------------PTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKFR-----YGDVYILNVDTMSWT----KPTIGGEIPQPRSLHSATLVG---NKMYIFGGWVPLVLDDNRNS 949
            N P  R+GH  V  K++ I+FGG                      E + + L   N   N  F   V  +RG IP              + +FGG+   G   +   LY+L    W+W  +      G  + P  R   +LT   N +YLFGG ++D  +   FN   Y   ++  D+ A +     +     G +                    P PR SH  +            + +L ++GG+++        GD++  NV T  WT    +  +G +   P  L   +L     N   + GG   ++ D+N ++
Sbjct:   73 NKPFDRYGHTVVKWKKIGILFGGFPNSSLTASSSSSEIYLFVPNIECLPNRLKVLNNSINSNFWVLVDGVRGSIPEKRDGHSADIYYDVMFLFGGLTSTGARYFDNKLYQLDLITWQWTIIY----NGDYVEPLGRDFCTLTTCKNSLYLFGGRSDDRFNGLTFNRDIYDTAVWKFDLVANKDNRWIKIHPGYGLVVSSSYHTSSYSSILPNCLKYPFPRRSHMTMV----------IRDELFIFGGLYQINSYCMHLGDLWSFNVMTYQWTMSSPRKRMGPDYVWPPGLRKGSLTAVNDNCGLLIGG--VIIYDENSDN 376          
BLAST of host cell factor-1 vs. Planmine SMEST
Match: SMESG000074654.1 (SMESG000074654.1)

HSP 1 Score: 52.7582 bits (125), Expect = 1.321e-6
Identity = 63/254 (24.80%), Postives = 94/254 (37.01%), Query Frame = 2
Query:  485 PCARIGHSLTLIGNKMYLFGGLA--NDSEDA-KFNIPRYLNDLYVLDIKA----------AQGTMMWETPSMKGSIPTPRESHSAVAYQLIQQNSDQTQWKLLVYGGMHKF--RYGDVYILNVDTM---SWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRV-CEDADEAEM--------PRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDLW 1165
            P AR  H+  +  N +YL GG +  N  +D  + N+   LN +     K+               +WE  S      +P +SH+ VAY+            L ++GG   +  R    +I N+       W    +   IP PR  HS  +  + + IFGG       D R S    W         D ET  W  + C      ++        PR R  H AV     ++I+ G  G       ++C  DLW
Sbjct:   37 PVARWKHATVIYDNYLYLMGGYSWTNTLKDLWRLNLSE-LNRIMTNQFKSIGLWSSIGNFGNNVNLWEDLSKFVGKISPLQSHTMVAYKN----------HLYIFGGAFTYDVRNCPFWIYNIGNQIMQKWKPIDVNAPIPFPRRNHSCCIYRSALVIFGG-----FGDVRGSLGDLWA-------FDFETGKWHLIWCTQYLNKQLKRSIVKYGPRARHDHRAVIHKNHLFIFGGMCGL------EIC-NDLW 260          
BLAST of host cell factor-1 vs. Planmine SMEST
Match: SMESG000050514.1 (SMESG000050514.1)

HSP 1 Score: 51.6026 bits (122), Expect = 3.041e-6
Identity = 57/244 (23.36%), Postives = 97/244 (39.75%), Query Frame = 2
Query:  416 YELHASRWEWKKLRPKPPRGGSLP----CARIGHSLTLIGNKMYLFGGLANDSEDAK-----------------FNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQ----------------LIQQNSDQTQWKL-----LVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPRSLHSATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSWDRV 1021
            Y +  S+ +  +L       GS P    CA  G +    GN++YLFGG +   ++                    NI +  N      +K   G+   ++  +  + P+ R+  S V ++                 IQ N DQ    L      V G  ++     + I ++ T  WT P   G IP PR+ HS+ +  +K++IFGG + +    N  +  +    +N  + LDL T  W ++
Sbjct:   59 YNVLNSQLDTVELSYDMESVGSFPTEFFCAS-GMACCSNGNRIYLFGGYSLTKQEVVNALYYIEISKSIDFTGLLNIKKLCNKKPKAVLKFLSGSHDGDSEEIHRNFPSYRDKASIVYWRNNIIVFGGYGSNFIRSEIQDNIDQGHNFLADNGEYVSGSGNRGWNNQLLIFSMSTNRWTNPATFGSIPCPRAAHSSAITDSKLFIFGGRLGM---KNTAATVR----SNEFYYLDLITFYWTKI 294          
The following BLAST results are available for this feature:
