Tetraspanin

Overview
NameTetraspanin
Smed IDSMED30022014
Length (bp)1106
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tetraspanin (SMED30022014) t-SNE clustered cells

Violin plots show distribution of expression levels for Tetraspanin (SMED30022014) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tetraspanin (SMED30022014) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tetraspanin (SMED30022014) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022014

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30022014SMESG000043678.1 dd_Smed_v4_2693_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022014SMESG000043678.1 dd_Smed_v4_2693_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30022014SMESG000043678.1 dd_Smed_v4_2693_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30022014SMESG000043678.1 dd_Smed_v4_2693_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30022014SMESG000043678.1 dd_Smed_v4_2693_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30022014SMESG000043678.1 dd_Smed_v4_2693_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30022014SMESG000043678.1 dd_Smed_v4_2693_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30022014SMESG000043678.1 dd_Smed_v6_2693_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30022014SMESG000043678.1 OX_Smed_1.0.16499ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30022014SMESG000043678.1 dd_Smed_v4_2693_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tetraspanin vs. Ensembl Human
Match: CD9 (CD9 molecule [Source:HGNC Symbol;Acc:HGNC:1709])

HSP 1 Score: 68.9366 bits (167), Expect = 7.749e-13
Identity = 58/171 (33.92%), Postives = 93/171 (54.39%), Query Frame = 2
Query:  263 TAFVIGFYVTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEELKSKPDDTEHWMNGVQRNMKCCGYKGSSDYTKVPGSCCSTSKCEDSYT-RGCESAWTELIQNNWVIFASXXXXXXXXXXXXXXFSMCLCCTAR 772
            ++F  G Y+ +G GA  ++VG  GCCGA  ES C+LG +F FLL+IFA EIAA +    +KD+V   V   ++    +LK+K +     +  +   + CCG  G  +  +     C      +++T + C  A  E+  N + I  ++ +GI ++ + G+IFSM LCC  R
Sbjct:   54 SSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVE--QFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIR 222          
BLAST of Tetraspanin vs. Ensembl Human
Match: CD9 (CD9 molecule [Source:HGNC Symbol;Acc:HGNC:1709])

HSP 1 Score: 68.9366 bits (167), Expect = 7.749e-13
Identity = 58/171 (33.92%), Postives = 93/171 (54.39%), Query Frame = 2
Query:  263 TAFVIGFYVTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEELKSKPDDTEHWMNGVQRNMKCCGYKGSSDYTKVPGSCCSTSKCEDSYT-RGCESAWTELIQNNWVIFASXXXXXXXXXXXXXXFSMCLCCTAR 772
            ++F  G Y+ +G GA  ++VG  GCCGA  ES C+LG +F FLL+IFA EIAA +    +KD+V   V   ++    +LK+K +     +  +   + CCG  G  +  +     C      +++T + C  A  E+  N + I  ++ +GI ++ + G+IFSM LCC  R
Sbjct:   54 SSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVE--QFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIR 222          
BLAST of Tetraspanin vs. Ensembl Human
Match: CD9 (CD9 molecule [Source:HGNC Symbol;Acc:HGNC:1709])

HSP 1 Score: 68.9366 bits (167), Expect = 7.749e-13
Identity = 58/171 (33.92%), Postives = 93/171 (54.39%), Query Frame = 2
Query:  263 TAFVIGFYVTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEELKSKPDDTEHWMNGVQRNMKCCGYKGSSDYTKVPGSCCSTSKCEDSYT-RGCESAWTELIQNNWVIFASXXXXXXXXXXXXXXFSMCLCCTAR 772
            ++F  G Y+ +G GA  ++VG  GCCGA  ES C+LG +F FLL+IFA EIAA +    +KD+V   V   ++    +LK+K +     +  +   + CCG  G  +  +     C      +++T + C  A  E+  N + I  ++ +GI ++ + G+IFSM LCC  R
Sbjct:   54 SSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVE--QFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIR 222          
BLAST of Tetraspanin vs. Ensembl Human
Match: CD9 (CD9 molecule [Source:HGNC Symbol;Acc:HGNC:1709])

HSP 1 Score: 60.8474 bits (146), Expect = 4.955e-10
Identity = 50/195 (25.64%), Postives = 85/195 (43.59%), Query Frame = 2
Query:  263 TAFVIGFYVTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXX----------XXXXXXXXXGVLVVL-------------YKDKVKSYVGVKFQKGTEELKSKPDDTEHWMNGVQRNMKCCGYKGSSDYTKVPGSCCSTSKCEDSYT-RGCESAWTELIQNNWVIFASXXXXXXXXXXXXXXFSMCLCCTARS 775
            ++F  G Y+ +G GA  ++VG  GCCGA  ES C+LG      +                   G L+V+             +KD+V   V   ++    +LK+K +     +  +   + CCG  G  +  +     C      +++T + C  A  E+  N + I  ++ +GI ++ + G+IFSM LCC  R 
Sbjct:   54 SSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLATKRTMFPPFLEDHVCFFSLNPQFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVE--QFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRR 246          
BLAST of Tetraspanin vs. Ensembl Human
Match: CD53 (CD53 molecule [Source:HGNC Symbol;Acc:HGNC:1686])

HSP 1 Score: 58.5362 bits (140), Expect = 2.029e-9
Identity = 42/130 (32.31%), Postives = 64/130 (49.23%), Query Frame = 2
Query:  260 GTAFVIGFYVTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEELKSKPDDTEHWMNGVQRNMKCCGYKGSSDYTK-VPGSCCSTSKCEDSYTRG 646
            G  FVI       +G+  ++V   GC G+  E+ CLL ++FI LL+I  AE+   +L+ +Y+ K+  YV            S       W + +Q  ++CCG  G+SD+T   P SC S  K E  Y + 
Sbjct:   53 GNVFVI-------VGSIIMVVAFLGCMGSIKENKCLLMSFFILLLIILLAEVTLAILLFVYEQKLNEYVAKGLTDSIHRYHSDNSTKAAW-DSIQSFLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKA 174          
BLAST of Tetraspanin vs. Ensembl Celegans
Match: tsp-17 (Tetraspanin-17 [Source:UniProtKB/Swiss-Prot;Acc:Q11098])

HSP 1 Score: 49.6766 bits (117), Expect = 1.143e-6
Identity = 42/129 (32.56%), Postives = 63/129 (48.84%), Query Frame = 2
Query:  284 YVTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKV-KSYVGVKFQKGTEELKSKPDDTEHWMNGVQRNMKCCGYKGSSDY---------------TKVPGSCCSTSK 622
            YV++  G   L+VG  G CGA + S  LL  + +FL+  F A++A G L + YKDK   +Y+GV  +  T    S+       M+ +Q   +CCG +G  DY               + VP SCC  ++
Sbjct:   63 YVSLVCGCAQLLVGFLGLCGAVNRSRFLLLAFVMFLIGTFLADVAMGTLSLFYKDKFSNNYMGVYLKNLTYNRYSRDRWVLPLMDTIQFYHQCCGGEGPLDYKDSFWYITNTLRGTRSFVPPSCCKQAQ 191          
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp42Ea (gene:FBgn0029508 transcript:FBtr0086171)

