Vacuolar protein sorting-associated protein 33A

Overview
NameVacuolar protein sorting-associated protein 33A
Smed IDSMED30022016
Length (bp)1957
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Vacuolar protein sorting-associated protein 33A (SMED30022016) t-SNE clustered cells

Violin plots show distribution of expression levels for Vacuolar protein sorting-associated protein 33A (SMED30022016) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Vacuolar protein sorting-associated protein 33A (SMED30022016) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Vacuolar protein sorting-associated protein 33A (SMED30022016) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022016

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30022016SMESG000061720.1 Contig2407GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
parenchymaSMED30022016SMESG000061720.1 dd_Smed_v4_3969_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30022016SMESG000061720.1 dd_Smed_v4_3969_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Vacuolar protein sorting-associated protein 33A vs. Ensembl Human
Match: VPS33A (VPS33A core subunit of CORVET and HOPS complexes [Source:HGNC Symbol;Acc:HGNC:18179])

HSP 1 Score: 271.166 bits (692), Expect = 8.597e-82
Identity = 168/592 (28.38%), Postives = 295/592 (49.83%), Query Frame = 2
Query:   83 GPVDLTYLNDTYKKELEDIFSKVTKPTIAIWDVKVKRSVYSIYSKESLEKAKISNVLIDDITTLEKTNKYXXXXXXXXXXXXMIDLVESVI---KRNLCEEYHLIFVPNILTCHEEYIRKKNLEIKFKSTGKFKCYGIPLENDLISLENPDFIMNM---NDLTTLYDLAKTIMLIQSLYGTIPSVSGQGEKFQELMKILTVMKKSSPEQKSIKQSKIHQMLIFDRRIDMLTPLLCQITYEGLLDEFFKFSSGFICVPMFFFNKSDNMD-------DTELFQMNSSDVFYGEVRDAVIQDYMKKIVNFHNEVEAEREKYLKARKLEEMAEVTSNLKAFKSREKAAHFHFTMATILNKYTKRSNYSDLVTAQNHFISQKDCDKIHPIVEEYLIKNIDIGRVIQLICIQSLCSNGLKPKILNSYKREILRTYGLRYVAVLMRLEKMGLLTSQQTSSMIPLGERAFDTIVTTLDLVPESQNLN--CDVSNIYAGFVPIITRLVQYYFKPGWPSISRALNLLPGAETPSIAPVVSADSLSVQNTDRKVVLVVYIGGATFSEISTLRFLSQQEESNTSYIILTTGIITNVTFFESLAQ 1813
            G V+L  L +  ++EL +   K       +WD  +      I     L++ ++  +       L   +    I F       M  + E+V+   +R    ++H++FVP      E+ ++   +   F    ++    IP + DL+S+E+           D T+LY  AK +M +Q+LYGTIP + G+GE  +++  ++  MK+     ++        +L+ DR +D+LTPL  Q+TYEGL+DE +   + ++ +P   F      D       + +  Q+NS++  Y E+RD         +      + A  E+   A+ + E+ +  S L   ++   +   H ++A ++   T   ++ D +T +  F+S  D DK++  +E+ + +   + +V++L+C+QS+C++GLK K+L+ YKREIL+TYG  ++  L  LEK GLL  Q        G   + TI  TL L  +  N     D+S +Y+G+ P+  RL Q   +PGW SI   L +LPG       P+ +      Q  + +V L+ ++GG TF+EI+ LRFLSQ E+  T Y+I TT ++   ++ E+L +
Sbjct:    8 GRVNLNVLREAVRRELREFLDKCAGSKAIVWDEYLTGPFGLIAQYSLLKEHEVEKMFTLKGNRLPAADVKNIIFFVRPRLELMDIIAENVLSEDRRGPTRDFHILFVPRRSLLCEQRLKDLGVLGSFIHREEYSLDLIPFDGDLLSMESEGAFKECYLEGDQTSLYHAAKGLMTLQALYGTIPQIFGKGECARQVANMMIRMKREFTGSQNSIFPVFDNLLLLDRNVDLLTPLATQLTYEGLIDEIYGIQNSYVKLPPEKFAPKKQGDGGKDLPTEAKKLQLNSAEELYAEIRDKNFNAVGSVLSKKAKIISAAFEERHNAKTVGEIKQFVSQLPHMQAARGSLANHTSIAELIKDVTTSEDFFDKLTVEQEFMSGIDTDKVNNYIEDCIAQKHSLIKVLRLVCLQSVCNSGLKQKVLDYYKREILQTYGYEHILTLHNLEKAGLLKPQTG------GRNNYPTIRKTLRLWMDDVNEQNPTDISYVYSGYAPLSVRLAQLLSRPGWRSIEEVLRILPGPHFEERQPLPTGLQKKRQPGENRVTLIFFLGGVTFAEIAALRFLSQLEDGGTEYVIATTKLMNGTSWIEALME 593          
BLAST of Vacuolar protein sorting-associated protein 33A vs. Ensembl Human
Match: VPS33A (VPS33A core subunit of CORVET and HOPS complexes [Source:HGNC Symbol;Acc:HGNC:18179])

HSP 1 Score: 251.136 bits (640), Expect = 8.130e-74
Identity = 168/633 (26.54%), Postives = 295/633 (46.60%), Query Frame = 2
Query:   83 GPVDLTYLNDTYKKELEDIFSKVTKPTIAIWDVKVKRSVYSIYSKESLEKAKISNVLIDDITTLEKTNKYXXXXXXXXXXXXMIDLVESVI---KRNLCEEYHLIFVPNILTCHEEYIRKKNLEIKFKSTGKFKCYGIPLENDLISLENPDFIMNM---NDLTTLYDLAKTIMLIQSLYGTIPSVSGQGEKFQELMKILTVMKKSSPEQKSIKQSKIHQMLIFDRRIDMLTPLLCQITYEGLLDEFFKFSSGFICVPMFFFNKSDNMD-------DTELFQMNSSDVFYGEVRDAVIQDYMKKIVNFHNEVEAEREKYLKARKLEEMAEVTSNLKAFKSREKAAHFHFTMATILNKYTK-----------------------------------------RSNYSDLVTAQNHFISQKDCDKIHPIVEEYLIKNIDIGRVIQLICIQSLCSNGLKPKILNSYKREILRTYGLRYVAVLMRLEKMGLLTSQQTSSMIPLGERAFDTIVTTLDLVPESQNLN--CDVSNIYAGFVPIITRLVQYYFKPGWPSISRALNLLPGAETPSIAPVVSADSLSVQNTDRKVVLVVYIGGATFSEISTLRFLSQQEESNTSYIILTTGIITNVTFFESLAQ 1813
            G V+L  L +  ++EL +   K       +WD  +      I     L++ ++  +       L   +    I F       M  + E+V+   +R    ++H++FVP      E+ ++   +   F    ++    IP + DL+S+E+           D T+LY  AK +M +Q+LYGTIP + G+GE  +++  ++  MK+     ++        +L+ DR +D+LTPL  Q+TYEGL+DE +   + ++ +P   F      D       + +  Q+NS++  Y E+RD         +      + A  E+   A+ + E+ +  S L   ++   +   H ++A ++   T                                            ++ D +T +  F+S  D DK++  +E+ + +   + +V++L+C+QS+C++GLK K+L+ YKREIL+TYG  ++  L  LEK GLL  Q        G   + TI  TL L  +  N     D+S +Y+G+ P+  RL Q   +PGW SI   L +LPG       P+ +      Q  + +V L+ ++GG TF+EI+ LRFLSQ E+  T Y+I TT ++   ++ E+L +
Sbjct:    8 GRVNLNVLREAVRRELREFLDKCAGSKAIVWDEYLTGPFGLIAQYSLLKEHEVEKMFTLKGNRLPAADVKNIIFFVRPRLELMDIIAENVLSEDRRGPTRDFHILFVPRRSLLCEQRLKDLGVLGSFIHREEYSLDLIPFDGDLLSMESEGAFKECYLEGDQTSLYHAAKGLMTLQALYGTIPQIFGKGECARQVANMMIRMKREFTGSQNSIFPVFDNLLLLDRNVDLLTPLATQLTYEGLIDEIYGIQNSYVKLPPEKFAPKKQGDGGKDLPTEAKKLQLNSAEELYAEIRDKNFNAVGSVLSKKAKIISAAFEERHNAKTVGEIKQFVSQLPHMQAARGSLANHTSIAELIKDVTNGVSLLLPRLQCNGTILAHRNLCLPGSSDSPASASQVAGITASEDFFDKLTVEQEFMSGIDTDKVNNYIEDCIAQKHSLIKVLRLVCLQSVCNSGLKQKVLDYYKREILQTYGYEHILTLHNLEKAGLLKPQTG------GRNNYPTIRKTLRLWMDDVNEQNPTDISYVYSGYAPLSVRLAQLLSRPGWRSIEEVLRILPGPHFEERQPLPTGLQKKRQPGENRVTLIFFLGGVTFAEIAALRFLSQLEDGGTEYVIATTKLMNGTSWIEALME 634          
BLAST of Vacuolar protein sorting-associated protein 33A vs. Ensembl Human
Match: AC048338.1 (novel protein)

HSP 1 Score: 210.69 bits (535), Expect = 9.734e-60
Identity = 145/566 (25.62%), Postives = 259/566 (45.76%), Query Frame = 2
Query:   83 GPVDLTYLNDTYKKELEDIFSKVTKPTIAIWDVKVKRSVYSIYSKESLEKAKISNVLIDDITTLEKTNKYXXXXXXXXXXXXMIDLVESVI---KRNLCEEYHLIFVPNILTCHEEYIRKKNLEIKFKSTGKFKCYGIPLENDLISLENPDFIMNMNDLTTLYDLAKTIMLIQSLYGTIPSVSGQGEKFQELMKILTVMKKSSPEQKSIKQSKIHQMLIFDRRIDMLTPLLCQITYEGLLDEFFKFSSGFICVPMFFFNKSDNMD-------DTELFQMNSSDVFYGEVRDAVIQDYMKKIVNFHNEVEAEREKYLKARKLEEMAEVTSNLKAFKSREKAAHFHFTMATILNKYTKRSNYSDLVTAQNHFISQKDCDKIHPIVEEYLIKNIDIGRVIQLICIQSLCSNGLKPKILNSYKREILRTYGLRYVAVLMRLEKMGLLTSQQTSSMIPLGERAFDTIVTTLDLVPESQNLN--CDVSNIYAGFVPIITRLVQYYFKPGWPSISRALNLLPGAETPSIAPVVSADSLSVQNTDRKVVLVVYIGGATFSEISTLRFLSQQEES 1744
            G V+L  L +  ++EL +   K       +WD  +      I     L++ ++  +       L   +    I F       M  + E+V+   +R    ++H++FVP      E+ ++   +   F    ++    IP + DL+S+E+                                       F+++  ++  MK+     ++        +L+ DR +D+LTPL  Q+TYEGL+DE +   + ++ +P   F      D       + +  Q+NS++  Y E+RD         +      + A  E+   A+ + E+ +  S L   ++   +   H ++A ++   T   ++ D +T +  F+S  D DK++  +E+ + +   + +V++L+C+QS+C++GLK K+L+ YKREIL+TYG  ++  L  LEK GLL  Q        G   + TI  TL L  +  N     D+S +Y+G+ P+  RL Q   +PGW SI   L +LPG       P+ +      Q  + +V L+ ++GG TF+EI+ LRFLSQ E+ 
Sbjct:    8 GRVNLNVLREAVRRELREFLDKCAGSKAIVWDEYLTGPFGLIAQYSLLKEHEVEKMFTLKGNRLPAADVKNIIFFVRPRLELMDIIAENVLSEDRRGPTRDFHILFVPRRSLLCEQRLKDLGVLGSFIHREEYSLDLIPFDGDLLSMESEG------------------------------------AFKQVANMMIRMKREFTGSQNSIFPVFDNLLLLDRNVDLLTPLATQLTYEGLIDEIYGIQNSYVKLPPEKFAPKKQGDGGKDLPTEAKKLQLNSAEELYAEIRDKNFNAVGSVLSKKAKIISAAFEERHNAKTVGEIKQFVSQLPHMQAARGSLANHTSIAELIKDVTTSEDFFDKLTVEQEFMSGIDTDKVNNYIEDCIAQKHSLIKVLRLVCLQSVCNSGLKQKVLDYYKREILQTYGYEHILTLHNLEKAGLLKPQTG------GRNNYPTIRKTLRLWMDDVNEQNPTDISYVYSGYAPLSVRLAQLLSRPGWRSIEEVLRILPGPHFEERQPLPTGLQKKRQPGENRVTLIFFLGGVTFAEIAALRFLSQLEDG 531          
BLAST of Vacuolar protein sorting-associated protein 33A vs. Ensembl Human
Match: VPS33B (VPS33B late endosome and lysosome associated [Source:HGNC Symbol;Acc:HGNC:12712])

HSP 1 Score: 142.124 bits (357), Expect = 4.033e-35
Identity = 107/479 (22.34%), Postives = 223/479 (46.56%), Query Frame = 2
Query:  485 IPLENDLISLENPDFIMNM---NDLTTLYDLAKTIMLIQSLYGTIPSVSGQGEKFQELMKILTVMKKSSPEQKSIKQSKIHQMLIFDRRIDMLTPLLCQITYEGLLDEFFKFSSGFICVPMFFFNKSDNMDDTELFQMNSSDVFYGEVRDAVIQDYMKKIVNFHNEVEAEREKYLKARKLEEMAE-VTSNLKAFKSREKAAHFHFTMATILNKYTKRSNYSDLVTAQNHFISQKDCDKIHPIVEEYLIKNIDIGRVIQLICIQSLCSNGLKPKILNSYKREILRTYGLRYVAVLMRLEKMGLLTSQQ------------------------TSSMIPLGERA-FDTIVTTLDLVPESQN-----LNCDVSNIYAG-FVPIITRLV-QYYFKPGWPSISRALNLLPGAETPSIAPVVSADSLSVQNTDRKVVLVVYIGGATFSEISTLRFLSQQEESNTSYIILTTGIITNVTFFESLAQ 1813
            +PL+ DL+S+E P+F  +     D   +  +A+ + L+ +LYG  P+  G G   +   ++   +++    +   ++ +I  + + DR +D +T L  Q+ YEGL+D+ F+      C  + F  +  + D +    +N+ D  + E+R+    +    +      ++A+ ++  +   +++M   V+  LK  K   +    H      + K   + ++ +L+  ++  +   +  +    +EE++ + +     ++L+C+ S+  NGL PK   S K + L++YG  ++     L + GLLT Q                         T +   L +R+ F  I   L+L+P         +  D++ ++ G +VP+  R++ Q   +  W  +   + LL  ++  +   +   D  S ++   +++LVV++GG TFSEIS LRFL +  E    +I LTT +  +    E++++
Sbjct:  119 LPLDVDLLSMELPEFFRDYFLEGDQRWINTVAQALHLLSTLYGPFPNCYGIGRCAKMAYELWRNLEEEEDGETKGRRPEIGHIFLLDRDVDFVTALCSQVVYEGLVDDTFRIK----CGSVDFGPEVTSSDKSLKVLLNAEDKVFNEIRNEHFSNVFGFLSQKARNLQAQYDRR-RGMDIKQMKNFVSQELKGLKQEHRLLSLHIGACESIMKKKTKQDFQELIKTEHALLEGFNIRESTSYIEEHIDRQVSPIESLRLMCLLSITENGLIPKDYRSLKTQYLQSYGPEHLLTFSNLRRAGLLTEQAPGDTLTAVESKVSKLVTDKAAGKITDAFSSLAKRSNFRAISKKLNLIPRVDGEYDLKVPRDMAYVFGGAYVPLSCRIIEQVLERRSWQGLDEVVRLLNCSDF-AFTDMTKEDKASSESL--RLILVVFLGGCTFSEISALRFLGR--EKGYRFIFLTTAVTNSARLMEAMSE 587          
BLAST of Vacuolar protein sorting-associated protein 33A vs. Ensembl Human
Match: VPS33B (VPS33B late endosome and lysosome associated [Source:HGNC Symbol;Acc:HGNC:12712])

HSP 1 Score: 141.739 bits (356), Expect = 6.962e-35
Identity = 107/479 (22.34%), Postives = 223/479 (46.56%), Query Frame = 2
Query:  485 IPLENDLISLENPDFIMNM---NDLTTLYDLAKTIMLIQSLYGTIPSVSGQGEKFQELMKILTVMKKSSPEQKSIKQSKIHQMLIFDRRIDMLTPLLCQITYEGLLDEFFKFSSGFICVPMFFFNKSDNMDDTELFQMNSSDVFYGEVRDAVIQDYMKKIVNFHNEVEAEREKYLKARKLEEMAE-VTSNLKAFKSREKAAHFHFTMATILNKYTKRSNYSDLVTAQNHFISQKDCDKIHPIVEEYLIKNIDIGRVIQLICIQSLCSNGLKPKILNSYKREILRTYGLRYVAVLMRLEKMGLLTSQQ------------------------TSSMIPLGERA-FDTIVTTLDLVPESQN-----LNCDVSNIYAG-FVPIITRLV-QYYFKPGWPSISRALNLLPGAETPSIAPVVSADSLSVQNTDRKVVLVVYIGGATFSEISTLRFLSQQEESNTSYIILTTGIITNVTFFESLAQ 1813
            +PL+ DL+S+E P+F  +     D   +  +A+ + L+ +LYG  P+  G G   +   ++   +++    +   ++ +I  + + DR +D +T L  Q+ YEGL+D+ F+      C  + F  +  + D +    +N+ D  + E+R+    +    +      ++A+ ++  +   +++M   V+  LK  K   +    H      + K   + ++ +L+  ++  +   +  +    +EE++ + +     ++L+C+ S+  NGL PK   S K + L++YG  ++     L + GLLT Q                         T +   L +R+ F  I   L+L+P         +  D++ ++ G +VP+  R++ Q   +  W  +   + LL  ++  +   +   D  S ++   +++LVV++GG TFSEIS LRFL +  E    +I LTT +  +    E++++
Sbjct:  146 LPLDVDLLSMELPEFFRDYFLEGDQRWINTVAQALHLLSTLYGPFPNCYGIGRCAKMAYELWRNLEEEEDGETKGRRPEIGHIFLLDRDVDFVTALCSQVVYEGLVDDTFRIK----CGSVDFGPEVTSSDKSLKVLLNAEDKVFNEIRNEHFSNVFGFLSQKARNLQAQYDRR-RGMDIKQMKNFVSQELKGLKQEHRLLSLHIGACESIMKKKTKQDFQELIKTEHALLEGFNIRESTSYIEEHIDRQVSPIESLRLMCLLSITENGLIPKDYRSLKTQYLQSYGPEHLLTFSNLRRAGLLTEQAPGDTLTAVESKVSKLVTDKAAGKITDAFSSLAKRSNFRAISKKLNLIPRVDGEYDLKVPRDMAYVFGGAYVPLSCRIIEQVLERRSWQGLDEVVRLLNCSDF-AFTDMTKEDKASSESL--RLILVVFLGGCTFSEISALRFLGR--EKGYRFIFLTTAVTNSARLMEAMSE 614          
BLAST of Vacuolar protein sorting-associated protein 33A vs. Ensembl Celegans
Match: vps-33.1 (Vacuolar protein sorting-associated protein 33A [Source:UniProtKB/Swiss-Prot;Acc:P34260])

HSP 1 Score: 109.383 bits (272), Expect = 1.046e-24
Identity = 111/508 (21.85%), Postives = 225/508 (44.29%), Query Frame = 2
Query:  377 YHLIFVPNILTCHEEYIRKKNLEIKF----KSTGKFKCYGIPLENDLISLENPDFIMNM---NDLTTLYDLAKTI-MLIQSLYGTIPS-------VSGQGEKFQELMKILTVMKKSSPEQKSIKQS--------KIHQMLIFDRRIDMLTPLLCQITYEGLLDEFFKFSS-GFICVPMFFFNKSDNMDDTELFQMNSSDVFYGEVR----DAVIQDYMKKIVNFHNEVEAEREKYLKARKLEEMAEVTSNLKAFKSREKAAHFHFTMATILNKYTKRSNYSDLVTAQNHFISQKDCDKIHPIVEEYLIKNIDIGRVIQLICIQSLCSNGLKPKILNSYKREILRTYGLRYVAVLMRLEKMGLLTSQQTSSMIPL--GERAFDTIVTTLDLVPE--SQNLNCDVSNIYAGFVPIITRLVQYYFK---PGWPSISRALNLLPGAETPSIAPVVSADSLSVQNTDRKVVLVVYIGGATFSEISTLR-FLSQQEESNTSYIILTTGIITNVT 1792
            Y + F+P       E ++ +  E K+    +S  +     +P + + +SL +P     +    D T L+  A  +  LI    G   S       +  +G+   ++ K++  ++ S+ E  S+ ++        KI+++++ DR +D LTP+L Q+T+ GLLDE +       + VP   F    + D  +  ++   D  Y  ++    +AV  +  K +    ++ + +R+K      + E + +   +    +R+K    H  +A ++  +      SD +  +   +   D DK  P++E+ +     +  V++LI + SL   GLKP +L  Y+R + ++YG   +  +++++KMGL+  +     +     +  F  +    D++PE  S+    D++  Y+GF P++ ++++   +    GWP                   V+   S  +   D +   V  IGG T SE++ +R  L       TS +I    ++ N+T
Sbjct:  118 YQVFFIPEAWFVVRESLKTR-AEGKYWERLESVKEIPLCWLPRDGECLSLSSPQIAARLLINGDWTHLHKCAVALNQLIDMCRGRSSSSNQRPMSIYAKGKWASDVAKMMGKIRNSA-EADSMTKNLDPIEGLLKINRIVLIDRWMDPLTPMLSQLTFYGLLDEIYGIGMVNSVKVPEMEFKNEKDGDPFQEKEVYLIDEVYHRLKHSHINAVSIEASKVLAEIRDDEQFDRDKM----SVAEYSVLVKKMPKIINRKKMIEVHMRLAEMIQSHV-YCKQSDSIKLERDLLEYSDSDKAIPLIEDLIFDASPLNAVLRLISVHSLTCGGLKPSVLQHYRRIVNQSYGSSALNKVLKMQKMGLIREKGGGGKMQCEYAQMMFQQMKKNHDMLPEEFSEAKLDDMAYAYSGFSPLLCKMLEEGDRVKWVGWPKT-----------------VIGDKSDLIAERDGRGTCVFVIGGLTRSELAIIRENLPNVALITTSALITGDKLLNNIT 601          
BLAST of Vacuolar protein sorting-associated protein 33A vs. Ensembl Celegans
Match: vps-33.2 (Vacuolar protein sorting-associated protein 33B [Source:UniProtKB/Swiss-Prot;Acc:Q18891])