BLAST of host cell factor-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HCFC12.215e-17360.97host cell factor C1 [Source:HGNC Symbol;Acc:HGNC:4... [more]
HCFC12.434e-17360.97host cell factor C1 [Source:HGNC Symbol;Acc:HGNC:4... [more]
HCFC22.219e-14655.70host cell factor C2 [Source:HGNC Symbol;Acc:HGNC:2... [more]
HCFC27.142e-14555.70host cell factor C2 [Source:HGNC Symbol;Acc:HGNC:2... [more]
HCFC15.997e-5049.74host cell factor C1 [Source:HGNC Symbol;Acc:HGNC:4... [more]
back to top
BLAST of host cell factor-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hcf-13.099e-11948.60HCF1 related; Host cell factor 1 [Source:UniProtK... [more]
F53E4.12.586e-1827.20pep chromosome:WBcel235:V:15652438:15659079:-1 gen... [more]
F53E4.12.586e-1827.20pep chromosome:WBcel235:V:15652438:15659067:-1 gen... [more]
F53E4.11.631e-1725.86pep chromosome:WBcel235:V:15652438:15668300:-1 gen... [more]
F53E4.11.781e-1725.86pep chromosome:WBcel235:V:15652438:15659079:-1 gen... [more]
back to top
BLAST of host cell factor-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hcf1.445e-15353.67gene:FBgn0039904 transcript:FBtr0089125[more]
Hcf1.445e-15353.67gene:FBgn0039904 transcript:FBtr0089126[more]
Hcf1.445e-15353.67gene:FBgn0039904 transcript:FBtr0345284[more]
Hcf7.786e-15253.40gene:FBgn0039904 transcript:FBtr0307379[more]
Hcf1.379e-13655.49gene:FBgn0039904 transcript:FBtr0334479[more]
back to top
BLAST of host cell factor-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hcfc1b7.644e-17159.00host cell factor C1b [Source:ZFIN;Acc:ZDB-GENE-030... [more]
hcfc1a1.695e-16960.81host cell factor C1a [Source:ZFIN;Acc:ZDB-GENE-030... [more]
hcfc1a2.427e-16960.81host cell factor C1a [Source:ZFIN;Acc:ZDB-GENE-030... [more]
hcfc21.247e-13549.87host cell factor C2 [Source:ZFIN;Acc:ZDB-GENE-0504... [more]
hcfc23.094e-3847.95host cell factor C2 [Source:ZFIN;Acc:ZDB-GENE-0504... [more]
back to top
BLAST of host cell factor-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HCFC11.054e-17661.17host cell factor C1 [Source:NCBI gene;Acc:10048553... [more]
HCFC11.940e-17661.17host cell factor C1 [Source:NCBI gene;Acc:10048553... [more]
HCFC13.074e-17661.17host cell factor C1 [Source:NCBI gene;Acc:10048553... [more]
HCFC13.992e-17661.17host cell factor C1 [Source:NCBI gene;Acc:10048553... [more]
HCFC15.151e-17661.17host cell factor C1 [Source:NCBI gene;Acc:10048553... [more]
back to top
BLAST of host cell factor-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hcfc18.132e-17360.71host cell factor C1 [Source:MGI Symbol;Acc:MGI:105... [more]
Hcfc11.154e-17260.71host cell factor C1 [Source:MGI Symbol;Acc:MGI:105... [more]
Hcfc29.771e-14753.79host cell factor C2 [Source:MGI Symbol;Acc:MGI:191... [more]
Hcfc24.672e-6169.63host cell factor C2 [Source:MGI Symbol;Acc:MGI:191... [more]
Hcfc14.506e-5048.73host cell factor C1 [Source:MGI Symbol;Acc:MGI:105... [more]
back to top
BLAST of host cell factor-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P51610|HCFC1_HUMAN1.064e-17260.97Host cell factor 1 OS=Homo sapiens OX=9606 GN=HCFC... [more]