HSP 1 Score: 63.5438 bits (153), Expect = 2.479e-11
Identity = 45/123 (36.59%), Postives = 64/123 (52.03%), Query Frame = 2
Query:  332 GCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEELKSKPDDTEHWMNGVQRNMKCCGYKGSSDYT---KVPGSCCS-TSKC--EDSYTRGCESAWTELIQNN 682
            GCCGA  ES C+  TY I L ++   ++A  + + + KDK    +G   +K      S+ D    +M+ +Q +MKCCG  G +DY    K P SCCS T+ C  E  Y RGC+  + E    N
Sbjct:   70 GCCGAIRESYCMSMTYSILLFVLMIGQLALVIYMWVQKDKYLEIMGDVVEKAWNHRTSRSD----YMDAIQISMKCCGRSGYTDYAYQGKFPPSCCSDTNNCRWETVYRRGCKVTFVEFWDRN 188          
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp42Ea (gene:FBgn0029508 transcript:FBtr0086173)

HSP 1 Score: 63.5438 bits (153), Expect = 2.479e-11
Identity = 45/123 (36.59%), Postives = 64/123 (52.03%), Query Frame = 2
Query:  332 GCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEELKSKPDDTEHWMNGVQRNMKCCGYKGSSDYT---KVPGSCCS-TSKC--EDSYTRGCESAWTELIQNN 682
            GCCGA  ES C+  TY I L ++   ++A  + + + KDK    +G   +K      S+ D    +M+ +Q +MKCCG  G +DY    K P SCCS T+ C  E  Y RGC+  + E    N
Sbjct:   70 GCCGAIRESYCMSMTYSILLFVLMIGQLALVIYMWVQKDKYLEIMGDVVEKAWNHRTSRSD----YMDAIQISMKCCGRSGYTDYAYQGKFPPSCCSDTNNCRWETVYRRGCKVTFVEFWDRN 188          
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp42Ea (gene:FBgn0029508 transcript:FBtr0086172)

HSP 1 Score: 63.5438 bits (153), Expect = 2.479e-11
Identity = 45/123 (36.59%), Postives = 64/123 (52.03%), Query Frame = 2
Query:  332 GCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEELKSKPDDTEHWMNGVQRNMKCCGYKGSSDYT---KVPGSCCS-TSKC--EDSYTRGCESAWTELIQNN 682
            GCCGA  ES C+  TY I L ++   ++A  + + + KDK    +G   +K      S+ D    +M+ +Q +MKCCG  G +DY    K P SCCS T+ C  E  Y RGC+  + E    N
Sbjct:   70 GCCGAIRESYCMSMTYSILLFVLMIGQLALVIYMWVQKDKYLEIMGDVVEKAWNHRTSRSD----YMDAIQISMKCCGRSGYTDYAYQGKFPPSCCSDTNNCRWETVYRRGCKVTFVEFWDRN 188          
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp96F (gene:FBgn0027865 transcript:FBtr0330163)

HSP 1 Score: 63.5438 bits (153), Expect = 4.196e-11
Identity = 62/219 (28.31%), Postives = 92/219 (42.01%), Query Frame = 2
Query:  275 IGFYVTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEEL--KSKPDDTEHWMNGVQRNMKCCGYKGSSDYT------------------------KVPGSCC----STSKCEDS-------------YTRGCESAWTELIQNNWVIFASXXXXXXXXXXXXXXFSMCLCCTARSIEYDMVETR 802
            I  YV + IG    +    GCCG   ES CLL ++F  +L++  A+IAAG      KDK+   V    +   +E   +S         + +Q+N+KCCG  G  D+                          +P SCC      ++CE S             Y +GC     E+I  NWV   ++   + L+ELL L F++ LCC  R+  Y   E +
Sbjct:   54 IALYVFLAIGILITLGAFFGCCGVCRESQCLLVSFFCVILIVMVAQIAAGAWAFHNKDKLDDIVRAAVKSSVQEEYGQSTMSSRTVTFDTLQKNLKCCGADGPGDWATSRFNNVDRTNIVEIAVSSMNVFYNIPESCCKDNLKDNECELSRRLKFGGPLNNAIYQQGCVDKLIEIIYENWVTIFAVTAAVILLELLSLTFALSLCCAVRNQHYKAXELQ 272          
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp96F (gene:FBgn0027865 transcript:FBtr0330164)

HSP 1 Score: 62.3882 bits (150), Expect = 9.279e-11
Identity = 61/213 (28.64%), Postives = 90/213 (42.25%), Query Frame = 2
Query:  275 IGFYVTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEEL--KSKPDDTEHWMNGVQRNMKCCGYKGSSDYT------------------------KVPGSCC----STSKCEDS-------------YTRGCESAWTELIQNNWVIFASXXXXXXXXXXXXXXFSMCLCCTARSIEY 784
            I  YV + IG    +    GCCG   ES CLL ++F  +L++  A+IAAG      KDK+   V    +   +E   +S         + +Q+N+KCCG  G  D+                          +P SCC      ++CE S             Y +GC     E+I  NWV   ++   + L+ELL L F++ LCC  R+  Y
Sbjct:   54 IALYVFLAIGILITLGAFFGCCGVCRESQCLLVSFFCVILIVMVAQIAAGAWAFHNKDKLDDIVRAAVKSSVQEEYGQSTMSSRTVTFDTLQKNLKCCGADGPGDWATSRFNNVDRTNIVEIAVSSMNVFYNIPESCCKDNLKDNECELSRRLKFGGPLNNAIYQQGCVDKLIEIIYENWVTIFAVTAAVILLELLSLTFALSLCCAVRNQHY 266          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: tspan34 (tetraspanin 34 [Source:ZFIN;Acc:ZDB-GENE-060825-202])

HSP 1 Score: 69.3218 bits (168), Expect = 3.213e-13
Identity = 58/177 (32.77%), Postives = 95/177 (53.67%), Query Frame = 2
Query:  284 YVTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVK---SYVGVKFQKGTEELKSKPDDTEHWMNGVQRNMKCCGYKGSSDY---------TKVPGSCCS--TSKC-----EDSYTRGCESAWTELIQNNWVIFASXXXXXXXXXXXXXXFSMCL 757
            Y+ +G+GAF  I+G  GCCGA  ES C+L T+FI +L+IF  E+AA V++ +++  V+   + +G K  K  ++   K +      N     +KCCGY   +D+         +  P  CCS  + +C     ED+   GC     +LI++N ++ A + LGI  +E+  ++ SM L
Sbjct:   52 YLLIGVGAFLAIMGFLGCCGAVKESKCMLLTFFIIVLIIFLVEVAAAVVLFVFEPVVQETLNEIGQKVAKSIKDNYGKDEPFSSIWNTTMNELKCCGYNNYTDFSGSNFVEETSMYPEKCCSSGSQRCDERAAEDAVIAGCFRTLVKLIEDNALLLAGVALGIAALEIAAMVVSMIL 228          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: cd82b (CD82 molecule b [Source:ZFIN;Acc:ZDB-GENE-030131-2857])