HSP 1 Score: 97.4413 bits (241), Expect = 6.491e-21
Identity = 103/482 (21.37%), Postives = 208/482 (43.15%), Query Frame = 2
Query:  485 IPLENDLISLEN-----PDFIMNMNDLTTLYDLAKTIMLIQSLYGTIPSVSGQGEKFQELMKILTVMKKSSPEQKSIKQSKIHQMLIFDRRIDMLTPLLCQITYEGLLDEFFKFSSGFICVPM------------FFFNKSDNMDDTELFQMNSSDVFYGEVRDAVIQDYMKKIVN-----FHNEVEAEREKYLKARKLEEMAE----VTSNLKAFKSREKAAHFHFTMATILNKYTKRSNYSDLVTAQNHFI-----SQKDCDKIHPIVEEYLIKNIDIGRVIQLICIQSLCSNGLKPKILNSYKREILRTYGLRYVAVLMRLEKMGLLTSQQ---TSSMIPLGERAFDTIVTTLDLVPESQNLN----CDVSNIYAGFV-PIITRLVQYYFKPGWPSISRALNLLPGAETPSIAPVVSADSLSVQNTDRKVVLVVYIGGATFSEISTLRFLSQQEESNTSYIILTTGIITNVTFFESLAQ 1813
            +PLE+DL SL++     PD          L+ +A   + +Q+LYG IP+V G G + + L  ++  +  SS E ++     I  + +FDR++D +  LL   +YEGLL EFF    G +  P+            F + + +  +D E  Q N  D    +  + +      K V       H++ ++ ++   K+  ++++A+    V  +L+A K   K    H     ++    K  +Y  +   ++  +      ++  D +   V     +++    V+ ++ + SL  +G+     N +    L+ YG  ++  L  L    ++ +++       I    R ++T+     +V  ++ ++     D+S ++   + P++ ++V+     GW        +            ++AD     N  RK ++V   GG T+ E++ LR L+ Q+  N   +I TT +I    + E  A+
Sbjct:  146 LPLESDLFSLQHVESAQPD----------LFSVANMFVALQNLYGVIPTVYGLGSESKNLWNLVHALC-SSNELRARPDQPISHLFLFDRQLDPVPVLLTGASYEGLLHEFFTIDCGKLAFPVDLRKQVQTGPLDFDWIEINPEEDKEAHQQNRGDTVKLDNCEDIFASIRNKHVTAALEFLHSKAKSIQKSIEKSSMIDDVADYRNFVEKDLRALKKDHKHCELHINACEMMMNKVKMEDYRTMFKLEHEMLLGTVTHEEYFDFVFERVPMRSCRDV----VLSMMSLASLKLDGVPDDTYNEFVEMYLQKYGYEHMFELQNLRNSRVIYARRHIAHDRTISERARTWETLARKFRIVKGNEPMDMSNPSDMSYVFGARISPLLCKIVEDTIDHGWNQAEYERIIGKDKVLVEENTYIAADRRP-DNRTRKAIMVFVNGGITYWEVAALRLLAIQK--NFRILICTTHVIKKREYLEVRAK 609          
BLAST of Vacuolar protein sorting-associated protein 33A vs. Ensembl Fly
Match: car (gene:FBgn0000257 transcript:FBtr0074728)

HSP 1 Score: 217.238 bits (552), Expect = 1.044e-61
Identity = 144/516 (27.91%), Postives = 257/516 (49.81%), Query Frame = 2
Query:  374 EYHLIFVPNILTCHEEYIRKKNLEIKFKSTGKFKCYGIPLENDLISLENPDFIMNM---NDLTTLYDLAKTIMLIQSLYGTIPSVSGQGEKFQELMKILTVMKKSSPEQKSIKQSKIHQMLIFDRRIDMLTPLLCQITYEGLLDEFFKFSSGFICVPMFFFNKSDN------------------MDDTE--LFQMNSSDVFYGEVRDAVIQDYMKKIVNFHNEVEAEREKYLKARKLEEMAEVTSNL-KAFKSREKAAHFHFTMATILNKYTKRSNYSDLVTAQNHFISQKDCDKIHPIVEEYLIKNIDIGRVIQLICIQSLCSNGLKPKILNSYKREILRTYGLRYVAVLMRLEKMGLLTSQQTSSMIPLGERAFDTIVTTLDLVPESQNLNC---DVSNIYAGFVPIITRLVQYYFKP-GWPSISRALNLLPG-------AETPSIAP---VVSADSLSVQNTDRKVVLVVYIGGATFSEISTLRFLSQQEESNTSYIILTTGIITNVTFFESL 1807
            +YH++F P         +    +   F +  +     +PL+ DL+S+E P+   ++    D ++LY  A  ++ +Q LYG IP + G+GE    + +    + +      +  +  + Q+++ DR ID+L+PL  Q+TYEGL+DEF+      + +P   F  SD                   + DTE     ++S +  Y E+R+    +  K +     E+  +     + + ++E+     NL     +++KA   H  +A +L++      ++D + A+  F+   D DK    +E+ +   +++ RV++LIC+Q   ++G K K+LN YKRE++  YGL  +  +  LEK GLL  Q  S       RA+  +  TL L  +  N+     D+S +++ + P+  R+V++  KP GW ++   +N LPG       A+   I     V +    S+ N  R VVLV ++GG TF+EI+ LRFL+ QE++N  ++I TT ++   +F +SL
Sbjct:  109 QYHILFAPRRSCLCVSQLEVSGVLGSFGNIEELAWNYLPLDVDLVSMEMPNAFRDVSVDGDTSSLYQAAVGLVQLQRLYGRIPKIYGKGEFAHRVWEHAKQLGRDERTLYNGDKGVVDQLILLDRSIDLLSPLATQLTYEGLIDEFYGIRQNKLTLPAENF-PSDGALPGGGGSGPRVEESQSLLGDTEKKTILLHSGEQLYAELRNKHFNEVTKLLARKAREIHVQMHATSQDKSVQEIKSFVENLLPQLMAQKKATSEHTAIAGLLHEQVNAVRFADDLAAEQEFMVCADIDKPSAYIEDLIACRVELNRVLRLICMQCHAASGFKEKLLNHYKRELVHVYGLEVLLTISNLEKSGLLHLQTES-------RAYSVLRKTLHLTVDD-NVEIEPKDISYVHSFYAPLTARIVEHSLKPLGWQTLKSQINNLPGPTFEDFQAQLVGIGGRHTVTTVSEGSLLNVPR-VVLVCFVGGCTFAEIAALRFLAAQEDNNVEFLIATTKVVNKHSFLDSL 614          
BLAST of Vacuolar protein sorting-associated protein 33A vs. Ensembl Fly
Match: car (gene:FBgn0000257 transcript:FBtr0074727)

HSP 1 Score: 217.238 bits (552), Expect = 1.044e-61
Identity = 144/516 (27.91%), Postives = 257/516 (49.81%), Query Frame = 2
Query:  374 EYHLIFVPNILTCHEEYIRKKNLEIKFKSTGKFKCYGIPLENDLISLENPDFIMNM---NDLTTLYDLAKTIMLIQSLYGTIPSVSGQGEKFQELMKILTVMKKSSPEQKSIKQSKIHQMLIFDRRIDMLTPLLCQITYEGLLDEFFKFSSGFICVPMFFFNKSDN------------------MDDTE--LFQMNSSDVFYGEVRDAVIQDYMKKIVNFHNEVEAEREKYLKARKLEEMAEVTSNL-KAFKSREKAAHFHFTMATILNKYTKRSNYSDLVTAQNHFISQKDCDKIHPIVEEYLIKNIDIGRVIQLICIQSLCSNGLKPKILNSYKREILRTYGLRYVAVLMRLEKMGLLTSQQTSSMIPLGERAFDTIVTTLDLVPESQNLNC---DVSNIYAGFVPIITRLVQYYFKP-GWPSISRALNLLPG-------AETPSIAP---VVSADSLSVQNTDRKVVLVVYIGGATFSEISTLRFLSQQEESNTSYIILTTGIITNVTFFESL 1807
            +YH++F P         +    +   F +  +     +PL+ DL+S+E P+   ++    D ++LY  A  ++ +Q LYG IP + G+GE    + +    + +      +  +  + Q+++ DR ID+L+PL  Q+TYEGL+DEF+      + +P   F  SD                   + DTE     ++S +  Y E+R+    +  K +     E+  +     + + ++E+     NL     +++KA   H  +A +L++      ++D + A+  F+   D DK    +E+ +   +++ RV++LIC+Q   ++G K K+LN YKRE++  YGL  +  +  LEK GLL  Q  S       RA+  +  TL L  +  N+     D+S +++ + P+  R+V++  KP GW ++   +N LPG       A+   I     V +    S+ N  R VVLV ++GG TF+EI+ LRFL+ QE++N  ++I TT ++   +F +SL
Sbjct:  109 QYHILFAPRRSCLCVSQLEVSGVLGSFGNIEELAWNYLPLDVDLVSMEMPNAFRDVSVDGDTSSLYQAAVGLVQLQRLYGRIPKIYGKGEFAHRVWEHAKQLGRDERTLYNGDKGVVDQLILLDRSIDLLSPLATQLTYEGLIDEFYGIRQNKLTLPAENF-PSDGALPGGGGSGPRVEESQSLLGDTEKKTILLHSGEQLYAELRNKHFNEVTKLLARKAREIHVQMHATSQDKSVQEIKSFVENLLPQLMAQKKATSEHTAIAGLLHEQVNAVRFADDLAAEQEFMVCADIDKPSAYIEDLIACRVELNRVLRLICMQCHAASGFKEKLLNHYKRELVHVYGLEVLLTISNLEKSGLLHLQTES-------RAYSVLRKTLHLTVDD-NVEIEPKDISYVHSFYAPLTARIVEHSLKPLGWQTLKSQINNLPGPTFEDFQAQLVGIGGRHTVTTVSEGSLLNVPR-VVLVCFVGGCTFAEIAALRFLAAQEDNNVEFLIATTKVVNKHSFLDSL 614          
BLAST of Vacuolar protein sorting-associated protein 33A vs. Ensembl Fly
Match: car (gene:FBgn0000257 transcript:FBtr0331158)

HSP 1 Score: 216.853 bits (551), Expect = 1.719e-61
Identity = 144/516 (27.91%), Postives = 257/516 (49.81%), Query Frame = 2
Query:  374 EYHLIFVPNILTCHEEYIRKKNLEIKFKSTGKFKCYGIPLENDLISLENPDFIMNM---NDLTTLYDLAKTIMLIQSLYGTIPSVSGQGEKFQELMKILTVMKKSSPEQKSIKQSKIHQMLIFDRRIDMLTPLLCQITYEGLLDEFFKFSSGFICVPMFFFNKSDN------------------MDDTE--LFQMNSSDVFYGEVRDAVIQDYMKKIVNFHNEVEAEREKYLKARKLEEMAEVTSNL-KAFKSREKAAHFHFTMATILNKYTKRSNYSDLVTAQNHFISQKDCDKIHPIVEEYLIKNIDIGRVIQLICIQSLCSNGLKPKILNSYKREILRTYGLRYVAVLMRLEKMGLLTSQQTSSMIPLGERAFDTIVTTLDLVPESQNLNC---DVSNIYAGFVPIITRLVQYYFKP-GWPSISRALNLLPG-------AETPSIAP---VVSADSLSVQNTDRKVVLVVYIGGATFSEISTLRFLSQQEESNTSYIILTTGIITNVTFFESL 1807
            +YH++F P         +    +   F +  +     +PL+ DL+S+E P+   ++    D ++LY  A  ++ +Q LYG IP + G+GE    + +    + +      +  +  + Q+++ DR ID+L+PL  Q+TYEGL+DEF+      + +P   F  SD                   + DTE     ++S +  Y E+R+    +  K +     E+  +     + + ++E+     NL     +++KA   H  +A +L++      ++D + A+  F+   D DK    +E+ +   +++ RV++LIC+Q   ++G K K+LN YKRE++  YGL  +  +  LEK GLL  Q  S       RA+  +  TL L  +  N+     D+S +++ + P+  R+V++  KP GW ++   +N LPG       A+   I     V +    S+ N  R VVLV ++GG TF+EI+ LRFL+ QE++N  ++I TT ++   +F +SL
Sbjct:  109 QYHILFAPRRSCLCVSQLEVSGVLGSFGNIEELAWNYLPLDVDLVSMEMPNAFRDVSVDGDTSSLYQAAVGLVQLQRLYGRIPKIYGKGEFAHRVWEHAKQLGRDERTLYNGDKGVVDQLILLDRSIDLLSPLATQLTYEGLIDEFYGIRQNKLTLPAENF-PSDGALPGGGGSGPRVEESQSLLGDTEKKTILLHSGEQLYAELRNKHFNEVTKLLARKAREIHVQMHATSQDKSVQEIKSFVENLLPQLMAQKKATSEHTAIAGLLHEQVNAVRFADDLAAEQEFMVCADIDKPSAYIEDLIACRVELNRVLRLICMQCHAASGFKEKLLNHYKRELVHVYGLEVLLTISNLEKSGLLHLQTES-------RAYSVLRKTLHLTVDD-NVEIEPKDISYVHSFYAPLTARIVEHSLKPLGWQTLKSQINNLPGPTFEDFQAQLVGIGGRHTVTTVSEGSLLNVPR-VVLVCFVGGCTFAEIAALRFLAAQEDNNVEFLIATTKVVNKHSFLDSL 614          
BLAST of Vacuolar protein sorting-associated protein 33A vs. Ensembl Zebrafish
Match: vps33a (VPS33A core subunit of CORVET and HOPS complexes [Source:ZFIN;Acc:ZDB-GENE-040914-82])

HSP 1 Score: 274.248 bits (700), Expect = 4.032e-83
Identity = 175/602 (29.07%), Postives = 308/602 (51.16%), Query Frame = 2
Query:   83 GPVDLTYLNDTYKKELEDIFSKVTKPTIAIWDVKVKR-----SVYSIYSKESLEK------AKISNVLIDDITTLEKTNKYXXXXXXXXXXXXMIDLV-ESVIKRNLCE--EYHLIFVPNILTCHEEYIRKKNLEIKFKSTGKFKCYGIPLENDLISLENPDFIMNM---NDLTTLYDLAKTIMLIQSLYGTIPSVSGQGEKFQELMKILTVMKKSSPEQKSIKQSKIHQMLIFDRRIDMLTPLLCQITYEGLLDEFFKFSSGFICVPMFFFNKSDNMD-------DTELFQMNSSDVFYGEVRDAVIQDYMKKIVNFHNEVEAEREKYLKARKLEEMAEVTSNLKAFKSREKAAHFHFTMATILNKYTKRSNYSDLVTAQNHFISQKDCDKIHPIVEEYLIKNIDIGRVIQLICIQSLCSNGLKPKILNSYKREILRTYGLRYVAVLMRLEKMGLLTSQQTSSMIPLGERAFDTIVTTLDLVPE---SQNLNCDVSNIYAGFVPIITRLVQYYFKPGWPSISRALNLLPGAETPSIAPVVSADSLSVQNTDRKVVLVVYIGGATFSEISTLRFLSQQEESNTSYIILTTGIITNVTFFESL 1807
            G V+L  L +  +K+L +   K +     +WD  +       + YS+  +  +EK       +I +  + +I    +              ++++D++ E+V   +  +  E+H++FVP      E+ +++K +   F +  ++    IP + DL+S+E+          ND T+LY  AK +M +Q+LYGTIP + G+GE  + +  ++  MK+      +        +L+ DR +D+LTPL  Q+TYEGL+DE F  ++G++ +P   F +    +       + +  Q+NS++  Y E+RD         +      + A  E+   A+ + E+ +  S L   ++   +   H ++A ++   T    + D +T +  F++  D DK+   +E+ + +   + ++++L+C+QS+C+NGLK K+L+ YKREIL+TYG +++  L  LEK+GLL  Q T          + TI  TL L  E    QN N D+S +Y+G+ P+  RL Q   +PGW SI   L +LPG        V +      Q  + +  LV ++GG T++EI+ LRFLS  E+S T YII TT +I   ++ +SL
Sbjct:    8 GRVNLNILREAARKDLREFLDKCSGSKAIVWDEYLTGPFGLIAQYSLLKEHEVEKMFTLKGGRIPSAAVKNIVFFVRPR------------LELMDIIAENVSSEDKLQPREFHILFVPRRSLLCEQRLKEKGVLNSFTNIDEYILDLIPYDGDLLSMESESSFRECYLENDQTSLYHAAKGLMTLQALYGTIPQIFGKGECARHVANMMLRMKREFAGSHTQILPVFDTLLLLDRNVDLLTPLATQLTYEGLIDEIFGITNGYVKLPPEKFAQKKQGEGGKDLPTEPKKLQLNSAEELYAEIRDKNFNAVGAALSKKAKIISAAFEERHNAKTVGEIKQFVSQLPHMQAARSSLANHTSIAELIKDITTSEVFFDSLTVEQEFMTGVDTDKVSTYIEDCIAQKDPLIKILRLVCMQSVCNNGLKQKVLDYYKREILQTYGYKHILTLKNLEKVGLLKPQSTM------RNNYPTIRKTLKLWMEDANEQNPN-DISYVYSGYAPLSVRLTQVLARPGWRSIEEVLKMLPGPHFEERQQVPTGLHKKRQPGENRTTLVFFLGGVTYAEIAALRFLSHMEDSGTEYIIATTKLINGTSWVKSL 590          
BLAST of Vacuolar protein sorting-associated protein 33A vs. Ensembl Zebrafish
Match: vps33a (VPS33A core subunit of CORVET and HOPS complexes [Source:ZFIN;Acc:ZDB-GENE-040914-82])

HSP 1 Score: 274.248 bits (700), Expect = 4.032e-83
Identity = 175/602 (29.07%), Postives = 308/602 (51.16%), Query Frame = 2
Query:   83 GPVDLTYLNDTYKKELEDIFSKVTKPTIAIWDVKVKR-----SVYSIYSKESLEK------AKISNVLIDDITTLEKTNKYXXXXXXXXXXXXMIDLV-ESVIKRNLCE--EYHLIFVPNILTCHEEYIRKKNLEIKFKSTGKFKCYGIPLENDLISLENPDFIMNM---NDLTTLYDLAKTIMLIQSLYGTIPSVSGQGEKFQELMKILTVMKKSSPEQKSIKQSKIHQMLIFDRRIDMLTPLLCQITYEGLLDEFFKFSSGFICVPMFFFNKSDNMD-------DTELFQMNSSDVFYGEVRDAVIQDYMKKIVNFHNEVEAEREKYLKARKLEEMAEVTSNLKAFKSREKAAHFHFTMATILNKYTKRSNYSDLVTAQNHFISQKDCDKIHPIVEEYLIKNIDIGRVIQLICIQSLCSNGLKPKILNSYKREILRTYGLRYVAVLMRLEKMGLLTSQQTSSMIPLGERAFDTIVTTLDLVPE---SQNLNCDVSNIYAGFVPIITRLVQYYFKPGWPSISRALNLLPGAETPSIAPVVSADSLSVQNTDRKVVLVVYIGGATFSEISTLRFLSQQEESNTSYIILTTGIITNVTFFESL 1807
            G V+L  L +  +K+L +   K +     +WD  +       + YS+  +  +EK       +I +  + +I    +              ++++D++ E+V   +  +  E+H++FVP      E+ +++K +   F +  ++    IP + DL+S+E+          ND T+LY  AK +M +Q+LYGTIP + G+GE  + +  ++  MK+      +        +L+ DR +D+LTPL  Q+TYEGL+DE F  ++G++ +P   F +    +       + +  Q+NS++  Y E+RD         +      + A  E+   A+ + E+ +  S L   ++   +   H ++A ++   T    + D +T +  F++  D DK+   +E+ + +   + ++++L+C+QS+C+NGLK K+L+ YKREIL+TYG +++  L  LEK+GLL  Q T          + TI  TL L  E    QN N D+S +Y+G+ P+  RL Q   +PGW SI   L +LPG        V +      Q  + +  LV ++GG T++EI+ LRFLS  E+S T YII TT +I   ++ +SL
Sbjct:    8 GRVNLNILREAARKDLREFLDKCSGSKAIVWDEYLTGPFGLIAQYSLLKEHEVEKMFTLKGGRIPSAAVKNIVFFVRPR------------LELMDIIAENVSSEDKLQPREFHILFVPRRSLLCEQRLKEKGVLNSFTNIDEYILDLIPYDGDLLSMESESSFRECYLENDQTSLYHAAKGLMTLQALYGTIPQIFGKGECARHVANMMLRMKREFAGSHTQILPVFDTLLLLDRNVDLLTPLATQLTYEGLIDEIFGITNGYVKLPPEKFAQKKQGEGGKDLPTEPKKLQLNSAEELYAEIRDKNFNAVGAALSKKAKIISAAFEERHNAKTVGEIKQFVSQLPHMQAARSSLANHTSIAELIKDITTSEVFFDSLTVEQEFMTGVDTDKVSTYIEDCIAQKDPLIKILRLVCMQSVCNNGLKQKVLDYYKREILQTYGYKHILTLKNLEKVGLLKPQSTM------RNNYPTIRKTLKLWMEDANEQNPN-DISYVYSGYAPLSVRLTQVLARPGWRSIEEVLKMLPGPHFEERQQVPTGLHKKRQPGENRTTLVFFLGGVTYAEIAALRFLSHMEDSGTEYIIATTKLINGTSWVKSL 590          
BLAST of Vacuolar protein sorting-associated protein 33A vs. Ensembl Zebrafish
Match: vps33b (VPS33B late endosome and lysosome associated [Source:NCBI gene;Acc:541534])