sp|P51611|HCFC1_MESAU6.103e-17260.71Host cell factor 1 OS=Mesocricetus auratus OX=1003... [more]
sp|Q61191|HCFC1_MOUSE8.069e-17260.71Host cell factor 1 OS=Mus musculus OX=10090 GN=Hcf... [more]
sp|Q9V4C8|HCF_DROME1.448e-15253.67Host cell factor OS=Drosophila melanogaster OX=722... [more]
sp|Q5RKG2|HCFC2_RAT1.573e-14655.96Host cell factor 2 OS=Rattus norvegicus OX=10116 G... [more]
back to top
BLAST of host cell factor-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZI980.000e+0100.00Host cell factor-1 OS=Schmidtea mediterranea OX=79... [more]
L0H7590.000e+0100.00Hcf1 (Fragment) OS=Schmidtea mediterranea OX=79327... [more]
A0A0R3TXZ05.671e-4663.64Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A068YEI72.703e-5063.80Host cell factor 1 OS=Echinococcus multilocularis ... [more]
U6J0K82.950e-5063.80Host cell factor OS=Echinococcus granulosus OX=621... [more]
back to top
BLAST of host cell factor-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hcfc1b7.804e-17258.94host cell factor C1 [Source:NCBI gene;Acc:10304450... [more]
hcfc21.430e-13849.39host cell factor C2 [Source:NCBI gene;Acc:10304761... [more]
klhdc31.070e-2227.67kelch domain containing 3 [Source:ZFIN;Acc:ZDB-GEN... [more]
krcp2.074e-1426.98rab9 effector protein with kelch motifs-like [Sour... [more]
klhdc21.312e-1324.32kelch domain containing 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of host cell factor-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003143.11.954e-17058.43pep scaffold:Pmarinus_7.0:GL476673:191963:200990:-... [more]
ENSPMAT00000003151.11.323e-2451.92pep scaffold:Pmarinus_7.0:GL476673:235484:236360:-... [more]
zgc:1630148.529e-2030.24zgc:163014 [Source:ZFIN;Acc:ZDB-GENE-070424-100][more]
zgc:1630149.106e-2029.84zgc:163014 [Source:ZFIN;Acc:ZDB-GENE-070424-100][more]
KLHDC21.448e-1324.46kelch domain containing 2 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of host cell factor-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
KEL21.959e-1828.26Protein that negatively regulates mitotic exit; fo... [more]
KEL11.704e-1327.84Protein required for proper cell fusion and cell m... [more]
KEL32.271e-921.73Cytoplasmic protein of unknown function [Source:SG... [more]
back to top
BLAST of host cell factor-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO496571.652e-16959.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO275741.960e-5861.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO496583.291e-5347.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO295411.518e-3156.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343244.902e-2527.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of host cell factor-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hcfc1a1.913e-16959.44host cell factor C1 [Source:NCBI gene;Acc:10115793... [more]
hcfc22.375e-14351.22host cell factor C2 [Source:NCBI gene;Acc:10116159... [more]