HSP 1 Score: 66.2402 bits (160), Expect = 6.236e-12
Identity = 67/204 (32.84%), Postives = 102/204 (50.00%), Query Frame = 2
Query:  263 TAFVIGFYVTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEELKSKPDDTEHWMNGVQRNMKCCGYKGSSDYTK-----------VPGSCCSTSK----------CE------DSYTRGCESAWTELIQNNWVIFASXXXXXXXXXXXXXXFSMCLCCTARSIEYDMV 793
            T+  +G Y+ +GIG+ ++++G  GC GA +E  CLLG YF  LLLI  A++ A VL+   +D +K        K         + +E   + +QR MKCCG+ G SD+ +            P SC + S           CE        +T+GC S+  + I  N  +   + +GI +IELLG+I SMCLC + +  +Y  V
Sbjct:   50 TSLKVGAYILIGIGSLSMLMGFLGCIGAIYEIRCLLGLYFTCLLLILIAQVTAAVLIYFQRDLLKGETYNIVNKILVNYTGSNNTSEDAWDYIQRTMKCCGWSGQSDWKENVMIKNNSKILYPCSCRNESISGSDKQEKGFCEGLSPQWPVFTKGCISSLEDWILRNCGVILGVCVGIAVIELLGMILSMCLCKSVQQEDYTKV 253          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: cd82b (CD82 molecule b [Source:ZFIN;Acc:ZDB-GENE-030131-2857])

HSP 1 Score: 66.2402 bits (160), Expect = 6.236e-12
Identity = 67/204 (32.84%), Postives = 102/204 (50.00%), Query Frame = 2
Query:  263 TAFVIGFYVTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEELKSKPDDTEHWMNGVQRNMKCCGYKGSSDYTK-----------VPGSCCSTSK----------CE------DSYTRGCESAWTELIQNNWVIFASXXXXXXXXXXXXXXFSMCLCCTARSIEYDMV 793
            T+  +G Y+ +GIG+ ++++G  GC GA +E  CLLG YF  LLLI  A++ A VL+   +D +K        K         + +E   + +QR MKCCG+ G SD+ +            P SC + S           CE        +T+GC S+  + I  N  +   + +GI +IELLG+I SMCLC + +  +Y  V
Sbjct:   50 TSLKVGAYILIGIGSLSMLMGFLGCIGAIYEIRCLLGLYFTCLLLILIAQVTAAVLIYFQRDLLKGETYNIVNKILVNYTGSNNTSEDAWDYIQRTMKCCGWSGQSDWKENVMIKNNSKILYPCSCRNESISGSDKQEKGFCEGLSPQWPVFTKGCISSLEDWILRNCGVILGVCVGIAVIELLGMILSMCLCKSVQQEDYTKV 253          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: cd9b (CD9 molecule b [Source:ZFIN;Acc:ZDB-GENE-040426-2768])

HSP 1 Score: 65.4698 bits (158), Expect = 6.610e-12
Identity = 60/172 (34.88%), Postives = 95/172 (55.23%), Query Frame = 2
Query:  263 TAFVIGFYVTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEELKSKPD-DTEHWMNGVQRNMKCCGYKG-SSDYTKVPGSCCSTSKCEDSYTRGCESAWTELIQNNWVIFASXXXXXXXXXXXXXXFSMCLCCTAR 772
            T F+ G Y+ +  GA  ++VG  GCCGA  ES C+LG +F+FLL+IFAAE+AAG+  +  KDK+ S +   + +  +  K  PD   +  +  +  +++CCG  G  +D   V  +C       +  T GC S   ++  +   +   + +GI +I + G+IFSM LCC  R
Sbjct:   49 TVFLTGVYILIVAGAVMMVVGFLGCCGAIKESACMLGLFFMFLLVIFAAEVAAGIWGLSNKDKIVSDIQQFYTQTVKNYKESPDGPLKETLTAIHFSLQCCGPTGLVTDGVSV--TCPKQEGLANVITTGCSSVIQDMFNSRLHVIGGVGIGIGVIMVFGMIFSMLLCCAIR 218          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: cd9b (CD9 molecule b [Source:ZFIN;Acc:ZDB-GENE-040426-2768])

HSP 1 Score: 65.0846 bits (157), Expect = 8.667e-12
Identity = 60/172 (34.88%), Postives = 95/172 (55.23%), Query Frame = 2
Query:  263 TAFVIGFYVTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEELKSKPD-DTEHWMNGVQRNMKCCGYKG-SSDYTKVPGSCCSTSKCEDSYTRGCESAWTELIQNNWVIFASXXXXXXXXXXXXXXFSMCLCCTAR 772
            T F+ G Y+ +  GA  ++VG  GCCGA  ES C+LG +F+FLL+IFAAE+AAG+  +  KDK+ S +   + +  +  K  PD   +  +  +  +++CCG  G  +D   V  +C       +  T GC S   ++  +   +   + +GI +I + G+IFSM LCC  R
Sbjct:   52 TVFLTGVYILIVAGAVMMVVGFLGCCGAIKESACMLGLFFMFLLVIFAAEVAAGIWGLSNKDKIVSDIQQFYTQTVKNYKESPDGPLKETLTAIHFSLQCCGPTGLVTDGVSV--TCPKQEGLANVITTGCSSVIQDMFNSRLHVIGGVGIGIGVIMVFGMIFSMLLCCAIR 221          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: arsh (arylsulfatase family member H [Source:Xenbase;Acc:XB-GENE-6465035])

HSP 1 Score: 65.855 bits (159), Expect = 6.559e-12
Identity = 49/138 (35.51%), Postives = 78/138 (56.52%), Query Frame = 2
Query:  293 MGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEELKSKPDDTEHWMNGVQRNMKCCGYKGSSDY-TKVPGSCCST---SKCE--DSYTRGCESAWTELIQNNWV 688
            + IG   ++ G  GC GA  E+ CLL T+FI LLLI  AE+   +L+ +Y+ ++ +YV  +     E+   K + +E W N +QRN++CCG  G+ D+   +P SCC++   SKC   D +  GC  A     + N++
Sbjct:   57 IAIGIIIMVFGFLGCMGAIKENKCLLLTFFILLLLILLAEVIMAILLFVYEKQLDNYVRDRLTSSFEQ-NLKQNSSETW-NIIQRNLQCCGINGTKDWKDNIPNSCCASNANSKCSQADLFKMGCSEALKNWFEKNFL 192          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: cd9 (CD9 protein [Source:NCBI gene;Acc:549743])

HSP 1 Score: 63.929 bits (154), Expect = 2.971e-11
Identity = 60/172 (34.88%), Postives = 94/172 (54.65%), Query Frame = 2
Query:  266 AFVIGFYVTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKG-TEELKSKPDDTEHWMNGVQRNMKCCGYKGSSDYTKVPGSCCSTSKCEDSYT-RGCESAWTELIQNNWVIFASXXXXXXXXXXXXXXFSMCLCCTARS 775
            AF  G Y+ +G GA  ++VG  GCCGA  ES C+LG +F FLL+IFA EIAAG+     KDKV   +   ++   T+ +KS  +  +  +  +   + CCG  G  + T V   C +      + + + C +A  ++    + I  ++ +GI +I + G+IFSM LCC  R+
Sbjct:   53 AFYTGVYILIGAGALMMLVGFLGCCGAIQESECMLGLFFAFLLVIFAVEIAAGIWGFTNKDKVVDELKTFYKDTYTKYMKSNDNALKDTLKAIHLALNCCGMTGVLEAT-VTDICPNNQGIVGALSAQSCPAAIEDVFTTKFHIVGAVGIGIAVIMIFGMIFSMVLCCAIRN 223          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: tspan1 (tetraspanin 1 [Source:NCBI gene;Acc:548861])