HSP 1 Score: 161.77 bits (408), Expect = 8.416e-42
Identity = 130/537 (24.21%), Postives = 247/537 (46.00%), Query Frame = 2
Query:  335 DLVESVIKRNLCEEYHLIFVPNILTCHEEYIRKKNLEIKFKSTGKFKCYGIPLENDLISLENPDFIMN---MNDLTTLYDLAKTIMLIQSLYGTIPSVSGQG-------EKFQELMKILTVMKKSSPEQKSIKQSKIHQMLIFDRRIDMLTPLLCQITYEGLLDEFFKFSSGFICVPMFFFNKSDNMDDTELFQMNSSDVFYGEVRDAVIQDYMKKIVNFHNEVEAEREKYLKARK---LEEM-AEVTSNLKAFKSREKAAHFHFTMATILNKYTKRSNYSDLVTAQNHFISQKDCDKIHPIVEEYLIKNIDIGRVIQLICIQSLCSNGLKPKILNSYKREILRTYGLRYVAVLMRLEKMGLLTSQQTSSMIPLGERA-------------------------FDTIVTTLDLVPESQ-----NLNCDVSNIYAG-FVPIITRLV-QYYFKPGWPSISRALNLLPGAETPSIAPVVSADSLSVQNTDRKVVLVVYIGGATFSEISTLRFLSQQEESNTSYIILTTGIITNVTFFESL 1807
            DLV S         Y +IF P      E  + ++ +     +T ++  Y +PL++D++SLE P+F  +     D   +      + L+QS+YG+   V G G       E ++ELM+          EQ++ +Q +  ++ + DR +D +TPL  Q+ YEGL+D+ F+      C  + F     + D +    +NS D  + E+R+    ++   +  F ++     +     R+   +++M A V   LK  K   +    H   +  + K   + ++ +L+  ++  +   +  +    +EE++ + + +   ++L+C+ S+  NGL  K   S K + L++YG+ ++     L ++GLL  QQT   + + E                           F  +   L LVP+S       +  D++ I++G ++P+  +L+ Q   + GW  +     +L G +        S+++ +  N  R +VLV+++GG T+SEIS LRFL +  E    +I+LTT I  +    E+L
Sbjct:   97 DLVNSDKVAGRFRRYKIIFTPQKFYACETVLEEQGVYGDV-TTDEWNFYILPLDDDILSLELPEFFRDNFLEGDQRWVTTGGGALHLLQSVYGSFSKVYGIGRCAKMVYESWRELME--------EGEQRT-RQPEFAKVFLIDRDVDFVTPLCSQVVYEGLVDDIFRIK----CSSVEFGPDVTSSDKSIKVMLNSQDKVFNEIRN----EHFSNVFGFLSQKAKNLQTAYDKRRGMDIQQMKAFVADELKGLKQEHRLLSLHIGASESIMKKKTKQDFQELLKTEHSLLEGFEIRECIAYIEEHINRQVSMIDSLRLLCLLSITENGLLSKDYRSLKAQYLQSYGIEHLLTFANLRQLGLLEEQQTGETLTVMESKVGKLVNDKTAGKLTDAFSSLAKKSNFRALSKRLALVPKSGEEYDLRVPRDMAYIFSGAYIPLSCKLIEQVLERDGWTGLEEVTRMLNGQDFAVTGGSSSSEARNKSNGQR-IVLVMFLGGCTYSEISALRFLGK--ERGCRFIVLTTAITNSGRLLEAL 612          
BLAST of Vacuolar protein sorting-associated protein 33A vs. Ensembl Zebrafish
Match: vps33b (VPS33B late endosome and lysosome associated [Source:NCBI gene;Acc:541534])

HSP 1 Score: 161.77 bits (408), Expect = 8.416e-42
Identity = 130/537 (24.21%), Postives = 247/537 (46.00%), Query Frame = 2
Query:  335 DLVESVIKRNLCEEYHLIFVPNILTCHEEYIRKKNLEIKFKSTGKFKCYGIPLENDLISLENPDFIMN---MNDLTTLYDLAKTIMLIQSLYGTIPSVSGQG-------EKFQELMKILTVMKKSSPEQKSIKQSKIHQMLIFDRRIDMLTPLLCQITYEGLLDEFFKFSSGFICVPMFFFNKSDNMDDTELFQMNSSDVFYGEVRDAVIQDYMKKIVNFHNEVEAEREKYLKARK---LEEM-AEVTSNLKAFKSREKAAHFHFTMATILNKYTKRSNYSDLVTAQNHFISQKDCDKIHPIVEEYLIKNIDIGRVIQLICIQSLCSNGLKPKILNSYKREILRTYGLRYVAVLMRLEKMGLLTSQQTSSMIPLGERA-------------------------FDTIVTTLDLVPESQ-----NLNCDVSNIYAG-FVPIITRLV-QYYFKPGWPSISRALNLLPGAETPSIAPVVSADSLSVQNTDRKVVLVVYIGGATFSEISTLRFLSQQEESNTSYIILTTGIITNVTFFESL 1807
            DLV S         Y +IF P      E  + ++ +     +T ++  Y +PL++D++SLE P+F  +     D   +      + L+QS+YG+   V G G       E ++ELM+          EQ++ +Q +  ++ + DR +D +TPL  Q+ YEGL+D+ F+      C  + F     + D +    +NS D  + E+R+    ++   +  F ++     +     R+   +++M A V   LK  K   +    H   +  + K   + ++ +L+  ++  +   +  +    +EE++ + + +   ++L+C+ S+  NGL  K   S K + L++YG+ ++     L ++GLL  QQT   + + E                           F  +   L LVP+S       +  D++ I++G ++P+  +L+ Q   + GW  +     +L G +        S+++ +  N  R +VLV+++GG T+SEIS LRFL +  E    +I+LTT I  +    E+L
Sbjct:   97 DLVNSDKVAGRFRRYKIIFTPQKFYACETVLEEQGVYGDV-TTDEWNFYILPLDDDILSLELPEFFRDNFLEGDQRWVTTGGGALHLLQSVYGSFSKVYGIGRCAKMVYESWRELME--------EGEQRT-RQPEFAKVFLIDRDVDFVTPLCSQVVYEGLVDDIFRIK----CSSVEFGPDVTSSDKSIKVMLNSQDKVFNEIRN----EHFSNVFGFLSQKAKNLQTAYDKRRGMDIQQMKAFVADELKGLKQEHRLLSLHIGASESIMKKKTKQDFQELLKTEHSLLEGFEIRECIAYIEEHINRQVSMIDSLRLLCLLSITENGLLSKDYRSLKAQYLQSYGIEHLLTFANLRQLGLLEEQQTGETLTVMESKVGKLVNDKTAGKLTDAFSSLAKKSNFRALSKRLALVPKSGEEYDLRVPRDMAYIFSGAYIPLSCKLIEQVLERDGWTGLEEVTRMLNGQDFAVTGGSSSSEARNKSNGQR-IVLVMFLGGCTYSEISALRFLGK--ERGCRFIVLTTAITNSGRLLEAL 612          
BLAST of Vacuolar protein sorting-associated protein 33A vs. Ensembl Xenopus
Match: ENSXETT00000007947.1 (VPS33A, CORVET/HOPS core subunit [Source:NCBI gene;Acc:549689])

HSP 1 Score: 271.937 bits (694), Expect = 3.969e-82
Identity = 177/593 (29.85%), Postives = 299/593 (50.42%), Query Frame = 2
Query:   83 GPVDLTYLNDTYKKELEDIFSKVTKPTIAIWDVKVKRSVYSIYSKESLEKAKISNVLIDDITTLEKTNKYXXXXXXXXXXXXMIDLVESVIKRNLCEEYHLIFVPNILTCHEEYIRKKNLEIKFKSTGKFKCYGIPLENDLISLENPDFIMNM---NDLTTLYDLAKTIMLIQSLYGTIPSVSGQGEKFQELMKILTVMKKSSPEQKSIKQSKIHQMLIFDRRIDMLTPLLCQITYEGLLDEFFKFSSGFICVPMFFF-------NKSDNMDDTELFQMNSSDVFYGEVRDAVIQDYMKKIVNFHNEVEAEREKYLKARKLEEMAEVTSNLKAFKSREKAAHFHFTMATILNKYTKRSNYSDLVTAQNHFISQKDCDKIHPIVEEYLIKNIDIGRVIQLICIQSLCSNGLKPKILNSYKREILRTYGLRYVAVLMRLEKMGLLTSQQTSSMIPLGERAFDTIVTTLDLVPE---SQNLNCDVSNIYAGFVPIITRLVQYYFKPGWPSISRALNLLPGA---ETPSIAPVVSADSLSVQNTDRKVVLVVYIGGATFSEISTLRFLSQQEESNTSYIILTTGIITNVTFFESLAQ 1813
            G V+L  L +  + EL +   K       +WD  +      I     L++ ++  +       L  ++    I F       M      +I  N+  +++++FVP      E+ ++   +   F    +++   IP + DL+S+E+ +        ND T+LY  AK +  +QSLYGTIP + G+GE  + +  ++  MK+     ++        +L+ DR +D+LTPL  Q+TYEGL+DE +   +  + +P   F          D   + +   +NS++  Y E+RD         +      + A  E    A+ + E+ +  S L   ++ + +   H ++A ++ + T    + D +T +  F+S  D DK++P +E+ + K   I ++++L+C+QS+C+ GLK K+L+ YKREIL+TYG  ++  L  LEK GLL  Q +S        ++ TI  TL L  +    QN N D+S +Y+G+ P+  RL Q   +PGW SI   L +LPG    E  S+ P +       Q  + KV+LV ++GG TF+EI+ LRFLSQ E+  T YII TT +I+  T+ +SL +
Sbjct:    8 GRVNLNILREAMRMELREFLDKCAGSKAIVWDEYLTGPFGLIAQYSLLKEHEVEKMFTLKSGPLPSSDVKNIIFFVRPRLELM-----DIIADNIQRDFYILFVPRRSILCEQRLKDLGVLGSFMHRDEYRLNLIPFDGDLLSMESENAFKECYLENDQTSLYQAAKGLTTLQSLYGTIPQICGKGECARHVANMMIRMKRELGGSQNQITPVFDTLLLLDRNVDLLTPLATQLTYEGLIDEVYGIQNSHVKLPPEKFAPKKQGEGGKDLPTEPKKLLLNSAEELYAEIRDKNFNAVGSVLSKKAKIISAAFEGRHNAKTVGEIKQFVSQLPHMQAEKASLANHTSIAELIKEITTSEAFFDNLTVEQEFMSGFDTDKVNPYIEDCIAKKDPIIKILRLVCLQSVCNTGLKQKVLDYYKREILQTYGYEHILTLHNLEKAGLLKLQASS------RNSYPTIRKTLRLWMDDVNEQNPN-DISYVYSGYAPLSVRLAQILVRPGWRSIEEVLKILPGPQFEERQSLPPGLLKKR---QQGENKVILVFFLGGVTFAEIAALRFLSQMEDGGTEYIIATTKLISGTTWIKSLME 585          
BLAST of Vacuolar protein sorting-associated protein 33A vs. Ensembl Xenopus
Match: ENSXETT00000008043.1 (VPS33A, CORVET/HOPS core subunit [Source:NCBI gene;Acc:549689])

HSP 1 Score: 271.937 bits (694), Expect = 7.533e-82
Identity = 182/603 (30.18%), Postives = 312/603 (51.74%), Query Frame = 2
Query:   83 GPVDLTYLNDTYKKELEDIFSKVTKPTIAIWDVKVKRSVYSIYSKESLEKAKISNVLIDDITTLEKTNKYXXXXXXXXXXXXMIDLVESVIKRN-----LCEEYHLIFVPNILTCHEEYIRKKNLEIKFKSTGKFKCYGIPLENDLISLENPDFIMNM---NDLTTLYDLAKTIMLIQSLYGTIPSVSGQGEKFQELMKILTVMKKSSPEQKSIKQSKIHQMLIFDRRIDMLTPLLCQITYEGLLDEFFKFSSGFICVPMFFF-------NKSDNMDDTELFQMNSSDVFYGEVRDAVIQDYMKKIVNFHNEVEAEREKYLKARKLEEMAEVTSNLKAFKSREKAAHFHFTMATILNKYTKRSNYSDLVTAQNHFISQKDCDKIHPIVEEYLIKNIDIGRVIQLICIQSLCSNGLKPKILNSYKREILRTYGLRYVAVLMRLEKMGLLTSQQTSSMIPLGERAFDTIVTTLDLVPE---SQNLNCDVSNIYAGFVPIITRLVQYYFKPGWPSISRALNLLPGA---ETPSIAPVVSADSLSVQNTDRKVVLVVYIGGATFSEISTLRFLSQQEESNTSYIILTTGIITNVTFFESLAQPYELP 1828
            G V+L  L +  + EL +   K       +WD  +      I     L++ ++  +       L  ++  K+IIFF++  ++++D++   I+R         +++++FVP      E+ ++   +   F    +++   IP + DL+S+E+ +        ND T+LY  AK +  +QSLYGTIP + G+GE  + +  ++  MK+     ++        +L+ DR +D+LTPL  Q+TYEGL+DE +   +  + +P   F          D   + +   +NS++  Y E+RD         +      + A  E    A+ + E+ +  S L   ++ + +   H ++A ++ + T    + D +T +  F+S  D DK++P +E+ + K   I ++++L+C+QS+C+ GLK K+L+ YKREIL+TYG  ++  L  LEK GLL  Q +S        ++ TI  TL L  +    QN N D+S +Y+G+ P+  RL Q   +PGW SI   L +LPG    E  S+ P +       Q  + KV+LV ++GG TF+EI+ LRFLSQ E+  T YII TT +I+  T+ +SL +  E P
Sbjct:   21 GRVNLNILREAMRMELREFLDKCAGSKAIVWDEYLTGPFGLIAQYSLLKEHEVEKMFTLKSGPLPSSD-VKNIIFFVRPRLELMDIIADNIQREERGRFPQRDFYILFVPRRSILCEQRLKDLGVLGSFMHRDEYRLNLIPFDGDLLSMESENAFKECYLENDQTSLYQAAKGLTTLQSLYGTIPQICGKGECARHVANMMIRMKRELGGSQNQITPVFDTLLLLDRNVDLLTPLATQLTYEGLIDEVYGIQNSHVKLPPEKFAPKKQGEGGKDLPTEPKKLLLNSAEELYAEIRDKNFNAVGSVLSKKAKIISAAFEGRHNAKTVGEIKQFVSQLPHMQAEKASLANHTSIAELIKEITTSEAFFDNLTVEQEFMSGFDTDKVNPYIEDCIAKKDPIIKILRLVCLQSVCNTGLKQKVLDYYKREILQTYGYEHILTLHNLEKAGLLKLQASS------RNSYPTIRKTLRLWMDDVNEQNPN-DISYVYSGYAPLSVRLAQILVRPGWRSIEEVLKILPGPQFEERQSLPPGLLKKR---QQGENKVILVFFLGGVTFAEIAALRFLSQMEDGGTEYIIATTKLISGTTWIKSLMEKLEPP 612          
BLAST of Vacuolar protein sorting-associated protein 33A vs. Ensembl Xenopus
Match: ENSXETT00000008008.1 (VPS33A, CORVET/HOPS core subunit [Source:NCBI gene;Acc:549689])

HSP 1 Score: 262.307 bits (669), Expect = 4.064e-78
Identity = 182/622 (29.26%), Postives = 313/622 (50.32%), Query Frame = 2
Query:   83 GPVDLTYLNDTYKKELEDIFSKVTKPTIAIWDVKVKRSVYSIYSKESLEKAKISNVLIDDITTLEKTNKYXXXXXXXXXXXXMIDLVESVIKRN-----LCEEYHLIFVPNILTCHEEYIRKKNLEIKFKSTGKFKCYGIPLENDLISLENPDFIMNM---NDLTTLYDLAKTIMLIQSLYGTIPSVSGQGEKFQELMKILTVMKKSSPEQKSIKQSKIHQMLIFDRRIDMLTPLLCQITYEGLLDEFFKFSSGFICVPMFFF-------NKSDNMDDTELFQMNSSDVFYGEVRDAVIQDYMKKIVNFHNEVEAEREKYLKARKLEEMAEVTSNLKAFKSREKAAHFHFTMATILNKYTKR-------------------SNYSDLVTAQNHFISQKDCDKIHPIVEEYLIKNIDIGRVIQLICIQSLCSNGLKPKILNSYKREILRTYGLRYVAVLMRLEKMGLLTSQQTSSMIPLGERAFDTIVTTLDLVPE---SQNLNCDVSNIYAGFVPIITRLVQYYFKPGWPSISRALNLLPGA---ETPSIAPVVSADSLSVQNTDRKVVLVVYIGGATFSEISTLRFLSQQEESNTSYIILTTGIITNVTFFESLAQPYELP 1828
            G V+L  L +  + EL +   K       +WD  +      I     L++ ++  +       L  ++  K+IIFF++  ++++D++   I+R         +++++FVP      E+ ++   +   F    +++   IP + DL+S+E+ +        ND T+LY  AK +  +QSLYGTIP + G+GE  + +  ++  MK+     ++        +L+ DR +D+LTPL  Q+TYEGL+DE +   +  + +P   F          D   + +   +NS++  Y E+RD         +      + A  E    A+ + E+ +  S L   ++ + +   H ++A ++ + T +                     + D +T +  F+S  D DK++P +E+ + K   I ++++L+C+QS+C+ GLK K+L+ YKREIL+TYG  ++  L  LEK GLL  Q +S        ++ TI  TL L  +    QN N D+S +Y+G+ P+  RL Q   +PGW SI   L +LPG    E  S+ P +       Q  + KV+LV ++GG TF+EI+ LRFLSQ E+  T YII TT +I+  T+ +SL +  E P
Sbjct:    8 GRVNLNILREAMRMELREFLDKCAGSKAIVWDEYLTGPFGLIAQYSLLKEHEVEKMFTLKSGPLPSSD-VKNIIFFVRPRLELMDIIADNIQREERGRFPQRDFYILFVPRRSILCEQRLKDLGVLGSFMHRDEYRLNLIPFDGDLLSMESENAFKECYLENDQTSLYQAAKGLTTLQSLYGTIPQICGKGECARHVANMMIRMKRELGGSQNQITPVFDTLLLLDRNVDLLTPLATQLTYEGLIDEVYGIQNSHVKLPPEKFAPKKQGEGGKDLPTEPKKLLLNSAEELYAEIRDKNFNAVGSVLSKKAKIISAAFEGRHNAKTVGEIKQFVSQLPHMQAEKASLANHTSIAELIKEITSKFYILDDLEIAHLKVGISASEAFFDNLTVEQEFMSGFDTDKVNPYIEDCIAKKDPIIKILRLVCLQSVCNTGLKQKVLDYYKREILQTYGYEHILTLHNLEKAGLLKLQASS------RNSYPTIRKTLRLWMDDVNEQNPN-DISYVYSGYAPLSVRLAQILVRPGWRSIEEVLKILPGPQFEERQSLPPGLLKKR---QQGENKVILVFFLGGVTFAEIAALRFLSQMEDGGTEYIIATTKLISGTTWIKSLMEKLEPP 618          
BLAST of Vacuolar protein sorting-associated protein 33A vs. Ensembl Xenopus
Match: vps33b (vacuolar protein sorting 33 homolog B [Source:NCBI gene;Acc:100125133])

HSP 1 Score: 136.732 bits (343), Expect = 3.291e-33
Identity = 115/535 (21.50%), Postives = 230/535 (42.99%), Query Frame = 2
Query:  380 HLIFVPNILTCHEEYIRKKNLEIKFKSTGKFKC--------------------YGIPLENDLISLENPDFIMNM---NDLTTLYDLAKTIMLIQSLYGTIPSVSGQGEKFQELMKILTVMKKSSPEQKSIKQSKIHQMLIFDRRIDMLTPLLCQITYEGLLDEFFKFSSGFICVPMFFFNKSDNMDDTELFQMNSSDVFYGEVRDAVIQDYMKKIVNFHNEVEAEREKYLKARKLEEMAE-VTSNLKAFKSREKAAHFHFTMATILNKYTKRSNYSDLVTAQNHFISQKDCDKIHPIVEEYLIKNIDIGRVIQLICIQSLCSNGLKPKILNSYKREILRTYGLRYVAVLMRLEKMGLLTSQQTSSMIPLGERAFDTIVT-------------------------TLDLVPESQN-----LNCDVSNIYAG-FVPIITRLV-QYYFKPGWPSISRALNLLPGAETPSIAPVVSADSLSVQNT-DRKVVLVVYIGGATFSEISTLRFLSQQEESNTSYIILTTGIITNVTFFESLAQ 1813
            H+ F+ N++   +   R +  +I F     + C                    Y +PL++D+IS+E P+F  +     D   +  +AK + L+ S++G +    G G   + +  +   + +     +  ++S +  + + DR +D +TP+  Q+ YEGL+D+ F+      C  + F  +  + D +    +NS D  + E+R+    +    +      ++++ +K  +   + +M   V   LK  K   +    H      + K   + ++ +L+  ++  +   +  +    +EE++ + +     ++L+C+ S+   GL  K   S K + L++YG  ++     L++ GLLT Q     +   E     +VT                          L L+P            D++ I++G ++P+  +L+ Q   + GW  +     LL G E         A+ L  +N+  ++ ++ V++GG TFSEIS LRFL +  E+   +I LTT I       ES+ +
Sbjct:   90 HVKFIANLVRSDKASARNRKYKIIFSPQKFYTCDMVLEQEGIFGDVTCDEWSFYLLPLDDDIISMELPEFYRDYFLEGDQRWVGTVAKALHLLNSIFGPVSKTYGIGRCSKMVFDLWRDLLEDDEHDQKDRRSDLGLVFMIDRDVDYVTPMCSQVVYEGLVDDIFRIK----CGSVEFGPEVTSCDKSIKVLLNSQDKVFNEIRNEHFSNVFSFLSQKARNLQSQYDKR-QGMDIRQMKTFVAQELKGLKQEHRLLSLHIGACESIMKKKTKQDFQELMKTEHSLLEGFEIRESISFIEEHINRQVSPIESLRLLCLLSITEYGLITKDYRSLKTQYLQSYGPEHLLTFSNLKRTGLLTEQAPGETLTAVENKMSKLVTDKAAGKLTDAFSSLAKKSNFRGIGKKLGLIPRVDGEYDLKTPKDMAYIFSGAYIPLSCKLMEQVLQRKGWTGLEEVTRLLNGNEF--------AEQLCDRNSGSQRTIVAVFLGGCTFSEISALRFLGK--EAGYKFIFLTTSITNGARMLESMME 609          
BLAST of Vacuolar protein sorting-associated protein 33A vs. Ensembl Xenopus
Match: vps33b (vacuolar protein sorting 33 homolog B [Source:NCBI gene;Acc:100125133])