klhdc36.058e-2329.13kelch domain containing 3 [Source:NCBI gene;Acc:10... [more]
klhdc37.787e-2329.07kelch domain containing 3 [Source:NCBI gene;Acc:10... [more]
krcp1.971e-1426.93tip elongation aberrant protein 1-like [Source:NCB... [more]
back to top
BLAST of host cell factor-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000068250.10.000e+0100.00SMESG000068250.1[more]
SMESG000068250.10.000e+099.62SMESG000068250.1[more]
SMESG000077083.11.056e-622.50SMESG000077083.1[more]
SMESG000074654.11.321e-624.80SMESG000074654.1[more]
SMESG000050514.13.041e-623.36SMESG000050514.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30022027
GenBankAFJ24752.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022027 ID=SMED30022027|Name=host cell factor-1|organism=Schmidtea mediterranea sexual|type=transcript|length=3391bp
ATAAGATAACACTTATAACTTCTTTACTATAAACTTTGTTTTAATAAATA
AAAAGAATATAATTCAAACGACCATTTTTGTTTATTTAAAATTTTAGATT
ATTGTTATATAAATGTTAACGGATTCAATTAATCCTAAATGGGTTAAAGT
TATTGCTGCCACTGGTAATTCACCACGCGCAAGACATGGCCACAAAGCTG
TCGCACTTAAAGAGCTTATCATTATATTTGGTGGTGGAAATGAGGGTATT
GTCGATGAACTTCATGCTTATAATACTTTAACAAATCAATGGTTTGTGCC
ATCACTTCGTGGCGAGATTCCTCCTGGGTGTGCTGCGTTTGGATTAGTTG
CAGATAACACAAGATTATTGATGTTTGGTGGCATGTTAGAATATGGGAAA
TATTCTGGTGATTTATACGAACTTCATGCAAGTCGCTGGGAATGGAAAAA
ATTACGCCCAAAACCTCCTAGAGGTGGTTCACTTCCATGTGCCAGAATAG
GACATTCATTAACTTTAATTGGTAATAAAATGTATCTCTTCGGTGGCTTA
GCCAATGACAGTGAAGATGCTAAATTTAACATACCAAGGTATTTGAATGA
TTTATATGTTCTCGATATAAAAGCAGCACAAGGTACAATGATGTGGGAAA
CTCCATCGATGAAAGGGTCAATTCCAACCCCAAGGGAATCCCATTCAGCA
GTTGCATATCAATTAATACAACAAAACTCAGATCAAACCCAATGGAAATT
GTTAGTTTATGGAGGAATGCATAAATTTCGATATGGAGATGTATATATTT
TAAATGTTGACACAATGAGTTGGACGAAACCGACAATCGGTGGAGAAATA
CCTCAGCCACGCAGTTTACACTCGGCAACCCTTGTTGGAAATAAAATGTA
TATTTTTGGTGGGTGGGTGCCGCTAGTTTTGGACGACAATAGAAATAGCC
AAGAAAAAGAGTGGAAATGTACAAATTCTGTTCACCGTTTGGATTTAGAA
ACGTTAAGCTGGGATCGTGTTTGTGAAGATGCCGATGAAGCTGAAATGCC
CAGACCGAGAGCTGGCCACAGTGCGGTTGCTGTATCTACTAGAATATATA
TTTGGTCTGGAAGAGATGGATATAGAAAGGCATGGAATAATCAGGTATGT
TTTAAGGATTTGTGGTATCTTGAAACGTCTTTGCCTCCAAGTCCAAGTAA
AATACAATTAGAACGAGCTCACGATGAGAGTTTGGAATTGACATGTAACC
CCGTTCCAACAGCAGATTATTATATGCTCCAAATAAGAATTTATCACATT
CCACAATCTAATTCAACTATCCAGTCGCAACAATCAGCAGCAGCATTGTC
AGGTATCGACGCGGCGCCTAAATCAGAATCATCCACATCGATTATTCCGA
CAACTGTTATAACTACCCCAACGGTTTCAGAACCGATAACGGTTTCATTC
AATACTTCCGAGCCAACTCATTTGCAACCTGACACATCACCCATGGTTCC
GGTACAACACAAAATTATTAGATTTGCTGCCGTCGAAGGAATAAATCAAT
CGTCGGCTTCAAATATTCAATCTAATCCCAATATACAGCGTATCAGTCTA
AATTCGGCTTCAAAAATCAGATTTTCTACCGTTCCAACAACCCAAAAACC
GGCTGCTTCCATTAAGCCACAAGTGATAAATTTAAATTCGAGTATCGTTC
CAACATCAAACACTCCTGTTGCTTTGCTCAAACCTGGTTCCAATCAGGTC
ACAAGACCTGTTTTACGCATTGTATCAAATAAAACCTTTACCTGTGTGAA
TCAACCCGTAAATGCTGTAAATCAGCCAGGGAAAATTGTCAAAACCGTTA
TGATGCAACAGCCGTCATCGCAACCTGGAACCGTTCAAATTCGACCGACT
CATCGTGTTTTAGTGTCCCAAACTCAACCTAATATTGTTCGAGCAGGATC
CACCGACCAGGTCCACAGTATTAGAATGATATCCACCGACCAGCTTAATC
GAATACAGAGCAGGGAGCATGAACCGCATCCCGATCAATATGACGGGGCC
GATACTGATGAGGATTCTGAGAAAAATATCGATATGGCAAAATTGGCTCA
AGCGGCAGCTGCAGAGTTATTAGCGGATGATGACGAAAACGAATATTCAG