HSP 1 Score: 63.929 bits (154), Expect = 4.631e-11
Identity = 49/157 (31.21%), Postives = 78/157 (49.68%), Query Frame = 2
Query:  284 YVTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTE-ELKSKPDDTEHWMNGVQRNMKCCGYKGSSDYT----------KVPGSCCSTSKCE----------DSYTRGCESAWTELIQNNWVI 691
            Y  + IG+  +I+G  GCCGA  ES CLL T+F  +L+IF AE+A  V+ ++Y    ++ +G   +   + E  S PD T+ W N    N+ CCG+   +D++          + P  CC+++             +S+  GC S    LI+ N  I
Sbjct:   59 YFLIAIGSLLVILGFLGCCGAQRESKCLLLTFFSIILIIFIAEVAGAVVALVYSSLAETILGPLLKPVLQNEYGSNPDVTKIW-NSTMENLHCCGFNNYTDFSNSTFYNNNHQQYPSYCCNSTSSANSVCTQQGAMNSHVSGCFSQLIYLIRQNAAI 214          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: tspan1 (tetraspanin 1 [Source:NCBI gene;Acc:548861])

HSP 1 Score: 63.5438 bits (153), Expect = 5.003e-11
Identity = 49/157 (31.21%), Postives = 78/157 (49.68%), Query Frame = 2
Query:  284 YVTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTE-ELKSKPDDTEHWMNGVQRNMKCCGYKGSSDYT----------KVPGSCCSTSKCE----------DSYTRGCESAWTELIQNNWVI 691
            Y  + IG+  +I+G  GCCGA  ES CLL T+F  +L+IF AE+A  V+ ++Y    ++ +G   +   + E  S PD T+ W N    N+ CCG+   +D++          + P  CC+++             +S+  GC S    LI+ N  I
Sbjct:   47 YFLIAIGSLLVILGFLGCCGAQRESKCLLLTFFSIILIIFIAEVAGAVVALVYSSLAETILGPLLKPVLQNEYGSNPDVTKIW-NSTMENLHCCGFNNYTDFSNSTFYNNNHQQYPSYCCNSTSSANSVCTQQGAMNSHVSGCFSQLIYLIRQNAAI 202          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: cd82 (CD82 molecule [Source:NCBI gene;Acc:394799])

HSP 1 Score: 60.4622 bits (145), Expect = 6.252e-10
Identity = 62/197 (31.47%), Postives = 98/197 (49.75%), Query Frame = 2
Query:  278 GFYVTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGT---EELKSKPDDTEHWMNGVQRNMKCCGYKGSSDYT----------KVPGSCCSTSKCEDS------------YTRGCESAWTELIQNNWVIFASXXXXXXXXXXXXXXFSMCLCCTARSIEYDMV 793
            G Y+ + +G FT+++G  GC GA +E  CLLG YF FLL+I  A++AAG+L+ L +D +K+ +     +     +    K    E   + +Q N++CCG+    ++T          + P SC       +             Y  GC       +Q+N  I   + +G+ +IELLGLI SMCLC + +S +Y  V
Sbjct:   56 GSYILIAVGGFTMVMGFLGCLGAVNEIRCLLGLYFSFLLIILIAQVAAGILIYLQRDTLKTEMSSIIHELIVTYDYEDGKNTSAETTWDYIQTNLRCCGWTNYQNWTANTVVQNSTNQYPCSCMKNQSSPNGFCQYNGTVESAVYQTGCMQGVESWLQDNLGIILGVCVGVAVIELLGLILSMCLCRSIQSEDYTKV 252          
BLAST of Tetraspanin vs. Ensembl Mouse
Match: Cd9 (CD9 antigen [Source:MGI Symbol;Acc:MGI:88348])

HSP 1 Score: 75.485 bits (184), Expect = 2.820e-15
Identity = 58/170 (34.12%), Postives = 93/170 (54.71%), Query Frame = 2
Query:  263 TAFVIGFYVTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEELKSKPDDTEHWMNGVQRNMKCCGYKGSSDYTKVPGSCCSTSKCEDSYTRGCESAWTELIQNNWVIFASXXXXXXXXXXXXXXFSMCLCCTAR 772
            ++F  G Y+ +G GA  ++VG  GCCGA  ES C+LG +F FLL+IFA EIAA V    +KD+V   +   ++   ++L+SK +     +  +   + CCG  G  +   +  +C      E    + C  A +E+  N + I  ++ +GI ++ + G+IFSM LCC  R
Sbjct:   52 SSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAVWGYTHKDEVIKELQEFYKDTYQKLRSKDEPQRETLKAIHMALDCCGIAGPLE-QFISDTCPKKQLLESFQVKPCPEAISEVFNNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIR 220          
BLAST of Tetraspanin vs. Ensembl Mouse
Match: Cd63 (CD63 antigen [Source:MGI Symbol;Acc:MGI:99529])

HSP 1 Score: 62.7734 bits (151), Expect = 7.595e-11
Identity = 59/179 (32.96%), Postives = 93/179 (51.96%), Query Frame = 2
Query:  287 VTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEELKSKPDDTEHWMNGVQRNMKCCGYKGSSDYTKVPG--------SCC--STSKCEDSY------TRGCESAWTELIQNNWVIFASXXXXXXXXXXXXXXFSMCLCCTARS 775
            V + +GAF  +V   GCCGA  E+ CL+ T+ IFL LI   E+A  +   +++D+VKS     FQ+  +    K + T   ++ +Q+   CCG    +D+  +PG        SCC   T  C + +      T+GC       ++ N ++ A+  LGI  +E+LG+IFS CL  + RS
Sbjct:   56 VIIAVGAFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAVAIAGYVFRDQVKSEFNKSFQQQMQN-YLKDNKTATILDKLQKENNCCGASNYTDWENIPGMAKDRVPDSCCINITVGCGNDFKESTIHTQGCVETIAIWLRKNILLVAAAALGIAFVEVLGIIFSCCLVKSIRS 233          
BLAST of Tetraspanin vs. Ensembl Mouse
Match: Cd63 (CD63 antigen [Source:MGI Symbol;Acc:MGI:99529])

HSP 1 Score: 62.7734 bits (151), Expect = 7.595e-11
Identity = 59/179 (32.96%), Postives = 93/179 (51.96%), Query Frame = 2
Query:  287 VTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEELKSKPDDTEHWMNGVQRNMKCCGYKGSSDYTKVPG--------SCC--STSKCEDSY------TRGCESAWTELIQNNWVIFASXXXXXXXXXXXXXXFSMCLCCTARS 775
            V + +GAF  +V   GCCGA  E+ CL+ T+ IFL LI   E+A  +   +++D+VKS     FQ+  +    K + T   ++ +Q+   CCG    +D+  +PG        SCC   T  C + +      T+GC       ++ N ++ A+  LGI  +E+LG+IFS CL  + RS
Sbjct:   56 VIIAVGAFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAVAIAGYVFRDQVKSEFNKSFQQQMQN-YLKDNKTATILDKLQKENNCCGASNYTDWENIPGMAKDRVPDSCCINITVGCGNDFKESTIHTQGCVETIAIWLRKNILLVAAAALGIAFVEVLGIIFSCCLVKSIRS 233          
BLAST of Tetraspanin vs. Ensembl Mouse
Match: Cd63 (CD63 antigen [Source:MGI Symbol;Acc:MGI:99529])