HSP 1 Score: 129.028 bits (323), Expect = 9.470e-31
Identity = 117/539 (21.71%), Postives = 230/539 (42.67%), Query Frame = 2
Query:  380 HLIFVPNILTCHEEYIRKKNLEIKFKSTGKFKC--------------------YGIPLENDLISLENPDFIMNM---NDLTTLYDLAKTIMLIQSLYGTIPSVSGQGEKFQELMKILTVMKKSSPEQKSIKQSKIHQMLIFDRRIDMLTPLLCQITYEGLLDEFFKFSSGFICVPMFFFNKSDNMDDTELFQMNSSDVFYGEVRDAVIQDYMKKIVNFHNEVEAEREKYLKARKLEEMAE-VTSNLKAFKSREKAAHFHFTMATILNKYTKRSNYSDLVTAQNHFISQKDCDKIH----PIVEEYLIKNIDIGRVIQLICIQSLCSNGLKPKILNSYKREILRTYGLRYVAVLMRLEKMGLLTSQQTSSMIPLGERAFDTIVT-------------------------TLDLVPESQN-----LNCDVSNIYAG-FVPIITRLV-QYYFKPGWPSISRALNLLPGAETPSIAPVVSADSLSVQNT-DRKVVLVVYIGGATFSEISTLRFLSQQEESNTSYIILTTGIITNVTFFESLAQ 1813
            H+ F+ N++   +   R +  +I F     + C                    Y +PL++D+IS+E P+F  +     D   +  +AK + L+ S++G +    G G   + +  +   + +     +  ++S +  + + DR +D +TP+  Q+ YEGL+D+ F+      C  + F  +  + D +    +NS D  + E+R+    +    +      ++++ +K  +   + +M   V   LK  K   +    H      + K   + ++ +L+  ++       C+ +     P   ++++ N     V++L+C+ S+   GL  K   S K + L++YG  ++     L++ GLLT Q     +   E     +VT                          L L+P            D++ I++G ++P+  +L+ Q   + GW  +     LL G E         A+ L  +N+  ++ ++ V++GG TFSEIS LRFL +  E+   +I LTT I       ES+ +
Sbjct:   90 HVKFIANLVRSDKASARNRKYKIIFSPQKFYTCDMVLEQEGIFGDVTCDEWSFYLLPLDDDIISMELPEFYRDYFLEGDQRWVGTVAKALHLLNSIFGPVSKTYGIGRCSKMVFDLWRDLLEDDEHDQKDRRSDLGLVFMIDRDVDYVTPMCSQVVYEGLVDDIFRIK----CGSVEFGPEVTSCDKSIKVLLNSQDKVFNEIRNEHFSNVFSFLSQKARNLQSQYDKR-QGMDIRQMKTFVAQELKGLKQEHRLLSLHIGACESIMKKKTKQDFQELMKTEH-------CNLMDLLEIPNSTDHIMTN-----VLRLLCLLSITEYGLITKDYRSLKTQYLQSYGPEHLLTFSNLKRTGLLTEQAPGETLTAVENKMSKLVTDKAAGKLTDAFSSLAKKSNFRGIGKKLGLIPRVDGEYDLKTPKDMAYIFSGAYIPLSCKLMEQVLQRKGWTGLEEVTRLLNGNEF--------AEQLCDRNSGSQRTIVAVFLGGCTFSEISALRFLGK--EAGYKFIFLTTSITNGARMLESMME 601          
BLAST of Vacuolar protein sorting-associated protein 33A vs. Ensembl Mouse
Match: Vps33a (VPS33A CORVET/HOPS core subunit [Source:MGI Symbol;Acc:MGI:1924823])

HSP 1 Score: 269.24 bits (687), Expect = 3.982e-81
Identity = 167/594 (28.11%), Postives = 296/594 (49.83%), Query Frame = 2
Query:   83 GPVDLTYLNDTYKKELEDIFSKVTKPTIAIWDVKVKRSVYSIYSKESLEKAKISNVLIDDITTLEKTNKYXXXXXXXXXXXXMIDLVESVI---KRNLCEEYHLIFVPNILTCHEEYIRKKNLEIKFKSTGKFKCYGIPLENDLISLENPDFIMNM---NDLTTLYDLAKTIMLIQSLYGTIPSVSGQGEKFQELMKILTVMKKSSPEQKSIKQSKIHQMLIFDRRIDMLTPLLCQITYEGLLDEFFKFSSGFICVPMFFF---------NKSDNMDDTELFQMNSSDVFYGEVRDAVIQDYMKKIVNFHNEVEAEREKYLKARKLEEMAEVTSNLKAFKSREKAAHFHFTMATILNKYTKRSNYSDLVTAQNHFISQKDCDKIHPIVEEYLIKNIDIGRVIQLICIQSLCSNGLKPKILNSYKREILRTYGLRYVAVLMRLEKMGLLTSQQTSSMIPLGERAFDTIVTTLDLVPESQNLN--CDVSNIYAGFVPIITRLVQYYFKPGWPSISRALNLLPGAETPSIAPVVSADSLSVQNTDRKVVLVVYIGGATFSEISTLRFLSQQEESNTSYIILTTGIITNVTFFESLAQ 1813
            G V+L  L +  ++EL +   K       +WD  +      I     L++ ++  +     + L   +    I         M  + E+V+   +R    ++H++FVP      E+ ++   +   F    ++    IP + DL+S+E+           D T+LY  AK +M +Q+LYGTIP + G+GE  +++  ++  MK+     ++        +L+ DR +D+LTPL  Q+TYEGL+DE +   + ++ +P   F            D   + +  Q+NS++  Y E+RD         +      + A  E+   A+ + E+ +  S L   ++   +   H ++A ++   T   ++ D +T +  F+S  D DK++  +E+ + +   + +V++L+C+QS+C++GLK K+L+ Y+REIL+TYG  ++  L  LEK GLL +Q        G   + TI  TL L  +  N     D+S +Y+G+ P+  RL Q   +PGW SI   L +LPG       P+ +      Q  + +V LV ++GG TF+EI+ LRFLSQ E+  T Y+I TT ++   ++ E+L +
Sbjct:    8 GRVNLNVLREAVRRELREFLDKCAGSKAIVWDEYLTGPFGLIAQYSLLKEHEVEKMFTLKGSRLPAADVKNIIFLVRPRLELMDIIAENVLSEDRRGPTRDFHILFVPRRSLLCEQRLKDLGVLGSFIHREEYSLDLIPFDGDLLSMESEGAFKECYLEGDQTSLYHAAKGLMTLQALYGTIPQIFGKGECARQVANMMVRMKREFTGSQNSVFPVFDNLLLLDRNVDLLTPLASQLTYEGLIDEIYGIQNSYVKLPPEKFAPKKQGGGSGGKDLPTEAKKLQLNSAEELYAEIRDKNFNAVGSVLSKKAKIISAAFEERHNAKTVGEIKQFVSQLPHMQAARGSLANHTSIAELIKDVTTSEDFFDKLTVEQEFMSGIDTDKVNSYIEDCIAQKHPLIKVLRLVCLQSVCNSGLKQKVLDYYRREILQTYGYEHILTLNNLEKAGLLKAQTG------GRNNYPTIRKTLRLWMDDVNEQNPTDISYVYSGYAPLSVRLAQLLSRPGWRSIEEVLRILPGPHFEERQPLPTGLQKKRQPGENRVTLVFFLGGVTFAEIAALRFLSQLEDGGTEYVIATTKLMNGNSWIEALME 595          
BLAST of Vacuolar protein sorting-associated protein 33A vs. Ensembl Mouse
Match: Vps33b (vacuolar protein sorting 33B [Source:MGI Symbol;Acc:MGI:2446237])

HSP 1 Score: 142.895 bits (359), Expect = 1.979e-35
Identity = 108/479 (22.55%), Postives = 221/479 (46.14%), Query Frame = 2
Query:  485 IPLENDLISLENPDFIMNM---NDLTTLYDLAKTIMLIQSLYGTIPSVSGQGEKFQELMKILTVMKKSSPEQKSIKQSKIHQMLIFDRRIDMLTPLLCQITYEGLLDEFFKFSSGFICVPMFFFNKSDNMDDTELFQMNSSDVFYGEVRDAVIQDYMKKIVNFHNEVEAEREKYLKARKLEEMAE-VTSNLKAFKSREKAAHFHFTMATILNKYTKRSNYSDLVTAQNHFISQKDCDKIHPIVEEYLIKNIDIGRVIQLICIQSLCSNGLKPKILNSYKREILRTYGLRYVAVLMRLEKMGLLTSQQ------------------------TSSMIPLGERA-FDTIVTTLDLVPESQN-----LNCDVSNIYAG-FVPIITRLV-QYYFKPGWPSISRALNLLPGAETPSIAPVVSADSLSVQNTDRKVVLVVYIGGATFSEISTLRFLSQQEESNTSYIILTTGIITNVTFFESLAQ 1813
            +PL+ DL+S+E P+F  +     D   +  +A+ + L+ +LYG  P+  G G   +    +   +++    +   ++ +I  + + DR +D +T L  Q+ YEGL+D+ F+      C  + F  +  + D +    +N+ D  + E+R+    +    +      ++A+ ++  +   +++M   V+  LK  K   +    H      + K   + ++ +L+  ++  +   +  +    +EE++ + +     ++L+C+ S+  NGL PK   S K + L++YG  ++     L + GLLT Q                         T +   L +R+ F  I   L+L+P         +  D++ +++G +VP+  R++ Q   +  W  +   + LL  +E    A   +A      +   +++LVV++GG TFSEIS LRFL +  E    +I LTT +  +    E++++
Sbjct:  146 LPLDVDLLSMELPEFFRDYFLEGDQRWINTVAQALHLLSTLYGPFPNCYGIGRCAKMSYDLWRKLEEEEDSETKGRKPEIGHIFLLDRDVDFVTALCSQVVYEGLVDDTFRIK----CGSVDFGPEVTSSDKSLKVLLNAEDKVFSEIRNEHFSNVFGFLSQKARNLQAQYDRR-RGMDIKQMKNFVSQELKGLKQEHRLLSLHIGACESIMKKKTKQDFQELIKTEHALLEGFNIRESTSYIEEHIDRQVSPIESLRLMCLLSITENGLIPKDYRSLKTQYLQSYGPEHLLTFSNLRRAGLLTEQAPGDTLTAVESKVSKLVTDKAAGKITDAFSSLAKRSNFRAISKKLNLIPRVDGEYDLKVPRDMAYVFSGAYVPLSCRIIEQVLDRRSWQGLDEVVRLLNCSE---FAFTDTAKEDKASSESLRLILVVFLGGCTFSEISALRFLGR--EKGYRFIFLTTAVTNSARLMEAMSE 614          
BLAST of Vacuolar protein sorting-associated protein 33A vs. Ensembl Mouse
Match: Vps33b (vacuolar protein sorting 33B [Source:MGI Symbol;Acc:MGI:2446237])

HSP 1 Score: 46.595 bits (109), Expect = 6.138e-6
Identity = 26/87 (29.89%), Postives = 50/87 (57.47%), Query Frame = 2
Query: 1484 DVSNIYAG-FVPIITRLVQYYF-KPGWPSISRALNLLPGAETPSIAPVVSADSLSVQNTDRKVVLVVYIGGATFSEISTLRFLSQQE 1738
            D++ +++G +VP+  R+++    +  W  +   + LL  +E    A   +A      +   +++LVV++GG TFSEIS LRFL +++
Sbjct:    7 DMAYVFSGAYVPLSCRIIEQVLDRRSWQGLDEVVRLLNCSE---FAFTDTAKEDKASSESLRLILVVFLGGCTFSEISALRFLGREK 90          
BLAST of Vacuolar protein sorting-associated protein 33A vs. UniProt/SwissProt
Match: sp|Q63615|VP33A_RAT (Vacuolar protein sorting-associated protein 33A OS=Rattus norvegicus OX=10116 GN=Vps33a PE=1 SV=1)

HSP 1 Score: 272.322 bits (695), Expect = 2.012e-81
Identity = 169/593 (28.50%), Postives = 296/593 (49.92%), Query Frame = 2
Query:   83 GPVDLTYLNDTYKKELEDIFSKVTKPTIAIWDVKVKRSVYSIYSKESLEKAKISNVLIDDITTLEKTNKYXXXXXXXXXXXXMIDLVESVI---KRNLCEEYHLIFVPNILTCHEEYIRKKNLEIKFKSTGKFKCYGIPLENDLISLENPDFIMNM---NDLTTLYDLAKTIMLIQSLYGTIPSVSGQGEKFQELMKILTVMKKSSPEQKSIKQSKIHQMLIFDRRIDMLTPLLCQITYEGLLDEFFKFSSGFICVPMFFF--------NKSDNMDDTELFQMNSSDVFYGEVRDAVIQDYMKKIVNFHNEVEAEREKYLKARKLEEMAEVTSNLKAFKSREKAAHFHFTMATILNKYTKRSNYSDLVTAQNHFISQKDCDKIHPIVEEYLIKNIDIGRVIQLICIQSLCSNGLKPKILNSYKREILRTYGLRYVAVLMRLEKMGLLTSQQTSSMIPLGERAFDTIVTTLDLVPESQNLN--CDVSNIYAGFVPIITRLVQYYFKPGWPSISRALNLLPGAETPSIAPVVSADSLSVQNTDRKVVLVVYIGGATFSEISTLRFLSQQEESNTSYIILTTGIITNVTFFESLAQ 1813
            G V+L  L +  ++EL +   K       +WD  +      I     L++ ++  +     + L   +    I         M  + E+V+   +R    ++H++FVP      E+ ++   +   F    ++    IP + DL+S+E+           D T+LY  AK +M +Q+LYGTIP + G+GE  +++  ++  MK+     ++        +L+ DR +D+LTPL  Q+TYEGL+DE +   + ++ +P   F           D   + +  Q+NS++  Y E+RD         +      + A  E+   A+ + E+ +  S L   ++   +   H ++A ++   T   ++ D +T +  F+S  D DK++  +E+ + +   + +V++L+C+QS+C++GLK K+L+ YKREIL+TYG  ++  L  LEK GLL +Q        G   + TI  TL L  +  N     D+S +Y+G+ P+  RL Q   +PGW SI   L +LPG       P+ +      Q  + +V LV ++GG TF+EI+ LRFLSQ E+  T Y+I TT +I   ++ E+L +
Sbjct:    8 GRVNLNVLREAVRRELREFLDKCAGSKAIVWDEYLTGPFGLIAQYSLLKEHEVEKMFTLKGSRLPAADVKNIIFLVRPRLELMDMIAENVLSEDRRGPTRDFHILFVPRRSLLCEQRLKDLGVLGSFIYREEYSLDLIPFDGDLLSMESESAFKECYLEGDQTSLYHAAKGLMTLQALYGTIPQIFGKGECARQVANMMVRMKREFTGSQNSVFPVFDNLLLLDRNVDLLTPLASQLTYEGLIDEIYGIQNSYVKLPPEKFAPKKQGGGGGKDLPTEAKKLQLNSAEELYAEIRDKNFNAVGSVLSKKAKIISAAFEERHNAKTVGEIKQFVSQLPHMQAARGSLANHTSIAELIKDVTTSEDFFDKLTVEQEFMSGIDTDKVNNYIEDCIAQKHPLIKVLRLVCLQSMCNSGLKQKVLDYYKREILQTYGYEHILTLNNLEKAGLLKAQTG------GRNNYPTIRKTLRLWMDDVNEQNPTDISYVYSGYAPLSVRLAQLLSRPGWRSIEEVLRILPGPHFEERQPLPTGVQKKRQPGENRVTLVFFLGGVTFAEIAALRFLSQLEDGGTEYVIATTKLINGSSWLEALME 594          
BLAST of Vacuolar protein sorting-associated protein 33A vs. UniProt/SwissProt
Match: sp|Q96AX1|VP33A_HUMAN (Vacuolar protein sorting-associated protein 33A OS=Homo sapiens OX=9606 GN=VPS33A PE=1 SV=1)

HSP 1 Score: 271.166 bits (692), Expect = 4.129e-81
Identity = 168/592 (28.38%), Postives = 295/592 (49.83%), Query Frame = 2
Query:   83 GPVDLTYLNDTYKKELEDIFSKVTKPTIAIWDVKVKRSVYSIYSKESLEKAKISNVLIDDITTLEKTNKYXXXXXXXXXXXXMIDLVESVI---KRNLCEEYHLIFVPNILTCHEEYIRKKNLEIKFKSTGKFKCYGIPLENDLISLENPDFIMNM---NDLTTLYDLAKTIMLIQSLYGTIPSVSGQGEKFQELMKILTVMKKSSPEQKSIKQSKIHQMLIFDRRIDMLTPLLCQITYEGLLDEFFKFSSGFICVPMFFFNKSDNMD-------DTELFQMNSSDVFYGEVRDAVIQDYMKKIVNFHNEVEAEREKYLKARKLEEMAEVTSNLKAFKSREKAAHFHFTMATILNKYTKRSNYSDLVTAQNHFISQKDCDKIHPIVEEYLIKNIDIGRVIQLICIQSLCSNGLKPKILNSYKREILRTYGLRYVAVLMRLEKMGLLTSQQTSSMIPLGERAFDTIVTTLDLVPESQNLN--CDVSNIYAGFVPIITRLVQYYFKPGWPSISRALNLLPGAETPSIAPVVSADSLSVQNTDRKVVLVVYIGGATFSEISTLRFLSQQEESNTSYIILTTGIITNVTFFESLAQ 1813
            G V+L  L +  ++EL +   K       +WD  +      I     L++ ++  +       L   +    I F       M  + E+V+   +R    ++H++FVP      E+ ++   +   F    ++    IP + DL+S+E+           D T+LY  AK +M +Q+LYGTIP + G+GE  +++  ++  MK+     ++        +L+ DR +D+LTPL  Q+TYEGL+DE +   + ++ +P   F      D       + +  Q+NS++  Y E+RD         +      + A  E+   A+ + E+ +  S L   ++   +   H ++A ++   T   ++ D +T +  F+S  D DK++  +E+ + +   + +V++L+C+QS+C++GLK K+L+ YKREIL+TYG  ++  L  LEK GLL  Q        G   + TI  TL L  +  N     D+S +Y+G+ P+  RL Q   +PGW SI   L +LPG       P+ +      Q  + +V L+ ++GG TF+EI+ LRFLSQ E+  T Y+I TT ++   ++ E+L +
Sbjct:    8 GRVNLNVLREAVRRELREFLDKCAGSKAIVWDEYLTGPFGLIAQYSLLKEHEVEKMFTLKGNRLPAADVKNIIFFVRPRLELMDIIAENVLSEDRRGPTRDFHILFVPRRSLLCEQRLKDLGVLGSFIHREEYSLDLIPFDGDLLSMESEGAFKECYLEGDQTSLYHAAKGLMTLQALYGTIPQIFGKGECARQVANMMIRMKREFTGSQNSIFPVFDNLLLLDRNVDLLTPLATQLTYEGLIDEIYGIQNSYVKLPPEKFAPKKQGDGGKDLPTEAKKLQLNSAEELYAEIRDKNFNAVGSVLSKKAKIISAAFEERHNAKTVGEIKQFVSQLPHMQAARGSLANHTSIAELIKDVTTSEDFFDKLTVEQEFMSGIDTDKVNNYIEDCIAQKHSLIKVLRLVCLQSVCNSGLKQKVLDYYKREILQTYGYEHILTLHNLEKAGLLKPQTG------GRNNYPTIRKTLRLWMDDVNEQNPTDISYVYSGYAPLSVRLAQLLSRPGWRSIEEVLRILPGPHFEERQPLPTGLQKKRQPGENRVTLIFFLGGVTFAEIAALRFLSQLEDGGTEYVIATTKLMNGTSWIEALME 593          
BLAST of Vacuolar protein sorting-associated protein 33A vs. UniProt/SwissProt
Match: sp|Q9D2N9|VP33A_MOUSE (Vacuolar protein sorting-associated protein 33A OS=Mus musculus OX=10090 GN=Vps33a PE=1 SV=2)