CAAAAGATGAATCCAAAGAAGAAACATCCAATAGCAGACTGTCCATGACA
GACACTGAAGATCCACTGGAAACTTTAGCAATTGTCGCTACCAGTCAGAG
AGAGCACTCTAATATATCTTCCTCCAGTCATAACATTCATCCATCCGAAC
ATTTAAGCAAAATAGGCCAATCAAATATTGGCAATATCGGATTATCTGAT
TCCATTAATCATTATATGCCAGTTGGCAATAGCTCTGCGTATATCAATGG
AAATAATAACAGTTCTACCCAAGAACCTCAAGATAAACAAAATTTAATCA
ACTCTAATACAGACGAAGTCGTTTGGTACGATGCTCTCATAACCACCCAG
CCTAAATTCACCGTGACATCATATTTCGCAATTCCCAATACTACTGGAAT
GCCAAATTTAAGTCTTATAAACGAAACTGAATCTGAAGGTTTACGAGTAA
ATTTGACTCCCGGAACTGCGTATAAAGTAAGAGTAGCCGCCATAAATAAA
TGCGGAAGAGGCCCTTGGTCAGAAGAAGGAGCTTTTAAAACGAGTCTGCC
AGGTTTTCCAGGAGCTCCAAGTGCCATTAAAGTTGTCAAAGTCAGAAATG
GTGCTCAATTAAGCTGGGAGCCCCCACACAATTGCCACAACATTTCAGAG
TATTCCATATATCTTGCGGTTAAAAACAACAATCCCTCATCGGGACAACA
GAATAAAGGGTTTACCTTTATTCGTGTATATTGTGGCCAAGAACCCAAGG
CAATAGTGACAGCATCATTCCTAACCCAAGCGCATTTAGATAACAGCAGT
AAACCAGCTGTTATATTTAGAATAGCAGCCCGCAATGAGCTTGGTTATGG
ACCTGCAACCCAGGTCAGGTGGCTACAAGACAGTACACAGCAACAGCATT
ATCAGCAACAGATGTCTAACCCATCTGTACCGGTTGTTAGCAGCAACTCT
AATCTCCAATCTTCTGTTAGACCATCGATTAATGTGGGGAATAATTTTTC
CTGCGCTCCGCCTGGTGTTAAAAGGCAACCATCCAATATTGATGATTGGT
CCGCAAACAAGAAATCAAAGCCTTCAATATAATTGAATAAAATGTGCTTG
CATGCTTGTTGATAATTGTTTATGGTGCATTTAATAACCAAGATGTATTG
TTTTGTATATTATAGAGAATCTGAATGATAATAAATCTAATAAACTGTCT
ATTAAAGTTTCAAAATAAATGATATGTTTATGAAAAAAAAA
back to top

protein sequence of SMED30022027-orf-1

>SMED30022027-orf-1 ID=SMED30022027-orf-1|Name=SMED30022027-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1040bp
MLTDSINPKWVKVIAATGNSPRARHGHKAVALKELIIIFGGGNEGIVDEL
HAYNTLTNQWFVPSLRGEIPPGCAAFGLVADNTRLLMFGGMLEYGKYSGD
LYELHASRWEWKKLRPKPPRGGSLPCARIGHSLTLIGNKMYLFGGLANDS
EDAKFNIPRYLNDLYVLDIKAAQGTMMWETPSMKGSIPTPRESHSAVAYQ
LIQQNSDQTQWKLLVYGGMHKFRYGDVYILNVDTMSWTKPTIGGEIPQPR
SLHSATLVGNKMYIFGGWVPLVLDDNRNSQEKEWKCTNSVHRLDLETLSW
DRVCEDADEAEMPRPRAGHSAVAVSTRIYIWSGRDGYRKAWNNQVCFKDL
WYLETSLPPSPSKIQLERAHDESLELTCNPVPTADYYMLQIRIYHIPQSN
STIQSQQSAAALSGIDAAPKSESSTSIIPTTVITTPTVSEPITVSFNTSE
PTHLQPDTSPMVPVQHKIIRFAAVEGINQSSASNIQSNPNIQRISLNSAS
KIRFSTVPTTQKPAASIKPQVINLNSSIVPTSNTPVALLKPGSNQVTRPV
LRIVSNKTFTCVNQPVNAVNQPGKIVKTVMMQQPSSQPGTVQIRPTHRVL
VSQTQPNIVRAGSTDQVHSIRMISTDQLNRIQSREHEPHPDQYDGADTDE
DSEKNIDMAKLAQAAAAELLADDDENEYSAKDESKEETSNSRLSMTDTED
PLETLAIVATSQREHSNISSSSHNIHPSEHLSKIGQSNIGNIGLSDSINH
YMPVGNSSAYINGNNNSSTQEPQDKQNLINSNTDEVVWYDALITTQPKFT
VTSYFAIPNTTGMPNLSLINETESEGLRVNLTPGTAYKVRVAAINKCGRG
PWSEEGAFKTSLPGFPGAPSAIKVVKVRNGAQLSWEPPHNCHNISEYSIY
LAVKNNNPSSGQQNKGFTFIRVYCGQEPKAIVTASFLTQAHLDNSSKPAV
IFRIAARNELGYGPATQVRWLQDSTQQQHYQQQMSNPSVPVVSSNSNLQS
SVRPSINVGNNFSCAPPGVKRQPSNIDDWSANKKSKPSI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000044cephalic ganglia
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR036116FN3_sf
IPR003961FN3_dom
IPR015915Kelch-typ_b-propeller
IPR006652Kelch_1
IPR013783Ig-like_fold
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0001205transcriptional activator activity, RNA polymerase II distal enhancer sequence-specific binding
GO:0003682chromatin binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0003713transcription coactivator activity