HSP 1 Score: 62.7734 bits (151), Expect = 7.595e-11
Identity = 59/179 (32.96%), Postives = 93/179 (51.96%), Query Frame = 2
Query:  287 VTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEELKSKPDDTEHWMNGVQRNMKCCGYKGSSDYTKVPG--------SCC--STSKCEDSY------TRGCESAWTELIQNNWVIFASXXXXXXXXXXXXXXFSMCLCCTARS 775
            V + +GAF  +V   GCCGA  E+ CL+ T+ IFL LI   E+A  +   +++D+VKS     FQ+  +    K + T   ++ +Q+   CCG    +D+  +PG        SCC   T  C + +      T+GC       ++ N ++ A+  LGI  +E+LG+IFS CL  + RS
Sbjct:   56 VIIAVGAFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAVAIAGYVFRDQVKSEFNKSFQQQMQN-YLKDNKTATILDKLQKENNCCGASNYTDWENIPGMAKDRVPDSCCINITVGCGNDFKESTIHTQGCVETIAIWLRKNILLVAAAALGIAFVEVLGIIFSCCLVKSIRS 233          
BLAST of Tetraspanin vs. Ensembl Mouse
Match: Cd63 (CD63 antigen [Source:MGI Symbol;Acc:MGI:99529])

HSP 1 Score: 56.9954 bits (136), Expect = 2.173e-9
Identity = 36/105 (34.29%), Postives = 58/105 (55.24%), Query Frame = 2
Query:  287 VTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEELKSKPDDTEHWMNGVQRNMKCCGYKGSSDYTKVPG 601
            V + +GAF  +V   GCCGA  E+ CL+ T+ IFL LI   E+A  +   +++D+VKS     FQ+  +    K + T   ++ +Q+   CCG    +D+  +PG
Sbjct:   56 VIIAVGAFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAVAIAGYVFRDQVKSEFNKSFQQQMQN-YLKDNKTATILDKLQKENNCCGASNYTDWENIPG 159          
BLAST of Tetraspanin vs. UniProt/SwissProt
Match: sp|P40240|CD9_MOUSE (CD9 antigen OS=Mus musculus OX=10090 GN=Cd9 PE=1 SV=2)

HSP 1 Score: 75.485 bits (184), Expect = 1.973e-14
Identity = 58/170 (34.12%), Postives = 93/170 (54.71%), Query Frame = 2
Query:  263 TAFVIGFYVTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEELKSKPDDTEHWMNGVQRNMKCCGYKGSSDYTKVPGSCCSTSKCEDSYTRGCESAWTELIQNNWVIFASXXXXXXXXXXXXXXFSMCLCCTAR 772
            ++F  G Y+ +G GA  ++VG  GCCGA  ES C+LG +F FLL+IFA EIAA V    +KD+V   +   ++   ++L+SK +     +  +   + CCG  G  +   +  +C      E    + C  A +E+  N + I  ++ +GI ++ + G+IFSM LCC  R
Sbjct:   52 SSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAVWGYTHKDEVIKELQEFYKDTYQKLRSKDEPQRETLKAIHMALDCCGIAGPLE-QFISDTCPKKQLLESFQVKPCPEAISEVFNNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIR 220          
BLAST of Tetraspanin vs. UniProt/SwissProt
Match: sp|P30932|CD9_BOVIN (CD9 antigen OS=Bos taurus OX=9913 GN=CD9 PE=2 SV=2)

HSP 1 Score: 73.1738 bits (178), Expect = 1.268e-13
Identity = 58/177 (32.77%), Postives = 97/177 (54.80%), Query Frame = 2
Query:  263 TAFVIGFYVTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEELKSKPDDTEHWMNGVQRNMKCCGYKGSSDYTKVPGSCCSTSKCEDSYTRGCESAWTELIQNNWVIFASXXXXXXXXXXXXXXFSMCLCCTARSIEYDMV 793
            ++F  G Y+ +G GA  ++VG  GCCGA  ES C+LG +F FLL+IFA E+AA +    +K++V   V   ++    +LK+K +     +  +   + CCG  G  +   +  +C   +  +   TR C  A  E+ ++ + I  ++ +GI ++ + G++FSM LCC  R    DMV
Sbjct:   52 SSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFSFLLVIFAIEVAAAIWGYSHKEEVIKEVQKFYEDTYNKLKNKDEPQRETLKAIHIALDCCGLTGVPEQF-LTDTCPPKNLIDSLKTRPCPEAIDEIFRSKFHIIGAVGIGIAVVMIFGMVFSMILCCAIRR-NRDMV 226          
BLAST of Tetraspanin vs. UniProt/SwissProt
Match: sp|P40241|CD9_RAT (CD9 antigen OS=Rattus norvegicus OX=10116 GN=Cd9 PE=1 SV=2)

HSP 1 Score: 70.8626 bits (172), Expect = 7.999e-13
Identity = 56/170 (32.94%), Postives = 91/170 (53.53%), Query Frame = 2
Query:  263 TAFVIGFYVTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEELKSKPDDTEHWMNGVQRNMKCCGYKGSSDYTKVPGSCCSTSKCEDSYTRGCESAWTELIQNNWVIFASXXXXXXXXXXXXXXFSMCLCCTAR 772
            ++F  G Y+ +G GA  ++VG  GCCGA  ES C+LG +F FLL+IFA EIAA V    +KD+V   +   ++   ++L++K +     +  +   + CCG  G  +   +   C      E    + C  A  E+  + + I  ++ +GI ++ + G+IFSM LCC  R
Sbjct:   52 SSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAVWGYTHKDEVIKELQEFYKDTYQKLRNKDEPQRETLKAIHMALNCCGIAGGVE-QFISDICPKKQVLESFQVKSCPDAIDEVFHSKFHIIGAVGIGIAVVMIFGMIFSMILCCAIR 220          
BLAST of Tetraspanin vs. UniProt/SwissProt
Match: sp|Q8WMQ3|CD9_PIG (CD9 antigen OS=Sus scrofa OX=9823 GN=CD9 PE=2 SV=3)

HSP 1 Score: 70.4774 bits (171), Expect = 1.008e-12
Identity = 60/171 (35.09%), Postives = 91/171 (53.22%), Query Frame = 2
Query:  263 TAFVIGFYVTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEELKSKPDDTEHWMNGVQRNMKCCGYKGSSDYTKVPGSCCSTSKCEDSY-TRGCESAWTELIQNNWVIFASXXXXXXXXXXXXXXFSMCLCCTAR 772
            ++F  G Y+ +G GA  ++VG  GCCGA  ES C+LG +F FLL+IFA EIAA +    +KD+V   V   ++    +LK K D     +  +   + CCG  G  +  ++    C       S   + C  A  E+ QN + I  ++ +GI ++ + G+IFSM LCC  R
Sbjct:   52 SSFYTGVYILIGAGALMMVVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDQVIKEVQDFYRDTYNKLKGKDDPQRETLKAIHYALDCCGLMGEVE--QLLADICPQRDVLSSLPMKPCPEAIKEVFQNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIR 220          
BLAST of Tetraspanin vs. UniProt/SwissProt
Match: sp|P21926|CD9_HUMAN (CD9 antigen OS=Homo sapiens OX=9606 GN=CD9 PE=1 SV=4)