HSP 1 Score: 269.24 bits (687), Expect = 2.785e-80
Identity = 167/594 (28.11%), Postives = 296/594 (49.83%), Query Frame = 2
Query:   83 GPVDLTYLNDTYKKELEDIFSKVTKPTIAIWDVKVKRSVYSIYSKESLEKAKISNVLIDDITTLEKTNKYXXXXXXXXXXXXMIDLVESVI---KRNLCEEYHLIFVPNILTCHEEYIRKKNLEIKFKSTGKFKCYGIPLENDLISLENPDFIMNM---NDLTTLYDLAKTIMLIQSLYGTIPSVSGQGEKFQELMKILTVMKKSSPEQKSIKQSKIHQMLIFDRRIDMLTPLLCQITYEGLLDEFFKFSSGFICVPMFFF---------NKSDNMDDTELFQMNSSDVFYGEVRDAVIQDYMKKIVNFHNEVEAEREKYLKARKLEEMAEVTSNLKAFKSREKAAHFHFTMATILNKYTKRSNYSDLVTAQNHFISQKDCDKIHPIVEEYLIKNIDIGRVIQLICIQSLCSNGLKPKILNSYKREILRTYGLRYVAVLMRLEKMGLLTSQQTSSMIPLGERAFDTIVTTLDLVPESQNLN--CDVSNIYAGFVPIITRLVQYYFKPGWPSISRALNLLPGAETPSIAPVVSADSLSVQNTDRKVVLVVYIGGATFSEISTLRFLSQQEESNTSYIILTTGIITNVTFFESLAQ 1813
            G V+L  L +  ++EL +   K       +WD  +      I     L++ ++  +     + L   +    I         M  + E+V+   +R    ++H++FVP      E+ ++   +   F    ++    IP + DL+S+E+           D T+LY  AK +M +Q+LYGTIP + G+GE  +++  ++  MK+     ++        +L+ DR +D+LTPL  Q+TYEGL+DE +   + ++ +P   F            D   + +  Q+NS++  Y E+RD         +      + A  E+   A+ + E+ +  S L   ++   +   H ++A ++   T   ++ D +T +  F+S  D DK++  +E+ + +   + +V++L+C+QS+C++GLK K+L+ Y+REIL+TYG  ++  L  LEK GLL +Q        G   + TI  TL L  +  N     D+S +Y+G+ P+  RL Q   +PGW SI   L +LPG       P+ +      Q  + +V LV ++GG TF+EI+ LRFLSQ E+  T Y+I TT ++   ++ E+L +
Sbjct:    8 GRVNLNVLREAVRRELREFLDKCAGSKAIVWDEYLTGPFGLIAQYSLLKEHEVEKMFTLKGSRLPAADVKNIIFLVRPRLELMDIIAENVLSEDRRGPTRDFHILFVPRRSLLCEQRLKDLGVLGSFIHREEYSLDLIPFDGDLLSMESEGAFKECYLEGDQTSLYHAAKGLMTLQALYGTIPQIFGKGECARQVANMMVRMKREFTGSQNSVFPVFDNLLLLDRNVDLLTPLASQLTYEGLIDEIYGIQNSYVKLPPEKFAPKKQGGGSGGKDLPTEAKKLQLNSAEELYAEIRDKNFNAVGSVLSKKAKIISAAFEERHNAKTVGEIKQFVSQLPHMQAARGSLANHTSIAELIKDVTTSEDFFDKLTVEQEFMSGIDTDKVNSYIEDCIAQKHPLIKVLRLVCLQSVCNSGLKQKVLDYYRREILQTYGYEHILTLNNLEKAGLLKAQTG------GRNNYPTIRKTLRLWMDDVNEQNPTDISYVYSGYAPLSVRLAQLLSRPGWRSIEEVLRILPGPHFEERQPLPTGLQKKRQPGENRVTLVFFLGGVTFAEIAALRFLSQLEDGGTEYVIATTKLMNGNSWIEALME 595          
BLAST of Vacuolar protein sorting-associated protein 33A vs. UniProt/SwissProt
Match: sp|Q9Y1I2|VP33A_DROME (Vacuolar protein sorting-associated protein 33A OS=Drosophila melanogaster OX=7227 GN=car PE=1 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 1.047e-60
Identity = 144/516 (27.91%), Postives = 257/516 (49.81%), Query Frame = 2
Query:  374 EYHLIFVPNILTCHEEYIRKKNLEIKFKSTGKFKCYGIPLENDLISLENPDFIMNM---NDLTTLYDLAKTIMLIQSLYGTIPSVSGQGEKFQELMKILTVMKKSSPEQKSIKQSKIHQMLIFDRRIDMLTPLLCQITYEGLLDEFFKFSSGFICVPMFFFNKSDN------------------MDDTE--LFQMNSSDVFYGEVRDAVIQDYMKKIVNFHNEVEAEREKYLKARKLEEMAEVTSNL-KAFKSREKAAHFHFTMATILNKYTKRSNYSDLVTAQNHFISQKDCDKIHPIVEEYLIKNIDIGRVIQLICIQSLCSNGLKPKILNSYKREILRTYGLRYVAVLMRLEKMGLLTSQQTSSMIPLGERAFDTIVTTLDLVPESQNLNC---DVSNIYAGFVPIITRLVQYYFKP-GWPSISRALNLLPG-------AETPSIAP---VVSADSLSVQNTDRKVVLVVYIGGATFSEISTLRFLSQQEESNTSYIILTTGIITNVTFFESL 1807
            +YH++F P         +    +   F +  +     +PL+ DL+S+E P+   ++    D ++LY  A  ++ +Q LYG IP + G+GE    + +    + +      +  +  + Q+++ DR ID+L+PL  Q+TYEGL+DEF+      + +P   F  SD                   + DTE     ++S +  Y E+R+    +  K +     E+  +     + + ++E+     NL     +++KA   H  +A +L++      ++D + A+  F+   D DK    +E+ +   +++ RV++LIC+Q   ++G K K+LN YKRE++  YGL  +  +  LEK GLL  Q  S       RA+  +  TL L  +  N+     D+S +++ + P+  R+V++  KP GW ++   +N LPG       A+   I     V +    S+ N  R VVLV ++GG TF+EI+ LRFL+ QE++N  ++I TT ++   +F +SL
Sbjct:  109 QYHILFAPRRSCLCVSQLEVSGVLGSFGNIEELAWNYLPLDVDLVSMEMPNAFRDVSVDGDTSSLYQAAVGLVQLQRLYGRIPKIYGKGEFAHRVWEHAKQLGRDERTLYNGDKGVVDQLILLDRSIDLLSPLATQLTYEGLIDEFYGIRQNKLTLPAENF-PSDGALPGGGGSGPRVEESQSLLGDTEKKTILLHSGEQLYAELRNKHFNEVTKLLARKAREIHVQMHATSQDKSVQEIKSFVENLLPQLMAQKKATSEHTAIAGLLHEQVNAVRFADDLAAEQEFMVCADIDKPSAYIEDLIACRVELNRVLRLICMQCHAASGFKEKLLNHYKRELVHVYGLEVLLTISNLEKSGLLHLQTES-------RAYSVLRKTLHLTVDD-NVEIEPKDISYVHSFYAPLTARIVEHSLKPLGWQTLKSQINNLPGPTFEDFQAQLVGIGGRHTVTTVSEGSLLNVPR-VVLVCFVGGCTFAEIAALRFLAAQEDNNVEFLIATTKVVNKHSFLDSL 614          
BLAST of Vacuolar protein sorting-associated protein 33A vs. UniProt/SwissProt
Match: sp|Q94KJ7|VPS33_ARATH (Vacuolar protein-sorting-associated protein 33 homolog OS=Arabidopsis thaliana OX=3702 GN=VPS33 PE=1 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 4.213e-53
Identity = 155/606 (25.58%), Postives = 286/606 (47.19%), Query Frame = 2
Query:   80 NGPVDLTYLNDTYKKELEDIFSKVTKPTIAIWDVKVKRSVYSIYSKESLEKAKIS-NVLIDDITTLEKTNKYXXXXXXXXXXXXMIDLVESVIKRNLCEEYHLIFVPNILTCHEEYIRKKNLEIKFKSTGKFKCYGIPLENDLISLE----NPDFIMNMNDLTTLYDLAKTIMLIQSLYGTIPSVSGQGEKFQELMKILTVMKKSSP-EQKSIKQSKIHQMLIFDRRIDMLTPLLCQITYEGLLDEFFKFSSGFICVPMFFFNKSDNMDDTELFQMNSSDVFYGEVRDAVIQDYMKKIVNFHNEVEAEREKYLKARKLEEMAEVTSN-----LKAFKSR-----EKAAHFHFTMATILNKYTKRSNYSDLVTAQNHFISQKDCDKIHPIVEEYLIKNIDIGRVIQLICIQSLCSNGLKPKILNSYKREILRTYGLRYVAVLMRLEKMGLLTSQQTSSMIPLGERAFDTIVTTLDLVPESQNLN--CDVSNIYAGFVPIITRLVQYYFKPGWPSISRALNLLPGAE----------TPSIAPVVSADSLSVQNTDRKVVLVVYIGGATFSEISTLRFLSQQEESNTSYIILTTGIITNVTFFESLAQ 1813
            N P++L  + D  ++EL ++   V      + D K+  SV  I     L++  +    L  +    E T     +   +     +   +++ I + +  +Y++ FVP      E+ + ++ +     +  +F  Y +PL+ D+IS E      D +++  D+++L+ +AK I  ++  +G I  +  +G+    +  IL  M+   P     + + ++  +++ DR +DM+TP+  Q+TYEGL+DE    S+G + V              ++  +NSSD  + E RD          +NF   V+  R+K +  +  E+  E+ S      LK F  +     E   H H  +A  L  +T + +++  +  +   +  ++ D  +  +EE + K   +  V++L+ + S+ ++GL  K  +  + E+L +YG  +V  L  LEK GLL  Q+  S        + T+  TL L+ E  + +   D++ +Y+G+ P+  RL+Q     GW  +   L LLPG            +PS+  +  A S  V +  R +VLVV+IGG TF+EIS LR+L+ +E      I+ TT I+   T  E+  +
Sbjct:    9 NAPLNLKSIRDKSERELVNLLKDVRGTKCLVIDPKLSGSVSLIIPTSKLKELGLELRHLTAEPVQTECTKVVYLVRSQLSFMKFIASHIQNDIAKAIQRDYYVYFVPRRSVACEKILEQEKVH-NLVTVKEFPLYMVPLDEDVISFELELSEKDCLVD-GDVSSLWHIAKAIHELEFSFGVISKMRAKGKASVRVADILNRMQVEEPVNSNDVGRPEVDTLILLDREVDMVTPMCSQLTYEGLIDEILHISNGAVEVDSSVMGAQQEGKKMKV-PLNSSDKLFKETRD----------LNFEVVVQVLRQKAMTMK--EDYTEINSTQTVSELKDFVKKLNSLPEMTRHIH--LAQHLTTFTSKQSFNSQLDMEQTLVEAENYDICYEYIEEMIHKQEPLTNVLRLLVLFSVTNSGLPKKQFDYIRMELLHSYGFEHVVTLNNLEKAGLLKKQEFKS-------NWLTVKRTLKLIVEDTDTSRPNDIAYVYSGYAPLSIRLIQQAIHSGWRPMEDILKLLPGPHLETKRSGFPSSPSVDSLHGA-SNGVADGRRSIVLVVFIGGVTFAEISALRYLASKEGMAYDLIVATTKIVNGATLIETFME 589          
BLAST of Vacuolar protein sorting-associated protein 33A vs. TrEMBL
Match: V4A284 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_209143 PE=3 SV=1)

HSP 1 Score: 311.997 bits (798), Expect = 6.726e-94
Identity = 193/612 (31.54%), Postives = 325/612 (53.10%), Query Frame = 2
Query:   77 NNGPVDLTYLNDTYKKELEDIFSKVTKPTIAIWDVKVKRSVYSIYSKESLEKAKISNVLIDDITTLEKTNKYXXXXXXXXXXXXMIDLVESVI----KRNLCEEYHLIFVPNILTCHEEYIRKKNLEIKFKSTGKFKCYGIPLENDLISLENPDFIMNM---NDLTTLYDLAKTIMLIQSLYGTIPSVSGQGEKFQELMKILTVMKKSSPEQKSIKQSKIHQMLIFDRRIDMLTPLLCQITYEGLLDEFFKFSSGFICVPMFFF----NKSDNMDDTELFQMNSSDVFYGEVRDAVIQDYMKKIVNFHNEVEAEREKYLKARKLEEMAEVTSNLKAFKSREKAAHFHFTMATILNKYTKRSNYSDLVTAQNHFISQKDCDKIHPIVEEYLIKNIDIGRVIQLICIQSLCSNGLKPKILNSYKREILRTYGLRYVAVLMRLEKMGLLTSQQTSSMIPLGERAFDTIVTTLDLVPES---QNLNCDVSNIYAGFVPIITRLVQYYFKPGWPSISRALNLLPGAETPSIA--PVV------SADSLSVQNTDRKVVLVVYIGGATFSEISTLRFLSQQEESNTSYIILTTGIITNVTFFESLAQPYELPNSTNPF 1846
            ++G ++L  L D Y++EL +   + T     +WD  +      +     L+  ++  +      TL+ +N    I         M  + ++++    K  L  E+HLIFVP      E+ +++  +   F S  +F    +P +NDL+S+E           ND T+++ +A++IM +Q+LYG IP ++G+G+  +++++++  MK     ++     +I  +LI DR +D+LTPLL Q+TYEGL+DE F  ++  + +P   F     KSD   + + F +NSSD  Y ++RD         +      + AE ++  +A+ + EM +  + L   +   ++   H ++A ++ + T   ++ D +  Q  F++  D DK+HP +EE + K   I ++++LICIQS C++G+KPKIL  YKREI++TYG  ++  LM LE+ GLL         P   R +  I  +L L+ E    QN   D++ +Y+G+ P+  RL Q+  +PGW SI+  LNLLPG +   I   PV       S  S      D+KV LV ++GG T++EI+ LRFL+QQ++  T Y+I TT II   +F E L +  +     NPF
Sbjct:   10 SSGKINLGVLRDHYRRELVECIDRCTGTKALVWDDALTGPFGLVAEYSLLKDHEVEKMFPLGPKTLQPSNVQNIIFLTRPKLKLMELIAQNLLNEDQKGTLRTEFHLIFVPRKSLLCEKKLKEMGVYGTFTSVDEFSLELVPFDNDLLSMEMDTTFRECYLENDFTSMFYVAQSIMTLQALYGIIPYINGKGDCAKQVVEMMRRMKGELGGREPQITPQIDNLLIIDRNVDLLTPLLSQLTYEGLIDETFGLNNTSVKLPAEKFVPKNQKSDEPLEPKKFVLNSSDELYADLRDKNFNAVGSIVSRKAKAITAEFDERHQAKTVGEMKQFVTKLPHLQKARESLATHTSIAELVKEATNSEDFMDTLRCQQDFVNGLDTDKVHPYIEECIAKKHPITKILRLICIQSYCNDGMKPKILEYYKREIIQTYGFEHMLTLMNLERTGLLR--------PSSTRTYAIIRKSLRLIVEDVHEQN-PTDIAYVYSGYAPLSVRLAQHLARPGWRSITEVLNLLPGPKIEEIQQIPVALRKRRNSMTSSHSSTGDQKVTLVFFLGGVTYAEIAALRFLAQQDDGGTDYLIATTKIINGNSFIELLKEKVDTVK-LNPF 611          
BLAST of Vacuolar protein sorting-associated protein 33A vs. TrEMBL
Match: R7T769 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_101629 PE=3 SV=1)

HSP 1 Score: 304.294 bits (778), Expect = 4.546e-91
Identity = 192/611 (31.42%), Postives = 324/611 (53.03%), Query Frame = 2
Query:   77 NNGPVDLTYLNDTYKKELEDIFSKVTKPTIAIWDVKVKRSVYSIYSKESLEKAKISNVLIDDITTLEKTNKYXXXXXXXXXXXXMIDLVESVIKR----NLCEEYHLIFVPNILTCHEEYIRKKNLEIKFKSTGKFKCYGIPLENDLISLENP----DFIMNMNDLTTLYDLAKTIMLIQSLYGTIPSVSGQGEKFQELMKILTVMKKSSPEQKSIKQSKIHQMLIFDRRIDMLTPLLCQITYEGLLDEFFKFSSGFICVPMFFF--------NKSDNMDDTEL--FQMNSSDVFYGEVRDAVIQDYMKKIVNFHNEVEAEREKYLKARKLEEMAEVTSNLKAFKSREKAAHFHFTMATILNKYTKRSNYSDLVTAQNHFISQKDCDKIHPIVEEYLIKNIDIGRVIQLICIQSLCSNGLKPKILNSYKREILRTYGLRYVAVLMRLEKMGLLTSQQTSSMIPLGERAFDTIVTTLDLVPES---QNLNCDVSNIYAGFVPIITRLVQYYFKPGWPSISRALNLLPGAETPSIAPVVSADSLSVQNTDRKVVLVVYIGGATFSEISTLRFLSQQEESNTSYIILTTGIITNVTFFESLAQPYELPNSTNPF 1846
            +NGPV+L  L ++Y++EL +   K T     +WD  +   +  I     L++ ++  +       L+ +N    I     +   M ++ ++V+K        +++HL FVP      E+ ++   +   F +  +F    IP + D++S+E      D ++N +D T+LY  AK +M +Q+LYG IP++ G+G   + +++++  M++    Q+    ++I  +LI DR  D LTPLL Q+TYEGL+DE F  ++  + +P   F          ++N+  TE   F +NS++  + E+RD         +      + A+ ++   A+ + E+ +  S L   ++ + +   H ++A ++ + T +  +   + AQ  F    + DK HP +E+ + K   + +V++LICIQ +C+NG KPK+L  YKREIL+TYG  ++  L  LEK GLL  Q        G R + T+  TL L+ E    QN N D+S +Y+G+ P+  RL Q   +PGW SI  ALNLLPG     I  +        Q  ++KV LV ++GG T +EI+ LRFLS QE+S + YI+ TT +IT  ++ +S+A+      S NPF
Sbjct:    6 SNGPVNLGVLRESYRRELLECLDKCTGSKALVWDDNLTGPIGLIAEYSLLKEHEVDKMFPLRPGRLQPSNVQNIIFICRPNLALMENIAQNVLKEEEMGGFRKDFHLFFVPRKSFLCEKALKDLGVYGTFTNVDEFCLDLIPFDGDVLSMEMDLSYRDCVLN-DDWTSLYHAAKALMTLQALYGIIPNIQGKGPCAKHVVEMMLRMRREMAGQEPQIMAQIDHLLIIDRSTDPLTPLLSQLTYEGLIDEIFGINNTTVKLPGEKFAPQGKGGDEAAENITTTEPKKFILNSTEELFAELRDRNFNAVGPLLSRKAKLIAAQFDERHSAKTVGEIKQFVSKLPHMQAAKTSLATHTSIAELVKEETTKEEFMASLRAQQEFYGGMETDKAHPYIEDCIAKLEPLVKVLRLICIQCICNNGFKPKMLEFYKREILQTYGFEHLITLHNLEKAGLLKIQ--------GARTYPTLRKTLKLIVEEVNEQNPN-DISYVYSGYAPLSVRLAQIAHRPGWRSIHEALNLLPGPTIDEIQQIPMELRRRSQTGEQKVTLVFFLGGVTHAEIAALRFLSHQEDSPSEYIVATTKLITGDSWLKSIAENLS-AKSYNPF 605          
BLAST of Vacuolar protein sorting-associated protein 33A vs. TrEMBL
Match: A0A210QYW0 (Small G protein signaling modulator 1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT15887 PE=3 SV=1)

HSP 1 Score: 303.523 bits (776), Expect = 1.299e-90
Identity = 185/616 (30.03%), Postives = 325/616 (52.76%), Query Frame = 2
Query:   77 NNGPVDLTYLNDTYKKELEDIFSKVTKPTIAIWDVKVKRSVYSIYSKESLEKAKISNVLIDDITTLEKTNKYXXXXXXXXXXXXMIDLVESVI----KRNLCEEYHLIFVPNILTCHEEYIRKKNLEIKFKSTGKFKCYGIPLENDLISLENPDFIMNM---NDLTTLYDLAKTIMLIQSLYGTIPSVSGQGEKFQELMKILTVMKKSSPEQKSIKQSKIHQMLIFDRRIDMLTPLLCQITYEGLLDEFFKFSSGFICVPMFFFNKSDNM-DDTELFQ-------MNSSDVFYGEVRDAVIQDYMKKIVNFHNEVEAEREKYLKARKLEEMAEVTSNLKAFKSREKAAHFHFTMATILNKYTKRSNYSDLVTAQNHFISQKDCDKIHPIVEEYLIKNIDIGRVIQLICIQSLCSNGLKPKILNSYKREILRTYGLRYVAVLMRLEKMGLLTSQQTSSMIPLGERAFDTIVTTLDLVPESQNLN--CDVSNIYAGFVPIITRLVQYYFKPGWPSISRALNLLPGAETPSIA--PVV------SADSLSVQNTDRKVVLVVYIGGATFSEISTLRFLSQQEESNTSYIILTTGIITNVTFFESLAQPYELPN-STNPF 1846
            + G ++L+ L D Y++EL +   + +     +WD  +  +   I     L++ ++  +     + L  +N    I         M  + ++++    K    ++YH+IFVP      ++ +++  +     +  +F+   IP ++DL+S+E           ND T+++  A+++M +Q+LYG IP++ G+G+  + ++ ++  M++    ++     +I  +LI DR +D+LTPLL Q+TYEGL+DE F  ++  + +P   F   +   +D +          +NS D  Y ++RD         +      + AE ++   A+ + EM +  S L   +    +   H ++A ++ + T    + D +  Q  FI+  D DKIHP +E+ + +   I +V++L+CIQS C+NGLKPK+L+ YKREI++TYG  ++  LM +EK GLL         P G R++  I  ++ L+ +  N     D++ +Y+GF P+  RLVQYY +PGW SI+  LNLLPG     I   PV       S  S      ++KV LV ++GG T++EI+ LRFL+QQ++  T Y+I TT +I+  +F +S+A+  EL     NPF
Sbjct:    8 STGKINLSLLRDFYRRELLESLDRCSGTKALVWDDALTGAFGLIAEYSLLKEHEVEKMFPLRSSGLPPSNVQNIIFVTRPKLSLMEQIAQNLLQEEQKGGFRKDYHIIFVPRRSLLCDKKLKEMGVYGTITNFEEFQLSLIPFDSDLLSMEMESSFRECYLENDFTSMHYAAQSLMTLQALYGIIPNICGKGDCAKHIVDMMLRMRRELGGREPQITPQIDNLLILDRNVDLLTPLLSQLTYEGLIDEMFGINNTSVKLPPEKFQTGNQQQEDPQGVSSEPKKVILNSLDELYADLRDKNFNAVGSIVSKKAKVITAEFDERHTAKTVSEMKQFVSKLPHLQQVRASLSTHTSIAELVKEATDTDEFMDSLRCQQEFINGVDTDKIHPYIEDCMGRQEPINKVLRLVCIQSFCNNGLKPKVLDHYKREIIQTYGYEHMVTLMNIEKAGLLR--------PHGNRSYPAIRKSMRLIVDDVNEQNPHDIAYVYSGFAPLSARLVQYYARPGWRSITEVLNLLPGPTVEEIQQIPVALRKRRSSIGSTHSSTGEQKVTLVFFLGGVTYAEIAALRFLAQQDDGGTDYLIATTKVISGTSFLKSIAE--ELSAVKMNPF 613          
BLAST of Vacuolar protein sorting-associated protein 33A vs. TrEMBL
Match: A0A2T7PE15 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_07065 PE=3 SV=1)

HSP 1 Score: 299.671 bits (766), Expect = 2.919e-89
Identity = 164/495 (33.13%), Postives = 283/495 (57.17%), Query Frame = 2
Query:  371 EEYHLIFVPNILTCHEEYIRKKNLEIKFKSTGKFKCYGIPLENDLISLE-NPDFIMNM--NDLTTLYDLAKTIMLIQSLYGTIPSVSGQGEKFQELMKILTVMKKSSPEQKSIKQSKIHQMLIFDRRIDMLTPLLCQITYEGLLDEFFKFSSGFICVPMFFFNKSDNMD--DTELFQMNSSDVFYGEVRDAVIQDYMKKIVNFHNEVEAEREKYLKARKLEEMAEVTSNLKAFKSREKAAHFHFTMATILNKYTKRSNYSDLVTAQNHFISQKDCDKIHPIVEEYLIKNIDIGRVIQLICIQSLCSNGLKPKILNSYKREILRTYGLRYVAVLMRLEKMGLLTSQQTSSMIPLGERAFDTIVTTLDLVPESQNLN--CDVSNIYAGFVPIITRLVQYYFKPGWPSISRALNLLPGAETPSIAPVVSA--------DSLSVQNTDRKVVLVVYIGGATFSEISTLRFLSQQEESNTSYIILTTGIITNVTFFESLA 1810
            +EYHLIFVP      E  +++K +   F S  +F    IP + DL+S+E N  F  +   ND T+++ +A++++ +Q+LYGTI  + G+G+  + LM+++  M+     ++     +I  +LI DR +D+LTPLL Q+TYEGL+DE F  ++  + VP+   N   + D  +T+   +NSSD  + E+RD         +      + AE ++   A+ + EM +  S L   ++  ++   H T+A ++ + T    + D +  Q  FI+  + DK+HP +E+ + K   + +V++LICIQS+C++GLKPK+L+ YKREI++TYG  ++  L  LEK G+L         P G R++  I  +L L+ +  N     D++ +++G+ P+  RL QY  +PGW SI+  LNLLPG +   +  + SA         S      D+++ LV ++GG T++EI+ LRFL+Q ++ ++ +I+ +T ++T     E+LA
Sbjct:  112 KEYHLIFVPRKSLLCERKLKEKGVYGSFASVEEFNMGLIPFDADLLSMEMNEAFRESYVENDFTSMFYVAQSLITLQALYGTIQYIHGKGDCAKHLMEMMRRMRAEVSGKEPQVMPQIDSLLILDRTVDLLTPLLSQLTYEGLIDEIFGINNTSVKVPLDKLNPGGSQDAGETKKVVLNSSDALFAELRDKNFNAVGSIVSKKAKHITAEFDERHAAKTIGEMKQFVSKLPHLQATRQSLATHTTIAELIKEVTDSDPFIDALRCQQEFINGLETDKVHPFIEDCISKQEKLTKVLRLICIQSICNDGLKPKVLDFYKREIIQTYGFEHIVTLANLEKTGMLR--------PHGARSYQIIRKSLKLIVDDVNEQNPTDIAYVFSGYAPLSVRLAQYLARPGWRSITEVLNLLPGPKVEEVQQIPSALRKRRSSVSSSQSSTGDQRLTLVFFLGGVTYAEIAALRFLAQMDDVSSDFIVGSTSVLTGDVLLETLA 598          
BLAST of Vacuolar protein sorting-associated protein 33A vs. TrEMBL
Match: S4RM90 (VPS33A core subunit of CORVET and HOPS complexes OS=Petromyzon marinus OX=7757 PE=3 SV=1)