GO:0042802identical protein binding
GO:0045296cadherin binding
Vocabulary: biological process
TermDefinition
GO:0000122negative regulation of transcription from RNA polymerase II promoter
GO:0006355regulation of transcription, DNA-templated
GO:0006366transcription from RNA polymerase II promoter
GO:0007005mitochondrion organization
GO:0007049cell cycle
GO:0010628positive regulation of gene expression
GO:0016032viral process
GO:0016569covalent chromatin modification
GO:0016579protein deubiquitination
GO:0019046release from viral latency
GO:0043254regulation of protein complex assembly
GO:0043981histone H4-K5 acetylation
GO:0043982histone H4-K8 acetylation
GO:0043984histone H4-K16 acetylation
GO:0045787positive regulation of cell cycle
GO:0045944positive regulation of transcription from RNA polymerase II promoter
GO:0050821protein stabilization
GO:0071407cellular response to organic cyclic compound
Vocabulary: cellular component
TermDefinition
GO:0000123histone acetyltransferase complex
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005737cytoplasm
GO:0016020membrane
GO:0030424axon
GO:0030425dendrite
GO:0043025neuronal cell body
GO:0048188Set1C/COMPASS complex
GO:0071339MLL1 complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003961Fibronectin type IIISMARTSM00060FN3_2coord: 866..963
e-value: 0.23
score: 20.5
coord: 358..850
e-value: 3.3
score: 15.7
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 865..978
score: 7.062
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 360..451
score: 6.643
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 771..863
score: 10.959
IPR003961Fibronectin type IIICDDcd00063FN3coord: 866..967
e-value: 0.00926231
score: 34.7795
IPR003961Fibronectin type IIICDDcd00063FN3coord: 830..860
e-value: 1.86047E-6
score: 45.1799
NoneNo IPR availablePFAMPF13415Kelch_3coord: 213..257
e-value: 1.1E-5
score: 25.6
coord: 137..199
e-value: 2.1E-5
score: 24.7
coord: 259..323
e-value: 3.0E-10
score: 40.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 630..645
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1017..1039
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1025..1039
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 670..700
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 629..651
NoneNo IPR availablePANTHERPTHR46003FAMILY NOT NAMEDcoord: 7..986
IPR015915Kelch-type beta propellerGENE3DG3DSA:2.120.10.80coord: 178..364
e-value: 7.3E-23
score: 82.9
IPR015915Kelch-type beta propellerGENE3DG3DSA:2.120.10.80coord: 3..177
e-value: 1.5E-18
score: 68.6
IPR015915Kelch-type beta propellerSUPERFAMILYSSF117281Kelch motifcoord: 34..356
IPR006652Kelch repeat type 1PFAMPF01344Kelch_1coord: 23..60
e-value: 1.5E-4
score: 21.3
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 864..987
e-value: 2.4E-46
score: 159.0
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 781..863
e-value: 9.2E-16
score: 60.1
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 798..971