HSP 1 Score: 68.9366 bits (167), Expect = 3.721e-12
Identity = 58/171 (33.92%), Postives = 93/171 (54.39%), Query Frame = 2
Query:  263 TAFVIGFYVTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEELKSKPDDTEHWMNGVQRNMKCCGYKGSSDYTKVPGSCCSTSKCEDSYT-RGCESAWTELIQNNWVIFASXXXXXXXXXXXXXXFSMCLCCTAR 772
            ++F  G Y+ +G GA  ++VG  GCCGA  ES C+LG +F FLL+IFA EIAA +    +KD+V   V   ++    +LK+K +     +  +   + CCG  G  +  +     C      +++T + C  A  E+  N + I  ++ +GI ++ + G+IFSM LCC  R
Sbjct:   54 SSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVE--QFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIR 222          
BLAST of Tetraspanin vs. TrEMBL
Match: C1L5Z0 (Tetraspanin OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 7.647e-27
Identity = 83/236 (35.17%), Postives = 133/236 (56.36%), Query Frame = 2
Query:  128 KACHSCIRILMMIFNXXXXXXXXXXXXXXXXXXXXXXXKNM---GAEGTAFVIGFYVTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEE---LKSKPDDTEHWMNGVQRNMKCCGYKGSSDYTK-VPGSCC---------STSKCEDSYTRGCESAWTELIQNNWVIFASXXXXXXXXXXXXXXFSMCLCCTARSIEYD 787
            K C  C+R+++++FNF+ VL GL + G  +Y YL    +++     +  A  I  Y  MGIG  TL++   GCCGAYHES CLLGTYF  L++IFA ++    L  LY++++  YV  + ++G EE   L+ + ++   +M+ +QR ++CCG  G  DY + +P +CC         +  K E+ Y  GC+  +  ++++  VI     + I   E+  L+FSM +CCT R    D
Sbjct:    2 KGCVQCLRVILVVFNFLVVLIGLAVLGFSVYIYLEPEAQDIILASGQQHAVQIMLYALMGIGGITLVIALFGCCGAYHESQCLLGTYFTILIVIFATQVTGATLGYLYREEIMKYVDDRMREGIEEYSMLRDQRENPVPFMDSIQRMLRCCGVNGYEDYRESIPIACCDHHISTCLNALLKPEEVYKDGCKDKYKAMLKDKLVIIFLATVSIAAFEIFCLLFSMVMCCTIRQYHSD 237          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A095A6B6 (Tetraspanin OS=Schistosoma haematobium OX=6185 GN=MS3_09698 PE=3 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 1.451e-26
Identity = 84/236 (35.59%), Postives = 133/236 (56.36%), Query Frame = 2
Query:  128 KACHSCIRILMMIFNXXXXXXXXXXXXXXXXXXXXXXXKNM---GAEGTAFVIGFYVTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEE---LKSKPDDTEHWMNGVQRNMKCCGYKGSSDYTK-VPGSCCS--TSKC-------EDSYTRGCESAWTELIQNNWVIFASXXXXXXXXXXXXXXFSMCLCCTARSIEYD 787
            K C  C+R+++++FNF+ VL GL + G  +Y YL    +++     +  A  I  Y  MGIG  TL++   GCCGAYHES CLLGTYF  L++IFA ++    L  LY++++  YV  + ++G EE   L+ + ++   +M+ +QR ++CCG  G  DY + +P +CC    S C       E+ Y  GC+  +  ++++  VI     + I   E+  L+FSM +CCT R    D
Sbjct:    2 KGCIQCLRVILVVFNFLVVLIGLAVLGFSVYIYLEPEAQDIILASGQQHAVQIMLYALMGIGGITLVIALFGCCGAYHESQCLLGTYFTILIVIFATQVTGATLGYLYREEIMKYVDDRMREGIEEYSMLRDQRENPVPFMDSIQRMLRCCGVNGYEDYRESIPIACCDHHVSTCLNALLSPEEVYKEGCKDKYKVMLKDKLVIIFLATVSIAAFEIFCLLFSMVMCCTIRQYHSD 237          
BLAST of Tetraspanin vs. TrEMBL
Match: Q86D97 (Tetraspanin OS=Schistosoma mansoni OX=6183 GN=Smp_095630 PE=2 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 1.512e-26
Identity = 84/236 (35.59%), Postives = 133/236 (56.36%), Query Frame = 2
Query:  128 KACHSCIRILMMIFNXXXXXXXXXXXXXXXXXXXXXXXKNM---GAEGTAFVIGFYVTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEE---LKSKPDDTEHWMNGVQRNMKCCGYKGSSDYTK-VPGSCCS--TSKC-------EDSYTRGCESAWTELIQNNWVIFASXXXXXXXXXXXXXXFSMCLCCTARSIEYD 787
            K C  C+R+++++FNF+ VL GL + G  +Y YL    +++     +  A  I  Y  MGIG  TL++   GCCGAYHES CLLGTYF  L++IFA ++    L  LY++++  YV  + ++G EE   L+ + ++   +M+ +QR ++CCG  G  DY + +P +CC    S C       E+ Y  GC+  +  ++++  VI     + I   E+  L+FSM +CCT R    D
Sbjct:    2 KGCIQCLRVILVVFNFLVVLIGLSVLGFSVYIYLEPEAQDIILASGQQHAVQIMLYALMGIGGITLVIALFGCCGAYHESQCLLGTYFTILIVIFATQVTGATLGYLYREEIMKYVDDRMREGIEEYSMLRDQRENPVPFMDSIQRMLRCCGVNGYEDYRESIPIACCDHHVSTCLNALLSPEEVYKEGCKDKYKVMLKDKLVIIFLATVSIAAFEIFCLLFSMVMCCTIRQYHSD 237          
BLAST of Tetraspanin vs. TrEMBL
Match: Q5C190 (Tetraspanin (Fragment) OS=Schistosoma japonicum OX=6182 PE=2 SV=2)

HSP 1 Score: 110.923 bits (276), Expect = 6.819e-25
Identity = 68/187 (36.36%), Postives = 105/187 (56.15%), Query Frame = 2
Query:  266 AFVIGFYVTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEE---LKSKPDDTEHWMNGVQRNMKCCGYKGSSDYTK-VPGSCC---------STSKCEDSYTRGCESAWTELIQNNWVIFASXXXXXXXXXXXXXXFSMCLCCTARSIEYD 787
            A  I  Y  MGIG  TL++   GCCGAYHES CLLGTYF  L++IFA ++    L  LY++++  YV  + ++G EE   L+ + ++   +M+ +QR ++CCG  G  DY + +P +CC         +  K E+ Y  GC+  +  ++++  VI     + I   E+  L+FSM +CCT R    D
Sbjct:   25 AVQIMLYALMGIGGITLVIALFGCCGAYHESQCLLGTYFTILIVIFATQVTGATLGYLYREEIMKYVDDRMREGIEEYSMLRDQRENPVPFMDSIQRMLRCCGVNGYEDYRESIPIACCDHHISTCLNALLKPEEVYKDGCKDKYKAMLKDKLVIIFLATVSIAAFEIFCLLFSMVMCCTIRQYHSD 211          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A4Z2DLZ3 (Tetraspanin OS=Schistosoma japonicum OX=6182 GN=EWB00_010998 PE=3 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 1.310e-24
Identity = 66/182 (36.26%), Postives = 103/182 (56.59%), Query Frame = 2
Query:  281 FYVTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEE---LKSKPDDTEHWMNGVQRNMKCCGYKGSSDYTK-VPGSCC---------STSKCEDSYTRGCESAWTELIQNNWVIFASXXXXXXXXXXXXXXFSMCLCCTARSIEYD 787
             Y  MGIG  TL++   GCCGAYHES CLLGTYF  L++IFA ++    L  LY++++  YV  + ++G EE   L+ + ++   +M+ +QR ++CCG  G  DY + +P +CC         +  K E+ Y  GC+  +  ++++  VI     + I   E+  L+FSM +CCT R    D
Sbjct:    2 LYALMGIGGITLVIALFGCCGAYHESQCLLGTYFTILIVIFATQVTGATLGYLYREEIMKYVDDRMREGIEEYSMLRDQRENPVPFMDSIQRMLRCCGVNGYEDYRESIPIACCDHHISTCLNALLKPEEVYKDGCKDKYKAMLKDKLVIIFLATVSIAAFEIFCLLFSMVMCCTIRQYHSD 183          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: cd82a (CD82 antigen [Source:NCBI gene;Acc:103021753])