HSP 1 Score: 293.893 bits (751), Expect = 1.859e-87
Identity = 177/511 (34.64%), Postives = 283/511 (55.38%), Query Frame = 2
Query:  347 SVIKRNLC---EEYHLIFVPNILTCHEEYIRKKNLEIKFKSTGKFKCYGIPLENDLISLENPDFIMNM----NDLTTLYDLAKTIMLIQSLYGTIPSVSGQGEKFQELMKILTVMKKSSPEQKSIKQSKIHQMLIFDRRIDMLTPLLCQITYEGLLDEFFKFSSGFICVP--MFFFNKSDNMDDTEL------FQMNSSDVFYGEVRDAVIQDYMKKIVNFHNEVEAEREKYLKARKLEEMAEVTSNLKAFKSREKAAHFHFTMATILNKYTKRSNYSDLVTAQNHFISQKDCDKIHPIVEEYLIKNIDIGRVIQLICIQSLCSNGLKPKILNSYKREILRTYGLRYVAVLMRLEKMGLLTSQQTSSMIPLGERAFDTIVTTLDL----VPESQNLNCDVSNIYAGFVPIITRLVQYYFKPGWPSISRALNLLPGAETPSIAPVVSADSLSVQNTDRKVVLVVYIGGATFSEISTLRFLSQQEESNTSYIILTTGIITNVTFFESLAQPYE 1822
            S++K   C    EYHL+ VP      E+++++  +   F +  ++    IP ++DLIS+EN +F        ND T+L+ +AK +M +QSLYGTIP++SG+GE  + +  +L  M +     +      I  +LI DR +D+LTP+L Q+TYEGL+DE +   +  + +P   F   K D     EL        +NS++  Y E+RD       + +      + A+ E+  +A+ + E+ E  S L   ++ + +   H ++A ++ + T    + D +  +  FI+  D DK +  +EE + + + + RV++L+CIQSLC+NGLKPK+L  Y+REI++TYG  ++  L  LEK GLL  Q      P G   F T+  TL L    V E Q    DVS +Y+G+ P+  RL Q   +PGW  I  AL LLPG E     P+ +  +   ++T  ++ LV+++GG T +EIS +RFL Q E+SNT Y+I TT +I   ++ +SLA+  E
Sbjct:   72 SLLKEEGCSPGREYHLVCVPRRCVLCEQHLQQMGVFGTFATIQEYPLDFIPFDSDLISMEN-EFAFRECHLENDFTSLFHVAKGLMTMQSLYGTIPNISGKGEWARRVTDMLLRMHREMAGVQMHMPPAIDTLLIIDRSVDLLTPMLTQLTYEGLVDEIYGLQNTSVKLPPEKFQPRKQDGEAAAELPSEPKKLILNSAEELYAEIRDRNFNAVGEVLSRKARLITAQFEERHQAKTVGEIKEFVSKLPHMQAVKSSLATHTSIAELVQEVTHSDTFLDSLAVEQEFIAGIDTDKANVYIEEGIAQKLPLMRVLRLMCIQSLCNNGLKPKLLEYYRREIIQTYGFEHMLTLFNLEKAGLLKLQ------PPGRNNFPTLRKTLRLHQTDVNERQA-PTDVSYVYSGYAPLSVRLAQLSTRPGWRVIEEALKLLPGPEFHEKQPIPTGLA-HKRDTGSRITLVLFLGGVTSAEISAIRFLGQSEDSNTDYVIGTTKLINGTSWLQSLAEKLE 573          
BLAST of Vacuolar protein sorting-associated protein 33A vs. Ensembl Cavefish
Match: vps33a (VPS33A core subunit of CORVET and HOPS complexes [Source:NCBI gene;Acc:103022932])

HSP 1 Score: 271.552 bits (693), Expect = 4.545e-82
Identity = 175/600 (29.17%), Postives = 314/600 (52.33%), Query Frame = 2
Query:   83 GPVDLTYLNDTYKKELEDIFSKVTKPTIAIWDVKVKR-----SVYSIYSKESLEKA---KISNVLIDDITTLEKTNKYXXXXXXXXXXXXMIDLV-ESVIKRNLCE---EYHLIFVPNILTCHEEYIRKKNLEIKFKSTGKFKCYGIPLENDLISLENPDFIMNM---NDLTTLYDLAKTIMLIQSLYGTIPSVSGQGEKFQELMKILTVMKKSSPEQKSIKQSKIHQMLIFDRRIDMLTPLLCQITYEGLLDEFFKFSSGFICVPMFFFNKS-------DNMDDTELFQMNSSDVFYGEVRDAVIQDYMKKIVNFHNEVEAEREKYLKARKLEEMAEVTSNLKAFKSREKAAHFHFTMATILNKYTKRSNYSDLVTAQNHFISQKDCDKIHPIVEEYLIKNIDIGRVIQLICIQSLCSNGLKPKILNSYKREILRTYGLRYVAVLMRLEKMGLLTSQQTSSMIPLGERAFDTIVTTLDLVPE---SQNLNCDVSNIYAGFVPIITRLVQYYFKPGWPSISRALNLLPGAETPSIAPVVSADSLSVQNTDRKVVLVVYIGGATFSEISTLRFLSQQEESNTSYIILTTGIITNVTFFESL 1807
            G V+L  L +  +KEL +   K       +WD  +       + YS+  +  +EK    K   V   D+  +         IFF++  ++++D++ E+V+  +  +   E+H++FVP      E+ ++++ +   F +  ++    IP + DL+S+E+          ND T+LY  AK +M +Q+LYGTIP + G+GE  + +  ++  MK+     ++        +L+ DR +D+LTPL  Q+TYEGL+DE +  ++G++ +P   F +        D   + +  Q+NS++  Y E+RD         +      + A  E+   A+ + E+ +  S L   ++   +   H ++A ++   T   ++ + +T +  F++  D DK++  +E+ + +   + ++++L+C+QS+C+NGLK K+L+ YKREIL+TYG  ++  L  LEK+GLL  Q T+         + TI  TL L  E    QN N D+S +Y+G+ P+  RL Q   +PGW SI   L +LPG        + +      Q  + +  LV ++GG T++EI+ LRFLSQ E+  T Y+I TT ++   ++ +SL
Sbjct:    8 GRVNLNILREAARKELREFLDKCAGSKAIVWDEYLTGPFGLIAQYSLLKEHEVEKMFTLKAGRVPSADVKNI---------IFFVRPRLELMDIIAENVMSEDKLQPPREFHILFVPRRSLLCEQRLKEQGVLNSFTNIDEYILDLIPYDGDLLSMESESAFRECYLENDQTSLYHTAKGLMTLQALYGTIPQIFGKGECARHVANMMLRMKREFAGSQNQILPVFDTLLLLDRNVDLLTPLATQLTYEGLIDEIYGITNGYVKLPPEKFAQKKPGEGGKDLPTEPKKLQLNSAEELYAEIRDKNFNAVGAALSKKAKIISAAFEERHNAKTVGEIKQFVSQLPHMQAARNSLANHTSIAELIKDITTSEDFFENLTVEQEFMTGVDTDKVNTYIEDSIAQKDPLIKILRLVCMQSVCNNGLKQKVLDHYKREILQTYGYEHLLTLNNLEKVGLLKPQLTT------RNNYPTIRKTLKLWMEDANEQNPN-DISYVYSGYAPLSVRLTQLLARPGWRSIEEVLKMLPGPHFEERQQLPTGLHKKRQQGENRTTLVFFLGGVTYAEIAALRFLSQMEDGGTEYVIATTKLLNGTSWIKSL 591          
BLAST of Vacuolar protein sorting-associated protein 33A vs. Ensembl Cavefish
Match: vps33b (VPS33B late endosome and lysosome associated [Source:NCBI gene;Acc:103023658])

HSP 1 Score: 146.362 bits (368), Expect = 9.190e-37
Identity = 124/516 (24.03%), Postives = 243/516 (47.09%), Query Frame = 2
Query:  377 YHLIFVPNILTCHEEYIRKKNLEIKFKSTGKFKCYGIPLENDLISLENPDFIMN---MNDLTTLYDLAKTIMLIQSLYGTIPSVSGQGEKFQELMKILTVMKKSSPEQKSIKQSKIHQMLIFDRRIDMLTPLLCQITYEGLLDEFFKFSSGFICVPMFFFNKSDNMDDTELFQMNSSDVFYGEVRDAVIQDYMKKIVNFHNEVEAEREKYLKARK---LEEM-AEVTSNLKAFKSREKAAHFHFTMATILNKYTKRSNYSDLVTAQNHFISQKDCDKIHPIVEEYLIKNIDIGRVIQLICIQSLCSNGLKPKILNSYKREILRTYGLRYVAVLMRLEKMGLLTSQQ------------------------TSSMIPLGERA-FDTIVTTLDLVPESQ-----NLNCDVSNIYAG-FVPIITRLV-QYYFKPGWPSISRALNLLPGAETPSIAPVVSADSLSVQNTDRKVVLVVYIGGATFSEISTLRFLSQQEESNTSYIILTTGIITNVTFFESL 1807
            Y +IF P      E  + ++ +     +  ++  Y +PL++D+ISLE P+F        D   +      + LI SLYG    V G G+  +  M   +  ++    ++  +Q +I  + + DR +D +TPL  Q+ YEGL+D+ F+      C  + F  +  + D +    +NS D  + E+R+    ++   +  F ++     +     R+   +++M A V+  LK  K   +    H   +  + K   + ++ +L+  ++  +   +  +    +EE++ + I +   ++L+C+ SL  NGL PK   S K + L++YG+ ++     L++MGLL  QQ                        T +   L +++ F  +   L L+P+S       +  D++ I++G +VP+  +L+ Q   + GW  +     +L G E  +++   +     ++   +++VLV+++GG T+SEIS LRFL +  E    +I++TT I  +    E+L
Sbjct:  101 YKIIFTPQKFYACEAVLEEQGV-FGDVTCDEWAFYLLPLDDDIISLELPEFFRENFLEGDQRWVGAAGGALRLIHSLYGPFSKVYGIGQCAK--MVYESWREQVEDGEQKTQQPEIGNVFLIDRDVDFITPLCSQVVYEGLVDDIFRIK----CGSVEFGPEVTSSDKSIKVMLNSQDKVFNEIRN----EHFSNVFGFLSQKARNLQTAYDKRRGMDIQQMKAFVSEELKGLKQEHRLLSLHIGASECIMKKKTKQDFQELLKTEHSLLEGFEVRECVSFIEEHINRQISMIDSLRLLCLLSLTENGLLPKDYRSLKAQYLQSYGIEHLLTFSNLKQMGLLVEQQPGETLTVMESKVGKLVNDKTAGKLTDAFSSLAKKSNFRALSKRLVLIPKSGEEYDLRVPRDMAYIFSGAYVPLSCKLIEQVLERDGWTGLEEITRMLNGHEF-AVSGGANGTESRIKADSQRIVLVMFLGGCTYSEISALRFLGR--ERGYKFIVVTTAITNSGRLLEAL 602          
BLAST of Vacuolar protein sorting-associated protein 33A vs. Ensembl Cavefish
Match: vps33b (VPS33B late endosome and lysosome associated [Source:NCBI gene;Acc:103023658])

HSP 1 Score: 146.362 bits (368), Expect = 1.144e-36
Identity = 125/516 (24.22%), Postives = 239/516 (46.32%), Query Frame = 2
Query:  377 YHLIFVPNILTCHEEYIRKKNLEIKFKSTGKFKCYGIPLENDLISLENPDFIMN---MNDLTTLYDLAKTIMLIQSLYGTIPSVSGQGEKFQELMKILTVMKKSSPEQKSIKQSKIHQMLIFDRRIDMLTPLLCQITYEGLLDEFFKFSSGFICVPMFFFNKSDNMDDTELFQMNSSDVFYGEVRDAVIQDYM----KKIVNFHNEVEAEREKYLKARKLEEMAEVTSNLKAFKSREKAAHFHFTMATILNKYTKRSNYSDLVTAQNHFISQKDCDKIHPIVEEYLIKNIDIGRVIQLICIQSLCSNGLKPKILNSYKREILRTYGLRYVAVLMRLEKMGLLTSQQ------------------------TSSMIPLGERA-FDTIVTTLDLVPESQ-----NLNCDVSNIYAG-FVPIITRLV-QYYFKPGWPSISRALNLLPGAETPSIAPVVSADSLSVQNTDRKVVLVVYIGGATFSEISTLRFLSQQEESNTSYIILTTGIITNVTFFESL 1807
            Y +IF P      E  + ++ +     +  ++  Y +PL++D+ISLE P+F        D   +      + LI SLYG    V G G+  +  M   +  ++    ++  +Q +I  + + DR +D +TPL  Q+ YEGL+D+ F+      C  + F  +  + D +    +NS D  + E+R+    +      +K  N     +  R   ++  K    A V+  LK  K   +    H   +  + K   + ++ +L+  ++  +   +  +    +EE++ + I +   ++L+C+ SL  NGL PK   S K + L++YG+ ++     L++MGLL  QQ                        T +   L +++ F  +   L L+P+S       +  D++ I++G +VP+  +L+ Q   + GW  +     +L G E  +++   +     ++   +++VLV+++GG T+SEIS LRFL +  E    +I++TT I  +    E+L
Sbjct:  111 YKIIFTPQKFYACEAVLEEQGV-FGDVTCDEWAFYLLPLDDDIISLELPEFFRENFLEGDQRWVGAAGGALRLIHSLYGPFSKVYGIGQCAK--MVYESWREQVEDGEQKTQQPEIGNVFLIDRDVDFITPLCSQVVYEGLVDDIFRIK----CGSVEFGPEVTSSDKSIKVMLNSQDKVFNEIRNEHFSNVFGFLSQKARNLQTAYDKRRGMDIQQMK----AFVSEELKGLKQEHRLLSLHIGASECIMKKKTKQDFQELLKTEHSLLEGFEVRECVSFIEEHINRQISMIDSLRLLCLLSLTENGLLPKDYRSLKAQYLQSYGIEHLLTFSNLKQMGLLVEQQPGETLTVMESKVGKLVNDKTAGKLTDAFSSLAKKSNFRALSKRLVLIPKSGEEYDLRVPRDMAYIFSGAYVPLSCKLIEQVLERDGWTGLEEITRMLNGHEF-AVSGGANGTESRIKADSQRIVLVMFLGGCTYSEISALRFLGR--ERGYKFIVVTTAITNSGRLLEAL 612          
BLAST of Vacuolar protein sorting-associated protein 33A vs. Ensembl Cavefish
Match: vps33b (VPS33B late endosome and lysosome associated [Source:NCBI gene;Acc:103023658])

HSP 1 Score: 114.775 bits (286), Expect = 1.969e-26
Identity = 107/449 (23.83%), Postives = 209/449 (46.55%), Query Frame = 2
Query:  569 AKTIMLIQSLYGTIPSVSGQGEKFQELMKILTVMKKSSPEQKSIKQSKIHQMLIFDRRIDMLTPLLCQITYEGLLDEFFKFSSGFICVPMFFFNKSDNMDDTELFQMNSSDVFYGEVRDAVIQDYMKKIVNFHNEVEAEREKYLKARK---LEEM-AEVTSNLKAFKSREKAAHFHFTMATILNKYTKRSNYSDLVTAQNHFISQKDCDKIHPIVEEYLIKNIDIGRVIQLICIQSLCSNGLKPKILNSYKREILRTYGLRYVAVLMRLEKMGLLTSQQ------------------------TSSMIPLGERA-FDTIVTTLDLVPESQ-----NLNCDVSNIYAG-FVPIITRLV-QYYFKPGWPSISRALNLLPGAETPSIAPVVSADSLSVQNTDRKVVLVVYIGGATFSEISTLRFLSQQEESNTSYIILTTGIITNVTFFESL 1807
               + LI SLYG    V G G+  +  M   +  ++    ++  +Q +I  + + DR +D +TPL  Q+ YEGL+D+ F+      C  + F  +  + D +    +NS D  + E+R+    ++   +  F ++     +     R+   +++M A V+  LK  K   +    H   +  + K   + ++ +L+  ++  +   +  +    +EE++ + I +   ++L+C+ SL  NG      ++    ++++YG+ ++     L++MGLL  QQ                        T +   L +++ F  +   L L+P+S       +  D++ I++G +VP+  +L+ Q   + GW  +     +L G E       VSADS       +++VLV+++GG T+SEIS LRFL +  E    +I++TT I  +    E+L
Sbjct:  138 GGALRLIHSLYGPFSKVYGIGQCAK--MVYESWREQVEDGEQKTQQPEIGNVFLIDRDVDFITPLCSQVVYEGLVDDIFRIK----CGSVEFGPEVTSSDKSIKVMLNSQDKVFNEIRN----EHFSNVFGFLSQKARNLQTAYDKRRGMDIQQMKAFVSEELKGLKQEHRLLSLHIGASECIMKKKTKQDFQELLKTEHSLLEGFEVRECVSFIEEHINRQISMIDSLRLLCLLSLTENG------DNCLFALVQSYGIEHLLTFSNLKQMGLLVEQQPGETLTVMESKVGKLVNDKTAGKLTDAFSSLAKKSNFRALSKRLVLIPKSGEEYDLRVPRDMAYIFSGAYVPLSCKLIEQVLERDGWTGLEEITRMLNGHEF-----AVSADS-------QRIVLVMFLGGCTYSEISALRFLGR--ERGYKFIVVTTAITNSGRLLEAL 556          
BLAST of Vacuolar protein sorting-associated protein 33A vs. Ensembl Sea Lamprey
Match: vps33a (VPS33A core subunit of CORVET and HOPS complexes [Source:ZFIN;Acc:ZDB-GENE-040914-82])

HSP 1 Score: 293.893 bits (751), Expect = 1.429e-91
Identity = 177/511 (34.64%), Postives = 283/511 (55.38%), Query Frame = 2
Query:  347 SVIKRNLC---EEYHLIFVPNILTCHEEYIRKKNLEIKFKSTGKFKCYGIPLENDLISLENPDFIMNM----NDLTTLYDLAKTIMLIQSLYGTIPSVSGQGEKFQELMKILTVMKKSSPEQKSIKQSKIHQMLIFDRRIDMLTPLLCQITYEGLLDEFFKFSSGFICVP--MFFFNKSDNMDDTEL------FQMNSSDVFYGEVRDAVIQDYMKKIVNFHNEVEAEREKYLKARKLEEMAEVTSNLKAFKSREKAAHFHFTMATILNKYTKRSNYSDLVTAQNHFISQKDCDKIHPIVEEYLIKNIDIGRVIQLICIQSLCSNGLKPKILNSYKREILRTYGLRYVAVLMRLEKMGLLTSQQTSSMIPLGERAFDTIVTTLDL----VPESQNLNCDVSNIYAGFVPIITRLVQYYFKPGWPSISRALNLLPGAETPSIAPVVSADSLSVQNTDRKVVLVVYIGGATFSEISTLRFLSQQEESNTSYIILTTGIITNVTFFESLAQPYE 1822
            S++K   C    EYHL+ VP      E+++++  +   F +  ++    IP ++DLIS+EN +F        ND T+L+ +AK +M +QSLYGTIP++SG+GE  + +  +L  M +     +      I  +LI DR +D+LTP+L Q+TYEGL+DE +   +  + +P   F   K D     EL        +NS++  Y E+RD       + +      + A+ E+  +A+ + E+ E  S L   ++ + +   H ++A ++ + T    + D +  +  FI+  D DK +  +EE + + + + RV++L+CIQSLC+NGLKPK+L  Y+REI++TYG  ++  L  LEK GLL  Q      P G   F T+  TL L    V E Q    DVS +Y+G+ P+  RL Q   +PGW  I  AL LLPG E     P+ +  +   ++T  ++ LV+++GG T +EIS +RFL Q E+SNT Y+I TT +I   ++ +SLA+  E
Sbjct:   72 SLLKEEGCSPGREYHLVCVPRRCVLCEQHLQQMGVFGTFATIQEYPLDFIPFDSDLISMEN-EFAFRECHLENDFTSLFHVAKGLMTMQSLYGTIPNISGKGEWARRVTDMLLRMHREMAGVQMHMPPAIDTLLIIDRSVDLLTPMLTQLTYEGLVDEIYGLQNTSVKLPPEKFQPRKQDGEAAAELPSEPKKLILNSAEELYAEIRDRNFNAVGEVLSRKARLITAQFEERHQAKTVGEIKEFVSKLPHMQAVKSSLATHTSIAELVQEVTHSDTFLDSLAVEQEFIAGIDTDKANVYIEEGIAQKLPLMRVLRLMCIQSLCNNGLKPKLLEYYRREIIQTYGFEHMLTLFNLEKAGLLKLQ------PPGRNNFPTLRKTLRLHQTDVNERQA-PTDVSYVYSGYAPLSVRLAQLSTRPGWRVIEEALKLLPGPEFHEKQPIPTGLA-HKRDTGSRITLVLFLGGVTSAEISAIRFLGQSEDSNTDYVIGTTKLINGTSWLQSLAEKLE 573          
BLAST of Vacuolar protein sorting-associated protein 33A vs. Ensembl Sea Lamprey
Match: vps33b (VPS33B late endosome and lysosome associated [Source:NCBI gene;Acc:541534])