HSP 1 Score: 70.8626 bits (172), Expect = 1.384e-13
Identity = 50/151 (33.11%), Postives = 79/151 (52.32%), Query Frame = 2
Query:  266 AFVIGFYVTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEELKSKPDDTEHWMNGVQRNMKCCGYKGSSDYTK-----------VPGSCCSTSKCEDSYTRGCESAWTELIQNNW 685
            A  +G Y+ +G+G+F++++G  GC GA +E  CLLG YF  LLLI  A++AA VL+   ++ +++       K  E    +    E   + +QRNM+CCG+ G  D+ +            P SC +TS   D+   G  S + E   +NW
Sbjct:   52 ALKVGSYILIGVGSFSMLMGFVGCLGAIYEVRCLLGLYFTCLLLILIAQVAAAVLIYFQRNLLRTETSNIVTKLLENYNGQNKTAEQAWDYIQRNMRCCGWTGPEDWMRNPVIVNSSQMLYPCSCRNTSVPGDN---GTNSGFCEAQSDNW 199          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: cd82a (CD82 antigen [Source:NCBI gene;Acc:103021753])

HSP 1 Score: 70.4774 bits (171), Expect = 1.460e-13
Identity = 50/151 (33.11%), Postives = 79/151 (52.32%), Query Frame = 2
Query:  266 AFVIGFYVTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEELKSKPDDTEHWMNGVQRNMKCCGYKGSSDYTK-----------VPGSCCSTSKCEDSYTRGCESAWTELIQNNW 685
            A  +G Y+ +G+G+F++++G  GC GA +E  CLLG YF  LLLI  A++AA VL+   ++ +++       K  E    +    E   + +QRNM+CCG+ G  D+ +            P SC +TS   D+   G  S + E   +NW
Sbjct:   51 ALKVGSYILIGVGSFSMLMGFVGCLGAIYEVRCLLGLYFTCLLLILIAQVAAAVLIYFQRNLLRTETSNIVTKLLENYNGQNKTAEQAWDYIQRNMRCCGWTGPEDWMRNPVIVNSSQMLYPCSCRNTSVPGDN---GTNSGFCEAQSDNW 198          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: cd82b (CD82 antigen-like [Source:NCBI gene;Acc:107197274])

HSP 1 Score: 68.9366 bits (167), Expect = 5.416e-13
Identity = 59/200 (29.50%), Postives = 103/200 (51.50%), Query Frame = 2
Query:  275 IGFYVTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEELKSKPDDTEHWMNGVQRNMKCCGYKGSSDYTK--------------------VPGS-------CCSTSKCEDSYTRGCESAWTELIQNNWVIFASXXXXXXXXXXXXXXFSMCLCCTARSIEYDMV 793
            +G Y+ +G+G+ ++++G  GC GA +E  CLLG YF  L+LI  A++ A VL+   +D +K  +     K       +   TEH  + +Q+ ++CCG+ G S++T+                    +PGS       C S       YT+GC S+  + + +N  +   + +G+ ++ELLG++ SMCLC + +  +Y  V
Sbjct:   54 VGSYILIGVGSLSMLMGFLGCIGAIYEIRCLLGLYFTCLVLILIAQVTAAVLIYFQRDLLKREISTVVNKILVGYTGQNKTTEHAWDYLQKTIQCCGWTGPSNWTENVWIKNSSQILYPCSCRNESIPGSEVQESGLCQSLVPEWPVYTKGCMSSVEDWLLSNCGVILGVCVGVAVLELLGMMLSMCLCKSVQQEDYSKV 253          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: zgc:64051 (leukocyte surface antigen CD53-like [Source:NCBI gene;Acc:103036604])

HSP 1 Score: 64.3142 bits (155), Expect = 1.177e-11
Identity = 41/131 (31.30%), Postives = 65/131 (49.62%), Query Frame = 2
Query:  299 IGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEELKSKPDDTEHWMNGVQRNMKCCGYKGSSDY-TKVPGSCCSTSKCEDSYTRGCESAWTELIQNNWV 688
            +G F   V   G  GA  E+ CLL ++FI L L+  AE+     +++Y+ ++   +  +  K  EE          W + VQ+  KCCG K ++D+   VP SCC T  CE+ Y +GC     +  + N +
Sbjct:   57 LGIFITCVSFLGFLGALKENRCLLISFFILLFLVMLAELGVACFLLMYESQIDKTIEGELNKSLEEAMKNNGSNIEW-DTVQKTFKCCGVKNATDWKNNVPKSCCKTESCEEKYNQGCYKKLQDWFEGNLL 186          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: cd81a (CD81 molecule [Source:NCBI gene;Acc:103037709])

HSP 1 Score: 64.6994 bits (156), Expect = 1.371e-11
Identity = 55/175 (31.43%), Postives = 85/175 (48.57%), Query Frame = 2
Query:  269 FVIGFYVTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVK----SYVGVKFQKGT-EELKSKPDDTEHWMNGVQRNMKCCGYKG-SSDYTKVPGSCCSTSKCEDSYTRGCESAWTELIQNNWVIFASXXXXXXXXXXXXXXFSMCLCCTARS 775
            F I  Y+ + +GA  + VG  GC GA  ES CLLGT+F  L+++FA E+AAG+   ++KDK+     ++    + KG  + L+ K D     +      ++CCG +G +S +T      C           GC S    L      +     L + +I +  +IFSM LCC  R+
Sbjct:   58 FYISVYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFACLVILFACEVAAGIWGFIHKDKISKELINFYDSVYDKGMGQTLQDKKDAAAAVLKVFHETLQCCGKEGVTSIFTGFATDLCPKKDSILDIQEGCHSKIRTLFTEKIYLIGIAALVVAVIMIFEMIFSMVLCCGIRN 232          
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Match: tspan4a (tetraspanin 4a [Source:ZFIN;Acc:ZDB-GENE-040718-38])