HSP 1 Score: 137.502 bits (345), Expect = 1.938e-34
Identity = 125/487 (25.67%), Postives = 225/487 (46.20%), Query Frame = 2
Query:  485 IPLENDLISLENPDFIMNM---NDLTTLYDLAKTIMLIQSLYGTIPSVSGQGEKFQ---ELMKILTVMKKSSPEQKSIKQSKIHQMLIFDRRIDMLTPLLCQITYEGLLDEFFKFSSGFICVPMFFFNKSDNMDDTELFQMNSSDVFYGEVRDAVIQDYMKKIVNFHNEVEAEREKYLKARKL--EEMAEVTSN-LKAFKSREKAAHFHFTMATILNKYTKRSNYSDLVTAQNHFISQKDCDKIHPIVEEYLIKNIDIGRVIQLICIQSLCSNGLKPKILNSYKREILRTYGLRYVAVLMRLEKMGLLTSQQTSSMIPLGERAFDTIV------------TTL----------------------DLVPESQNLNCDVSNIYAGFVPIITRLV-QYYFKPGWPSISRALNLLPGAETPSIAPVVSADSLSVQNTDRKVVLVVYIGGATFSEISTLRFLSQQEESNTSYIILTTGIITNVTFFESLAQ 1813
            +PL+ND+I+LE PDF  +     + + L+ +AK+I  +QSL+G + +V G G   +   ELM++L+   +++  + S   S++  + + DR +D++TPL  Q+T+EGLLD+ F    G  C  + F  +    +      +NS D  + E+R+   Q +        ++ +  +  Y K   +  + M E  +N L+A K   ++   +      + K   +S++ +L+  ++  +      +    +EE + +   I  V++L+C+ S+   GL    + S K + L +YG   +  L  L K GLLT QQT   +   E     +V            T L                      D     +      +     ++P+  R+V Q   + GW  +     LL G E  S+  +  A++  +     K+VLV ++GG T+SEI+ LRFL + +  N  +++LTT II +    ESL +
Sbjct:  152 LPLDNDVITLELPDFFQDFFMDGNQSMLFTVAKSIHKLQSLFGPVRNVYGIGRAAKMVYELMELLS--NEANVRRSSTTNSEMGDLFLIDRDVDLITPLCSQVTFEGLLDDIF----GIKCGSVEFGPEVTGTEKKLKILLNSQDKVFREIRN---QHFSNVFGLLSSKAKVLQTNYDKRHDMNIQNMKEFVANELRALKQEHRSLSLYIGSCEAIMKRKTKSDFKELLKTEHSLLEGIAIRECISSIEEAINRQSPILDVLRLLCLLSVTEGGLVANDMRSLKTQFLHSYGTEQLLTLNNLRKAGLLTEQQTPETVTTMESKVGKLVSDKPSGKLTDAFTALQRKSHFRALSKKLNLLSLLARQDSRSRKRLRPAQPAGHGGAYMPLSCRIVEQVLDREGWNGLEEIARLLNGNEFSSLK-LGQAEAPGLSRA--KLVLVFFLGGCTYSEIAALRFLGRTKGYN--FVVLTTSIINSTRLLESLVE 624          
BLAST of Vacuolar protein sorting-associated protein 33A vs. Ensembl Yeast
Match: VPS33 (ATP-binding protein that is a subunit of the HOPS and CORVET complexes; essential for protein sorting, vesicle docking, and fusion at the vacuole; binds to SNARE domains [Source:SGD;Acc:S000004388])

HSP 1 Score: 82.8037 bits (203), Expect = 5.589e-17
Identity = 95/441 (21.54%), Postives = 181/441 (41.04%), Query Frame = 2
Query:  722 MLIFDRRIDMLTPLLCQITYEGLLDEFFKFSSGFICVPMFFFNKSDNMDDTELFQMNSSDVFYGEVRDAVIQDYMKKIVNFHN----------EVEAEREKYLKARKLEEMAEVTSNLKAFKSREKAAHFHFTMATILNKYTKRSNYS--------DLVTAQNHFISQKDCDKIHPIVEEYLIKNIDIGRVIQLICIQSLCSNGLKPKILNSYKREILRTYGLRYVAVLMRLEKMGLLTSQQ-------TSSMIPLGERAFDTIVTTLDLVP--------ESQNLNCDVSN---IYAGFVPIITRLVQYYFKPG----------------WPSISRALNLL----------------PGAETPSI-APVVSADSLSVQNTD------RKVVLVVYIGGATFSEISTLRFLSQ---QEESNTSYIILTTGIITNVTFFESLA 1810
            ++I +R  D +TPLL Q+TY G+LD+ ++F+SG                     ++   D+ +    D +  D   K +NF +          E++ + +   KA  + E+ E   +L + + R+     H T+++ + K  +   Y         +L     + ++    D I  +  +Y    +D  ++++LIC+ SLC N L+ K     +  ++ ++G+     L  L ++G  TS+        T+S     ++ +  I    + VP        +  N N D S     Y+G VP+  RLVQ  +                    P +S+  +L+                PG  T  I A + S +  S+  ++        + LVV++GG T  EI+ ++ L +   ++  N  +II+  G+I       S++
Sbjct:  276 LIILERNTDPITPLLTQLTYAGILDDLYEFNSG--------------------IKIKEKDMNFNYKEDKIWNDL--KFLNFGSIGPQLNKLAKELQTQYDTRHKAESVHEIKEFVDSLGSLQQRQAFLKNHTTLSSDVLKVVETEEYGSFNKILELELEILMGNTLNNDIEDIILELQYQY---EVDQKKILRLICLLSLCKNSLREKDYEYLRTFMIDSWGIEKCFQLESLAELGFFTSKTGKTDLHITTSKSTRLQKEYRYISQWFNTVPIEDEHAADKITNENDDFSEATFAYSGVVPLTMRLVQMLYDRSILFHNYSSQQPFILSREPRVSQTEDLIEQLYGDSHAIEESIWVPGTITKKINASIKSNNRRSIDGSNGTFHAAEDIALVVFLGGVTMGEIAIMKHLQKILGKKGINKRFIIIADGLINGTRIMNSIS 691          
BLAST of Vacuolar protein sorting-associated protein 33A vs. Ensembl Nematostella
Match: EDO44186 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWL2])

HSP 1 Score: 196.823 bits (499), Expect = 5.347e-55
Identity = 127/419 (30.31%), Postives = 213/419 (50.84%), Query Frame = 2
Query:  641 QELMKILTVM---KKSSPEQKSIKQSKIHQMLIFDRRIDMLTPLLCQITYEGLLDEFFKFSSGFICVPMFFFNKSDN----------MDDTELFQMNSSDVFYGEVRDAVIQDYMKKIVNFHNEVEAEREKYLKARKLEEMAEVTSNLKAFKSREKAAHFHFTMATILNKYTKRSNYSDLVTAQNHFISQKDCDKIHPIVEEYLIKNIDIGRVIQLICIQSLCSNGLKPKILNSYKREILRTYGLRYVA-VLMRLEKMGLLTSQQTSSMIPLGERAFDTIVTTLDLVPE---SQNLNCDVSNIYAGFVPIITRLVQYYFKP-GWPSISRALNLLPGAETPSIAPVVSA-DSLSVQNTDRKVVLVVYIGGATFSEISTLRFLSQQEESNTSYIILTTGIITNVTFFESLAQPYELPNSTN 1840
            Q L ++L +M   K+   + +S    +I  +L+ DR +D+LTPL  Q+TYEGL+DE F   +     P   F + D+            D ++  +NS+D  + ++RD         +     ++ A  E++  A+ + EM +    L   +  + +   H T+A ++ + T + ++ + +  +  F    D +KI+  +E+Y+     + +V++LICIQ   +NG KPK+L  Y REI+ TYG   V+  L  LE +GLL         P G R +  +  ++ L  E    QN + D++ +Y+G+ P+  RL Q+  +P GW  +   L LLPG       P+          ++  KV LV +IGG T++E++ LRFLSQQ+ S T ++I TT +IT  T+  SL +   LP  T 
Sbjct:  178 QSLQRVLDMMMRKKREMADSESQLPPQIDTVLLLDRNVDLLTPLFTQLTYEGLIDELFGIHNTTAKFPHERFLQPDDKGVNPQPSGPQTDKKVV-LNSADELFSDIRDLNFSAVGVHLSRKAKQISAAFEEHKSAKTVGEMKQYVQRLPYMQKAKASLAMHMTIAELIKEETDKEDFRESIRIEQEFAQGLDTEKINSYIEKYIALKKPLTKVLRLICIQCQTNNGFKPKMLEYYIREIVHTYGFEQVSKTLTPLETVGLLR--------PQGARTYTAMRKSIKLFVEDVKEQNPD-DIAFVYSGYAPLSVRLAQFLSRPQGWRGLEEVLRLLPGPTIEERQPLPPGLQKRYTGDSPPKVTLVYFIGGCTYAEVAALRFLSQQDNSPTDFVIATTKMITGSTWLNSLVED-PLPKETQ 585          
BLAST of Vacuolar protein sorting-associated protein 33A vs. Ensembl Nematostella
Match: EDO44187 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWL4])

HSP 1 Score: 186.422 bits (472), Expect = 1.651e-51
Identity = 143/535 (26.73%), Postives = 261/535 (48.79%), Query Frame = 2
Query:   77 NNGPVDLTYLNDTYKKELEDIFSKVTKPTIAIWDVKVKRSVYSIYSKESLEKAKISNVLIDDITTLEKTNKYXXXXXXXXXXXXMIDLVESVI--KRNLCEEYHLIFVPNILTCHEEYIRKKNLEIKFKSTGKFKCYGIPLENDLISLENPDFIMNM---NDLTTLYDLAKTIMLIQSLYGTIPSVSGQGEK------FQELMKILTVM---KKSSPEQKSIKQSKIHQMLIFDRRIDMLTPLLCQITYEGLLDEFFKFSSGFICVPMFFFNKSDN----------MDDTELFQMNSSDVFYGEVRDAVIQDYMKKIVNFHNEVEAEREKYLKARKLEEMAEVTSNLKAFKSREKAAHFHFTMATILNKYTKRSNYSDLVTAQNHFISQKDCDKIHPIVEEYLIKNIDIGRVIQLICIQSLCSNGLKPKILNSYKREILRTYGLRYVA-VLMRLEKMGLLTSQQTSSMIPLGERAFDTIVTTLDLVPE---SQNLNCDVSNIYAGFVPIITRLVQYYFKP-GWPSISRALNLLPG 1594
            +NG +++  L +  ++EL     K       +WD K+    + + ++  L +    +V+          N+  ++IF  +  + ++D++   I  ++   ++YH++FVP      E   R K L + F +  ++    IPL+NDL+SLE           +D T+L+ +A ++M +Q LYG +P +  +GE        Q L ++L +M   K+   + +S    +I  +L+ DR +D+LTPL  Q+TYEGL+DE F   +     P   F + D+            D ++  +NS+D  + ++RD         +     ++ A  E++  A+ + EM +    L   +  + +   H T+A ++ + T + ++ + +  +  F    D +KI+  +E+Y+     + +V++LICIQ   +NG KPK+L  Y REI+ TYG   V+  L  LE +GLL  Q        G R +  +  ++ L  E    QN + D++ +Y+G+ P ++R V     P GW  +   L LLPG
Sbjct:   11 SNGRINVGLLRECSRRELLQCLDKHPGSKALVWDEKLT-GPFGLVAEYPLLREHEVDVMFSLKPGQLPPNQVVNVIFITRPILSLMDIIADNILNEKGKTKDYHILFVPRKTVLCEN--RLKALGVSFVNIEEYPLDFIPLDNDLLSLEMESSFKECYLESDYTSLFYVANSLMSLQLLYGVVPKIYAKGEMAKAIVCVQSLQRVLDMMMRKKREMADSESQLPPQIDTVLLLDRNVDLLTPLFTQLTYEGLIDELFGIHNTTAKFPHERFLQPDDKGVNPQPSGPQTDKKVV-LNSADELFSDIRDLNFSAVGVHLSRKAKQISAAFEEHKSAKTVGEMKQYVQRLPYMQKAKASLAMHMTIAELIKEETDKEDFRESIRIEQEFAQGLDTEKINSYIEKYIALKKPLTKVLRLICIQCQTNNGFKPKMLEYYIREIVHTYGFEQVSKTLTPLETVGLLRPQ--------GARTYTAMRKSIKLFVEDVKEQNPD-DIAFVYSGYAP-LSRYVNVAISPHGWRGLEEVLRLLPG 531          
BLAST of Vacuolar protein sorting-associated protein 33A vs. Ensembl Medaka
Match: vps33a (VPS33A core subunit of CORVET and HOPS complexes [Source:NCBI gene;Acc:101173947])

HSP 1 Score: 271.552 bits (693), Expect = 4.564e-82
Identity = 174/605 (28.76%), Postives = 307/605 (50.74%), Query Frame = 2
Query:   83 GPVDLTYLNDTYKKELEDIFSKVTKPTIAIWDVKVKR-----SVYSIYSKESLEK------AKISNVLIDDITTLEKTNKYXXXXXXXXXXXXMIDL----VESVIKRNLCEEYHLIFVPNILTCHEEYIRKKNLEIKFKSTGKFKCYGIPLENDLISLENPDFIMNM---NDLTTLYDLAKTIMLIQSLYGTIPSVSGQGEKFQELMKILTVMKKSSPEQKSIKQSKIHQMLIFDRRIDMLTPLLCQITYEGLLDEFFKFSSGFICVPMFFFNK-------SDNMDDTELFQMNSSDVFYGEVRDAVIQDYMKKIVNFHNEVEAEREKYLKARKLEEMAEVTSNLKAFKSREKAAHFHFTMATILNKYTKRSNYSDLVTAQNHFISQKDCDKIHPIVEEYLIKNIDIGRVIQLICIQSLCSNGLKPKILNSYKREILRTYGLRYVAVLMRLEKMGLLTSQQTSSMIPLGERAFDTIVTTLDLVPE---SQNLNCDVSNIYAGFVPIITRLVQYYFKPGWPSISRALNLLPGAETPSIAPVVSADSLSVQNTDRKVVLVVYIGGATFSEISTLRFLSQQEESNTSYIILTTGIITNVTFFESLAQ 1813
            G V+L  L +  +K+L +   K       +WD  +       + YS+  +  +EK       K+ N  + +I    +              ++++D+    V+S  + +   ++H++FVP      E+ ++ + +   F +  ++    IP + DL+S+E           ND T+LY  AK +M +Q+LYGTIP + G+G+  + +  ++  MK+     ++        +L+ DR +D+LTPL  Q+TYEGL+DE +  ++G++ +P   F +        D   + +  Q+NS++  Y E+RD         +      + A  E+   A+ + E+ +  S L   ++   +   H ++A ++   T    + D +T +  F++  D DK++  +E+ + +   + ++++L+C+QS+C+NGLK K+L+ YKREIL+TYG  ++  L  LEK+GLL  Q +S         + TI  TL L  E    QN N D+S +Y+G+ P+  RL Q   +PGW SI   L +LPG        + S      Q  + +  LV ++GG T++EIS LRFLSQ E+S   YII TT +I   T+ ++L +
Sbjct:    8 GKVNLNILREAARKDLREFLDKCAGSKAIVWDEYLTGPFGLIAQYSLLKEHEVEKMFTLKSGKLPNADVKNIIFFVRPR------------LELMDIIAKNVQSEDRLHSSRDFHILFVPRRSMLCEQRLKDQGVLGSFINMDEYILDLIPYDGDLLSMEYESAFRECYLENDQTSLYHTAKGLMTLQALYGTIPQIYGKGDCARHVANMMLRMKREFAGIQNQILPVFDTLLLLDRNVDLLTPLATQLTYEGLIDEIYGINNGYVKLPPEKFAQMKQGEASKDPPTEPKKLQLNSAEELYAEIRDKNFNAVGAALSKKAKIISAAFEERHNAKTVGEIKQFVSQLPHMQAARSSLANHTSIAELVKDITTSEAFFDSLTVEQEFMTGVDTDKVNTYIEDCIAQKDPLIKILRLVCMQSVCNNGLKQKVLDYYKREILQTYGYEHILTLHNLEKVGLLKPQTSS------RNNYPTIRKTLKLWMEDANEQNPN-DISYVYSGYAPLSIRLTQVLARPGWRSIEEVLKMLPGPHFEERQQLPSGLHKKRQQGENRTTLVFFLGGVTYAEISALRFLSQMEDSGMEYIIATTKLINGTTWIKTLME 593          
BLAST of Vacuolar protein sorting-associated protein 33A vs. Ensembl Medaka
Match: vps33a (VPS33A core subunit of CORVET and HOPS complexes [Source:NCBI gene;Acc:101173947])

HSP 1 Score: 241.121 bits (614), Expect = 6.489e-71
Identity = 181/614 (29.48%), Postives = 303/614 (49.35%), Query Frame = 2
Query:   83 GPVDLTYLNDTYKKELEDIFSKVTKPTIAIWDVKVKR-----SVYSIYSKESLEK------AKISNVLIDDITTLEKTNKYXXXXXXXXXXXXMIDL----VESVIKRNLCEEYHLIFVPNILTCHEEYIRKKNLEIKFKSTGKFKCYGIPLENDLISLENPDFIMNM---NDLTTLYDLAKTIMLIQSLYGTIPSVSGQGEKFQELMKILTVMKKSSPEQKSIKQSKIHQMLIFDRRIDMLTPLLCQITYEGLLDEFFKFSSGFICVPMFFFNK-------SDNMDDTELFQMNSSDVFYGEVRDAVIQDYMKKIVNFHNEVEAEREKYLKARKLEEMAEVTSNLKAFKSR--EKAAHFHFTMATIL---NKYT----KRSNYSDLVTAQNHFISQKDCDKIHPIVEEYLIKNIDIGRVIQLICIQSLCSNGLKPKILNSYKREILRTYGLRYVAVLMRLEKMGLLTSQQTSSMIPLGERAFDTIVTTLDLVPES---QNLNCDVSNIYAGFVPIITRLVQYYFKPGWPSISRALNLLPGAETPSIAPVVSADSLSVQNTDRKVVLVVYIGGATFSEISTLRFLSQQEESNTSYIILTTGIITNVTFFESLAQ 1813
            G V+L  L +  +K+L +   K       +WD  +       + YS+  +  +EK       K+ N  + +I    +              ++++D+    V+S  + +   ++H++FVP      E+ ++ + +   F +  ++    IP + DL+S+E           ND T+LY  AK +M +Q+LYGTIP + G+G+  + +  ++  MK+     ++        +L+ DR +D+LTPL  Q+TYEGL+DE +  ++G++ +P   F +        D   + +  Q+NS++  Y E+RD           NF N V A          L + A++ S   AF+ R         +  A IL   N Y      + N SDL      F++Q     ++  +E+ + +   + ++++L+C+QS+C+NGLK K+L+ YKREIL+TYG  ++  L  LEK+GLL  Q +S         + TI  TL L  E    QN N D+S +Y+G+ P+  RL Q   +PGW SI   L +LPG        + S      Q  + +  LV ++GG T++EIS LRFLSQ E+S   YII TT +I   T+ ++L +
Sbjct:    8 GKVNLNILREAARKDLREFLDKCAGSKAIVWDEYLTGPFGLIAQYSLLKEHEVEKMFTLKSGKLPNADVKNIIFFVRPR------------LELMDIIAKNVQSEDRLHSSRDFHILFVPRRSMLCEQRLKDQGVLGSFINMDEYILDLIPYDGDLLSMEYESAFRECYLENDQTSLYHTAKGLMTLQALYGTIPQIYGKGDCARHVANMMLRMKREFAGIQNQILPVFDTLLLLDRNVDLLTPLATQLTYEGLIDEIYGINNGYVKLPPEKFAQMKQGEASKDPPTEPKKLQLNSAEELYAEIRDK----------NF-NAVGA---------ALSKKAKIIS--AAFEVRLVPDLPILMYVSAWILLHTNPYNLVRVTKENRSDLSLC---FLTQ-----VNTYIEDCIAQKDPLIKILRLVCMQSVCNNGLKQKVLDYYKREILQTYGYEHILTLHNLEKVGLLKPQTSS------RNNYPTIRKTLKLWMEDANEQNPN-DISYVYSGYAPLSIRLTQVLARPGWRSIEEVLKMLPGPHFEERQQLPSGLHKKRQQGENRTTLVFFLGGVTYAEISALRFLSQMEDSGMEYIIATTKLINGTTWIKTLME 572          
BLAST of Vacuolar protein sorting-associated protein 33A vs. Ensembl Medaka
Match: vps33b (VPS33B late endosome and lysosome associated [Source:NCBI gene;Acc:101160132])

HSP 1 Score: 159.458 bits (402), Expect = 3.334e-41
Identity = 126/517 (24.37%), Postives = 241/517 (46.62%), Query Frame = 2
Query:  377 YHLIFVPNILTCHEEYIRKKNLEIKFKSTGKFKCYGIPLENDLISLENPDFIMN---MNDLTTLYDLAKTIMLIQSLYGTIPSVSGQGEKFQELMKILTVMKKSSPEQKSIKQSKIHQMLIFDRRIDMLTPLLCQITYEGLLDEFFKFSSGFICVPMFFFNKSDNMDDTELFQMNSSDVFYGEVRDAVIQDYMKKIVNFHNEVEAEREKYLKARKLEEMAE----VTSNLKAFKSREKAAHFHFTMATILNKYTKRSNYSDLVTAQNHFISQKDCDKIHPIVEEYLIKNIDIGRVIQLICIQSLCSNGLKPKILNSYKREILRTYGLRYVAVLMRLEKMGLLTSQQ------------------------TSSMIPLGERA-FDTIVTTLDLVPESQ-----NLNCDVSNIYAG-FVPIITRLV-QYYFKPGWPSISRALNLLPGAETPSIAPVVSADSLSVQNTD-RKVVLVVYIGGATFSEISTLRFLSQQEESNTSYIILTTGIITNVTFFESL 1807
            Y +IF P      E  + ++ +     +T ++  Y +PL++D++S+E P+F  +     D   L  +   + L+ S+YG    + G G   Q  M      ++    ++  + ++I  + + DR +D +TPL  Q+ YEGLLD+ F+   G  CV   F     + D +    +NS D  + E+R+    ++   +  F ++     +     R+  ++ +    V+  LK  K   +    H   +  + K   + ++ +L+  ++  +   +  +    +EE++ + I +   ++++C+ S+  NGL PK   S K + L++YG  ++     L ++GLL  QQ                        T +   L  R+ F  +   L+LVP+S       +  D++ I++G +VP+  RL+ Q   + GW  +     LL G E       V+  S +  N+D +++VLV+++GG TFSEIS LRFL + +     +I++TT +  +    E+L
Sbjct:  108 YKIIFTPQRFFACEAVLEEEGV-FGDVTTDEWAFYLLPLDDDILSMELPEFFHDNFLAGDQRWLRTVGGALHLLHSVYGPFSKLYGIGSCSQ--MTYEWWREQVEQGEQGARPAEIGSVFLIDRDVDFVTPLCSQVVYEGLLDDIFRIKCG--CVE--FGPDVTSSDRSVKVMLNSQDKVFNEIRN----EHFSNVFGFLSQKARNLQTAYDKRQGMDIKQMKTFVSEELKGLKQEHRLLSLHIGASESIMKKKTKQDFQELLQREHCLLEGFEIRESISFIEEHINRQISMMESLRMLCLLSITENGLLPKDYRSLKTQYLQSYGFDHLLTFSNLRQLGLLVEQQGAETLTVMESKVGKLVNDKTAGKITDAFSSLARRSHFRALSRKLNLVPKSDEEYDLRVPKDMAYIFSGAYVPLSCRLIEQVLERDGWAGLEDVTRLLNGHEF-----AVTGGSRAEPNSDAQRLVLVLFLGGCTFSEISALRFLGRAK--GYKFIVVTTAVTNSSRLLEAL 606          
BLAST of Vacuolar protein sorting-associated protein 33A vs. Ensembl Medaka
Match: vps33b (VPS33B late endosome and lysosome associated [Source:NCBI gene;Acc:101160132])

HSP 1 Score: 159.458 bits (402), Expect = 3.334e-41
Identity = 126/517 (24.37%), Postives = 241/517 (46.62%), Query Frame = 2
Query:  377 YHLIFVPNILTCHEEYIRKKNLEIKFKSTGKFKCYGIPLENDLISLENPDFIMN---MNDLTTLYDLAKTIMLIQSLYGTIPSVSGQGEKFQELMKILTVMKKSSPEQKSIKQSKIHQMLIFDRRIDMLTPLLCQITYEGLLDEFFKFSSGFICVPMFFFNKSDNMDDTELFQMNSSDVFYGEVRDAVIQDYMKKIVNFHNEVEAEREKYLKARKLEEMAE----VTSNLKAFKSREKAAHFHFTMATILNKYTKRSNYSDLVTAQNHFISQKDCDKIHPIVEEYLIKNIDIGRVIQLICIQSLCSNGLKPKILNSYKREILRTYGLRYVAVLMRLEKMGLLTSQQ------------------------TSSMIPLGERA-FDTIVTTLDLVPESQ-----NLNCDVSNIYAG-FVPIITRLV-QYYFKPGWPSISRALNLLPGAETPSIAPVVSADSLSVQNTD-RKVVLVVYIGGATFSEISTLRFLSQQEESNTSYIILTTGIITNVTFFESL 1807
            Y +IF P      E  + ++ +     +T ++  Y +PL++D++S+E P+F  +     D   L  +   + L+ S+YG    + G G   Q  M      ++    ++  + ++I  + + DR +D +TPL  Q+ YEGLLD+ F+   G  CV   F     + D +    +NS D  + E+R+    ++   +  F ++     +     R+  ++ +    V+  LK  K   +    H   +  + K   + ++ +L+  ++  +   +  +    +EE++ + I +   ++++C+ S+  NGL PK   S K + L++YG  ++     L ++GLL  QQ                        T +   L  R+ F  +   L+LVP+S       +  D++ I++G +VP+  RL+ Q   + GW  +     LL G E       V+  S +  N+D +++VLV+++GG TFSEIS LRFL + +     +I++TT +  +    E+L
Sbjct:  108 YKIIFTPQRFFACEAVLEEEGV-FGDVTTDEWAFYLLPLDDDILSMELPEFFHDNFLAGDQRWLRTVGGALHLLHSVYGPFSKLYGIGSCSQ--MTYEWWREQVEQGEQGARPAEIGSVFLIDRDVDFVTPLCSQVVYEGLLDDIFRIKCG--CVE--FGPDVTSSDRSVKVMLNSQDKVFNEIRN----EHFSNVFGFLSQKARNLQTAYDKRQGMDIKQMKTFVSEELKGLKQEHRLLSLHIGASESIMKKKTKQDFQELLQREHCLLEGFEIRESISFIEEHINRQISMMESLRMLCLLSITENGLLPKDYRSLKTQYLQSYGFDHLLTFSNLRQLGLLVEQQGAETLTVMESKVGKLVNDKTAGKITDAFSSLARRSHFRALSRKLNLVPKSDEEYDLRVPKDMAYIFSGAYVPLSCRLIEQVLERDGWAGLEDVTRLLNGHEF-----AVTGGSRAEPNSDAQRLVLVLFLGGCTFSEISALRFLGRAK--GYKFIVVTTAVTNSSRLLEAL 606          
BLAST of Vacuolar protein sorting-associated protein 33A vs. Ensembl Medaka
Match: vps33b (VPS33B late endosome and lysosome associated [Source:NCBI gene;Acc:101160132])

HSP 1 Score: 141.739 bits (356), Expect = 2.289e-35
Identity = 118/488 (24.18%), Postives = 221/488 (45.29%), Query Frame = 2
Query:  455 KSTGKFKCYGIPLENDLISLENPDFIMNMNDLTTLYDLAKTIMLIQSLYGTIPSVSGQGEKFQELMKILTVMKKSSPEQKSIKQSKIHQMLIFDRRIDMLTPLLCQITYEGLLDEFFKFSSGFICVPMFFFNKSDNMDDTELFQMNSSDVFYGEVRDAVIQDYMKKIVNFHNEVEAEREKYLKARKLEEMAE----VTSNLKAFKSREKAAHFHFTMATILNKYTKRSNYSDLVTAQNHFISQKDCDKIHPIVEEYLIKNIDIGRVIQLICIQSLCSNGLKPKILNSYKREILRTYGLRYVAVLMRLEKMGLLTSQQ------------------------TSSMIPLGERA-FDTIVTTLDLVPESQ-----NLNCDVSNIYAG-FVPIITRLV-QYYFKPGWPSISRALNLLPGAETPSIAPVVSADSLSVQNTD-RKVVLVVYIGGATFSEISTLRFLSQQEESNTSYIILTTGIITNVTFFESL 1807
            K+ G+F+ Y I        +  P       D   L  +   + L+ S+YG    + G G   Q  M      ++    ++  + ++I  + + DR +D +TPL  Q+ YEGLLD+ F+   G  CV   F     + D +    +NS D  + E+R+    ++   +  F ++     +     R+  ++ +    V+  LK  K   +    H   +  + K   + ++ +L+  ++  +   +  +    +EE++ + I +   ++++C+ S+  NGL PK   S K + L++YG  ++     L ++GLL  QQ                        T +   L  R+ F  +   L+LVP+S       +  D++ I++G +VP+  RL+ Q   + GW  +     LL G E       V+  S +  N+D +++VLV+++GG TFSEIS LRFL + +     +I++TT +  +    E+L
Sbjct:  100 KAVGRFRRYKI--------IFTP---QRAGDQRWLRTVGGALHLLHSVYGPFSKLYGIGSCSQ--MTYEWWREQVEQGEQGARPAEIGSVFLIDRDVDFVTPLCSQVVYEGLLDDIFRIKCG--CVE--FGPDVTSSDRSVKVMLNSQDKVFNEIRN----EHFSNVFGFLSQKARNLQTAYDKRQGMDIKQMKTFVSEELKGLKQEHRLLSLHIGASESIMKKKTKQDFQELLQREHCLLEGFEIRESISFIEEHINRQISMMESLRMLCLLSITENGLLPKDYRSLKTQYLQSYGFDHLLTFSNLRQLGLLVEQQGAETLTVMESKVGKLVNDKTAGKITDAFSSLARRSHFRALSRKLNLVPKSDEEYDLRVPKDMAYIFSGAYVPLSCRLIEQVLERDGWAGLEDVTRLLNGHEF-----AVTGGSRAEPNSDAQRLVLVLFLGGCTFSEISALRFLGRAK--GYKFIVVTTAVTNSSRLLEAL 559          
BLAST of Vacuolar protein sorting-associated protein 33A vs. Planmine SMEST
Match: SMESG000061720.1 (SMESG000061720.1)

HSP 1 Score: 1196.42 bits (3094), Expect = 0.000e+0
Identity = 595/596 (99.83%), Postives = 596/596 (100.00%), Query Frame = 2
Query:   65 MEFSNNGPVDLTYLNDTYKKELEDIFSKVTKPTIAIWDVKVKRSVYSIYSKESLEKAKISNVLIDDITTLEKTNKYXXXXXXXXXXXXMIDLVESVIKRNLCEEYHLIFVPNILTCHEEYIRKKNLEIKFKSTGKFKCYGIPLENDLISLENPDFIMNMNDLTTLYDLAKTIMLIQSLYGTIPSVSGQGEKFQELMKILTVMKKSSPEQKSIKQSKIHQMLIFDRRIDMLTPLLCQITYEGLLDEFFKFSSGFICVPMFFFNKSDNMDDTELFQMNSSDVFYGEVRDAVIQDYMKKIVNFHNEVEAEREKYLKARKLEEMAEVTSNLKAFKSREKAAHFHFTMATILNKYTKRSNYSDLVTAQNHFISQKDCDKIHPIVEEYLIKNIDIGRVIQLICIQSLCSNGLKPKILNSYKREILRTYGLRYVAVLMRLEKMGLLTSQQTSSMIPLGERAFDTIVTTLDLVPESQNLNCDVSNIYAGFVPIITRLVQYYFKPGWPSISRALNLLPGAETPSIAPVVSADSLSVQNTDRKVVLVVYIGGATFSEISTLRFLSQQEESNTSYIILTTGIITNVTFFESLAQPYELPNSTNPFNN 1852
            MEFSNNGPVDLTYLNDTYKKELEDIFSKVTKPTIAIWDVKVKRSVYSIYSKESLEKAKISNVLIDDITTLEKTNKYKSIIFFIKSSIKMIDLVESVIKRNLCEEYHLIFVPNILTCHEEYIRKKNLEIKFKSTGKFKCYGIPLENDLISLENPDFIMNMNDLTTLYDLAKTIMLIQSLYGTIPSVSGQGEKFQELMKILTVMKKSSPEQKSIKQSKIHQMLIFDRRIDMLTPLLCQITYEGLLDEFFKFSSGFICVPMFFFNKSDNMDDTELFQMNSSDVFYGEVRDAVIQDYMKKIVNFHNEVEAEREKYLKARKLEEMAEVTSNLKAFKSREKAAHFHFTMATILNKYTKRSNYSDLVTAQNHFISQKDCDKIHPIVEEYLIKNIDIGRVIQLICIQSLCSNGLKPKILNSYKREILRTYGLRYVAVLMRLEKMGLLTSQQTSSMIPLGERAFDTIVTTLDLVPESQNLNCDVSNIYAGFVPIITRLVQYYFKPGWPSISRALNLLPGAETPSIAPVVSADSL+VQNTDRKVVLVVYIGGATFSEISTLRFLSQQEESNTSYIILTTGIITNVTFFESLAQPYELPNSTNPFNN
Sbjct:    1 MEFSNNGPVDLTYLNDTYKKELEDIFSKVTKPTIAIWDVKVKRSVYSIYSKESLEKAKISNVLIDDITTLEKTNKYKSIIFFIKSSIKMIDLVESVIKRNLCEEYHLIFVPNILTCHEEYIRKKNLEIKFKSTGKFKCYGIPLENDLISLENPDFIMNMNDLTTLYDLAKTIMLIQSLYGTIPSVSGQGEKFQELMKILTVMKKSSPEQKSIKQSKIHQMLIFDRRIDMLTPLLCQITYEGLLDEFFKFSSGFICVPMFFFNKSDNMDDTELFQMNSSDVFYGEVRDAVIQDYMKKIVNFHNEVEAEREKYLKARKLEEMAEVTSNLKAFKSREKAAHFHFTMATILNKYTKRSNYSDLVTAQNHFISQKDCDKIHPIVEEYLIKNIDIGRVIQLICIQSLCSNGLKPKILNSYKREILRTYGLRYVAVLMRLEKMGLLTSQQTSSMIPLGERAFDTIVTTLDLVPESQNLNCDVSNIYAGFVPIITRLVQYYFKPGWPSISRALNLLPGAETPSIAPVVSADSLNVQNTDRKVVLVVYIGGATFSEISTLRFLSQQEESNTSYIILTTGIITNVTFFESLAQPYELPNSTNPFNN 596          
The following BLAST results are available for this feature:
BLAST of Vacuolar protein sorting-associated protein 33A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
VPS33A8.597e-8228.38VPS33A core subunit of CORVET and HOPS complexes [... [more]
VPS33A8.130e-7426.54VPS33A core subunit of CORVET and HOPS complexes [... [more]
AC048338.19.734e-6025.62novel protein[more]
VPS33B4.033e-3522.34VPS33B late endosome and lysosome associated [Sour... [more]
VPS33B6.962e-3522.34VPS33B late endosome and lysosome associated [Sour... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 33A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
vps-33.11.046e-2421.85Vacuolar protein sorting-associated protein 33A [... [more]
vps-33.26.491e-2121.37Vacuolar protein sorting-associated protein 33B [... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 33A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
car1.044e-6127.91gene:FBgn0000257 transcript:FBtr0074728[more]
car1.044e-6127.91gene:FBgn0000257 transcript:FBtr0074727[more]
car1.719e-6127.91gene:FBgn0000257 transcript:FBtr0331158[more]
back to top
BLAST of Vacuolar protein sorting-associated protein 33A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
vps33a4.032e-8329.07VPS33A core subunit of CORVET and HOPS complexes [... [more]
vps33a4.032e-8329.07VPS33A core subunit of CORVET and HOPS complexes [... [more]
vps33b8.416e-4224.21VPS33B late endosome and lysosome associated [Sour... [more]
vps33b8.416e-4224.21VPS33B late endosome and lysosome associated [Sour... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 33A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000007947.13.969e-8229.85VPS33A, CORVET/HOPS core subunit [Source:NCBI gene... [more]
ENSXETT00000008043.17.533e-8230.18VPS33A, CORVET/HOPS core subunit [Source:NCBI gene... [more]
ENSXETT00000008008.14.064e-7829.26VPS33A, CORVET/HOPS core subunit [Source:NCBI gene... [more]
vps33b3.291e-3321.50vacuolar protein sorting 33 homolog B [Source:NCBI... [more]
vps33b9.470e-3121.71vacuolar protein sorting 33 homolog B [Source:NCBI... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 33A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Vps33a3.982e-8128.11VPS33A CORVET/HOPS core subunit [Source:MGI Symbol... [more]
Vps33b1.979e-3522.55vacuolar protein sorting 33B [Source:MGI Symbol;Ac... [more]
Vps33b6.138e-629.89vacuolar protein sorting 33B [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 33A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q63615|VP33A_RAT2.012e-8128.50Vacuolar protein sorting-associated protein 33A OS... [more]
sp|Q96AX1|VP33A_HUMAN4.129e-8128.38Vacuolar protein sorting-associated protein 33A OS... [more]
sp|Q9D2N9|VP33A_MOUSE2.785e-8028.11Vacuolar protein sorting-associated protein 33A OS... [more]
sp|Q9Y1I2|VP33A_DROME1.047e-6027.91Vacuolar protein sorting-associated protein 33A OS... [more]
sp|Q94KJ7|VPS33_ARATH4.213e-5325.58Vacuolar protein-sorting-associated protein 33 hom... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 33A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4A2846.726e-9431.54Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
R7T7694.546e-9131.42Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A210QYW01.299e-9030.03Small G protein signaling modulator 1 OS=Mizuhopec... [more]
A0A2T7PE152.919e-8933.13Uncharacterized protein OS=Pomacea canaliculata OX... [more]
S4RM901.859e-8734.64VPS33A core subunit of CORVET and HOPS complexes O... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 33A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
vps33a4.545e-8229.17VPS33A core subunit of CORVET and HOPS complexes [... [more]
vps33b9.190e-3724.03VPS33B late endosome and lysosome associated [Sour... [more]
vps33b1.144e-3624.22VPS33B late endosome and lysosome associated [Sour... [more]
vps33b1.969e-2623.83VPS33B late endosome and lysosome associated [Sour... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 33A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
vps33a1.429e-9134.64VPS33A core subunit of CORVET and HOPS complexes [... [more]
vps33b1.938e-3425.67VPS33B late endosome and lysosome associated [Sour... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 33A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
VPS335.589e-1721.54ATP-binding protein that is a subunit of the HOPS ... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 33A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO441865.347e-5530.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO441871.651e-5126.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 33A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vps33a4.564e-8228.76VPS33A core subunit of CORVET and HOPS complexes [... [more]
vps33a6.489e-7129.48VPS33A core subunit of CORVET and HOPS complexes [... [more]
vps33b3.334e-4124.37VPS33B late endosome and lysosome associated [Sour... [more]
vps33b3.334e-4124.37VPS33B late endosome and lysosome associated [Sour... [more]
vps33b2.289e-3524.18VPS33B late endosome and lysosome associated [Sour... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 33A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000061720.10.000e+099.83SMESG000061720.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022016 ID=SMED30022016|Name=Vacuolar protein sorting-associated protein 33A|organism=Schmidtea mediterranea sexual|type=transcript|length=1957bp
GTAAATTTAAATGTTAGCATAAATTTAAAAACGGAATTTTTTAAAATTTG
ATTTTTCACTAAATATGGAATTTTCTAACAATGGACCAGTAGACTTAACT
TATTTAAATGATACGTATAAAAAAGAGTTAGAGGATATATTTAGCAAAGT
TACAAAGCCAACTATTGCAATTTGGGATGTTAAAGTAAAGCGTTCGGTGT
ACTCTATTTATTCTAAAGAAAGTCTTGAGAAAGCAAAAATTTCCAATGTC
CTAATAGACGATATCACTACTTTGGAAAAGACTAATAAATACAAATCTAT
AATTTTCTTCATAAAATCTTCTATTAAAATGATTGATTTGGTTGAATCAG
TTATTAAAAGAAATCTATGTGAAGAATATCATTTAATTTTCGTACCGAAC
ATCCTTACTTGTCATGAAGAATATATTCGTAAGAAAAATTTGGAAATAAA
ATTTAAGAGTACTGGGAAATTTAAGTGTTATGGTATTCCTTTAGAAAACG
ATCTTATCTCTCTGGAAAATCCAGACTTTATCATGAACATGAATGATTTA
ACTACACTGTATGATTTGGCAAAGACAATAATGCTTATTCAATCATTATA
CGGCACGATTCCGTCTGTGAGTGGACAAGGTGAAAAATTCCAAGAGCTGA
TGAAGATTCTTACAGTAATGAAGAAAAGTTCACCTGAACAGAAAAGCATA
AAACAATCGAAAATACATCAAATGCTTATTTTTGATCGTAGAATAGACAT
GCTGACCCCCTTATTGTGTCAAATTACTTATGAAGGATTGCTAGATGAAT
TTTTTAAATTTTCTTCTGGATTTATCTGTGTTCCTATGTTTTTTTTTAAT
AAATCCGACAATATGGATGATACTGAACTGTTTCAAATGAATTCTTCTGA
TGTTTTTTATGGAGAAGTTCGAGACGCTGTTATTCAAGACTACATGAAAA
AAATTGTCAATTTTCACAATGAAGTCGAAGCAGAAAGAGAAAAATATTTG
AAAGCCCGAAAGCTTGAAGAAATGGCTGAAGTGACAAGTAATCTAAAAGC
ATTCAAAAGTCGTGAAAAAGCTGCCCATTTCCATTTTACTATGGCAACGA
TTCTTAATAAATACACGAAACGAAGTAATTATTCGGATTTGGTCACGGCA
CAAAATCATTTTATTAGTCAAAAAGATTGCGACAAAATACACCCGATTGT
CGAGGAATATTTAATCAAAAACATAGATATTGGCCGGGTTATTCAGTTAA
TATGCATTCAATCTCTGTGCTCCAATGGCCTTAAACCTAAAATTCTTAAT
TCGTATAAGAGGGAAATTTTAAGAACATATGGGCTACGATATGTAGCTGT
TTTAATGCGTTTAGAAAAAATGGGTTTGCTAACATCTCAGCAAACATCAA
GTATGATACCTCTTGGTGAAAGAGCTTTCGACACTATTGTGACGACTTTG
GATCTTGTTCCTGAATCTCAAAATTTGAACTGCGATGTGAGCAATATTTA
CGCCGGTTTCGTTCCAATTATAACTAGACTCGTCCAATATTATTTCAAAC
CTGGCTGGCCAAGCATTTCAAGAGCACTCAATCTGTTGCCCGGGGCAGAA
ACACCGAGTATTGCTCCTGTTGTCTCAGCCGATTCTCTTAGCGTCCAAAA
CACTGATCGAAAGGTTGTATTGGTAGTATATATAGGAGGAGCAACTTTCT
CGGAGATTTCCACATTGAGATTTTTATCCCAGCAAGAAGAATCCAATACA
AGTTACATAATTTTGACTACCGGAATCATAACCAATGTGACTTTTTTTGA
AAGTCTTGCGCAGCCCTACGAATTACCGAATTCAACAAATCCTTTCAATA
ATTAAATTGCAATTAAAATGAAATTGTTCTTATTTTTATTGAAAAATTAT
TGTGCGTTTTTATTTTAATTATAATATCAGAATTTATATTATTTATTATA
ATCAGTG
back to top

protein sequence of SMED30022016-orf-1

>SMED30022016-orf-1 ID=SMED30022016-orf-1|Name=SMED30022016-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=597bp
MEFSNNGPVDLTYLNDTYKKELEDIFSKVTKPTIAIWDVKVKRSVYSIYS
KESLEKAKISNVLIDDITTLEKTNKYKSIIFFIKSSIKMIDLVESVIKRN
LCEEYHLIFVPNILTCHEEYIRKKNLEIKFKSTGKFKCYGIPLENDLISL
ENPDFIMNMNDLTTLYDLAKTIMLIQSLYGTIPSVSGQGEKFQELMKILT
VMKKSSPEQKSIKQSKIHQMLIFDRRIDMLTPLLCQITYEGLLDEFFKFS
SGFICVPMFFFNKSDNMDDTELFQMNSSDVFYGEVRDAVIQDYMKKIVNF
HNEVEAEREKYLKARKLEEMAEVTSNLKAFKSREKAAHFHFTMATILNKY
TKRSNYSDLVTAQNHFISQKDCDKIHPIVEEYLIKNIDIGRVIQLICIQS
LCSNGLKPKILNSYKREILRTYGLRYVAVLMRLEKMGLLTSQQTSSMIPL
GERAFDTIVTTLDLVPESQNLNCDVSNIYAGFVPIITRLVQYYFKPGWPS
ISRALNLLPGAETPSIAPVVSADSLSVQNTDRKVVLVVYIGGATFSEIST
LRFLSQQEESNTSYIILTTGIITNVTFFESLAQPYELPNSTNPFNN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005764lysosome
GO:0005776autophagosome
GO:0033263CORVET complex
Vocabulary: biological process
TermDefinition
GO:0030220platelet formation
GO:0043473pigmentation
GO:0048070regulation of developmental pigmentation
GO:0016192vesicle-mediated transport
GO:0006904vesicle docking involved in exocytosis
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR027482Sec-1-like_dom2
IPR001619Sec1-like