HSP 1 Score: 54.299 bits (129), Expect = 7.756e-9
Identity = 72/237 (30.38%), Postives = 120/237 (50.63%), Query Frame = 2
Query:  122 MCKACHSCIRILMMIFNXXXXXXXXXXXXXXXXXXXXXXXKNMGAEGTAFVIGFYVTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEELKSKPDD--TEHWMNGVQRNMKCCGYKGSSDY------TKVPGSCCST------SKCEDSYTR-GCESAWTELIQNNWVIFASXXXXXXXXXXXXXXFSMCLCCTARSIEYD 787
            M +ACH C++ L+ +FN +F L G G+ G+G++  +T       +     +    + + +GA  +++G  GC GA  E+PCLL T+F+ LL++F AE   GVL  +Y+ K+++      ++G     ++ +   T  W N +   + CCG    +D+       +VP SCC        S    +Y R GC       I++N        LGI  I++LG++FSM + C  R+ E D
Sbjct:    3 MGRACHYCLKYLLFVFNLVFWLGGCGVLGVGIWLSITQGGVAAVSPNLPLLSAANLLIALGAAAMLLGFLGCLGAIKENPCLLLTFFVLLLVVFLAEFVGGVLFFVYQGKLETRAQDDLRQGLHLYGTEGNVGLTNAW-NTLHSEVGCCGVHNHTDWFAVFGERRVPDSCCRDPASGCGSVPSSAYARPGCYEKLKSWIKDNLAYVGIFCLGIATIQILGMVFSMTMFCHLRAEEKD 238          
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005284.1 (pep scaffold:Pmarinus_7.0:GL480552:16638:25636:-1 gene:ENSPMAG00000004798.1 transcript:ENSPMAT00000005284.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.6842 bits (130), Expect = 8.087e-9
Identity = 49/163 (30.06%), Postives = 79/163 (48.47%), Query Frame = 2
Query:  284 YVTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEELKSKPDDTEHWMNGVQRNMKCCGYKGSSDY--------------TKVPGSCC--STSKC-EDS----------YTRGCESAWTELIQNNWVI 691
            YV + +G    +V A GCCGA+ ES  ++ T+ +FL LIF AE+AAG+   ++KD+++  V  K +    +  +K  D    ++ +Q+ ++CCG     D+                VP SCC   TS C +D           YT+GC       ++ N V+
Sbjct:   62 YVIIAVGVVIFVVAAFGCCGAHKESYFMVATFSVFLFLIFVAELAAGIGAYIFKDQLRDVVETKAKVVINDYPTKNKDP---VDNMQKELQCCGVVHYQDWFNSTNWVTSDPNNPNSVPDSCCLNVTSGCGQDDIRFKNATAIIYTKGCVEKLEATMKENIVL 221          
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Match: tspan3a (tetraspanin 3a [Source:ZFIN;Acc:ZDB-GENE-030131-7787])

HSP 1 Score: 53.1434 bits (126), Expect = 2.375e-8
Identity = 48/162 (29.63%), Postives = 74/162 (45.68%), Query Frame = 2
Query:  257 EGTAFVIGFYVTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEELKSKPDDT-EHWMNGVQRNMKCCGYKGSSDY-----------TKVPGSCC--STSKCE-------DSYTRGCESAWTELIQN 679
            E    ++   V + +G F  +VG  GCC    ES C L T+FI LL+IF+ E+ A +L   Y+ +VK  V     +   E      +T    ++ VQ  +KCCG K   D+             VP SCC  + + C+       D Y  GCE+   + +++
Sbjct:   48 EDRYVLLAPLVVVAVGIFLFVVGIVGCCATVRESKCGLSTFFILLLMIFSLEVVAALLGYAYRGQVKDKVERTISQVFNEYNGTDSNTASRAIDYVQHQLKCCGVKNYLDWKDRPWFNHTGNNSVPISCCRSNVTHCDGNIKHPGDIYNEGCEAMVEKTVKD 209          
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Match: tspan4a (tetraspanin 4a [Source:ZFIN;Acc:ZDB-GENE-040718-38])

HSP 1 Score: 49.2914 bits (116), Expect = 3.821e-7
Identity = 51/174 (29.31%), Postives = 83/174 (47.70%), Query Frame = 2
Query:  287 VTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEELKSKPDD--TEHWMNGVQRNMKCCGYKGSSDY------TKVPGSC-------CSTSKCEDSYTRGCESAWTELIQNNWVIFASXXXXXXXXXXXXXXFSMCLCC 763
            + +  G   ++VG  GC GA  E  CLL ++F+ LL+IF  E+   +L  +Y+D++  +     ++G     S+ +   T  W N VQ +  CCG    +D+       +VP SC       C   K    +  GC       I+ N ++    +L I LI++LG+ FSM + C
Sbjct:   51 ILISTGTIMMVVGFIGCLGAIKEHKCLLLSFFVCLLIIFVLEMICVILFFMYRDQIDGHAKDDLKEGLRLYGSEGNVGLTNAW-NIVQTDFHCCGVVNHTDWFLAFGDKRVPDSCCMEYSVDCGRDKPNTWWPSGCYDKVEAWIEENLMVLGVFILCISLIQILGMAFSMSMFC 223          
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Match: cd82b (CD82 molecule b [Source:ZFIN;Acc:ZDB-GENE-030131-2857])

HSP 1 Score: 48.9062 bits (115), Expect = 5.245e-7
Identity = 38/110 (34.55%), Postives = 58/110 (52.73%), Query Frame = 2
Query:  269 FVIGFYVTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYV-GVKFQ--KGTEELKSK-PDDTEHWMNGVQRNMKCCGYKGSSDY 586
              I  Y  +GIG+ T +V   GC GA  E  CLL  YFI L+ +  A++A G +V + K+K+ + + GV F   K    L ++ P  T    + +Q+   CCG  G+ D+
Sbjct:   32 LTIPAYALVGIGSITCLVSLFGCLGASKEVRCLLAVYFICLVGLLVAQVAIGTVVYINKEKINNKLNGVAFNIIKSYWNLSTEDPLHTWRLWDSIQQKFNCCGLNGTEDW 141          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO47592 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLE8])

HSP 1 Score: 67.0106 bits (162), Expect = 7.057e-13
Identity = 63/189 (33.33%), Postives = 94/189 (49.74%), Query Frame = 2
Query:  257 EGTAFVIGFYVTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEEL--KSKPDDTEHWMNGVQRNMKCCGYKGSSD-----YTK-----VPGSCCSTS--------KCEDSYTRGCESAWTELIQNNWVIFASXXXXXXXXXXXXXXFSMCLCC 763
            +   ++ G  + + +GAF  +V   GCCGA  E  CLL T+F  L +I A EI    L  +Y++KV+  +G            K K   T+ + + +Q+  KCCG  G  D     YTK     VP SCC T         K  D YT+GC      L+++N +I   I +G+ +I++L +IF+M L C
Sbjct:   46 QSVKYITGSIIIIAVGAFIALVSFFGCCGAIKEHRCLLATFFALLFIILAVEITGTALGYVYRNKVEEQLGKDMNDTIVSYGEKGKEGITDAY-DAIQKKEKCCGINGFKDWQRSYYTKGNHSIVPDSCCKTVSKGCGINFKENDIYTKGCFDTVKTLLKDNLIIIGGIGIGVAVIQILAMIFAMVLVC 233          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO38288 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDC9])

HSP 1 Score: 65.855 bits (159), Expect = 2.240e-12
Identity = 43/137 (31.39%), Postives = 70/137 (51.09%), Query Frame = 2
Query:  284 YVTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEELKSKPDDTEHWMNGVQRNMKCCGYKGSSDYTK---------------VPGSCCSTSKCEDSYTRGC 649
            +  + +G    I+G  GC GA  E+ CLL  + + L +IF  ++A GV V +++DKV++ +  K Q    + +    D ++ ++GVQ+  KCCG KG +D+ K               VP SCC     +D+  R C
Sbjct:   57 FALIIVGGIMFILGFSGCIGALRENICLLKFFSVVLAIIFFLQLALGVFVFVFQDKVEAVIVEKLQTAVTKYRDNA-DLQNLIDGVQQEFKCCGAKGINDWDKNIYFNCSSPGSEACGVPYSCC----IKDTINRQC 188          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO47593 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLE9])

HSP 1 Score: 60.8474 bits (146), Expect = 9.005e-11
Identity = 54/188 (28.72%), Postives = 87/188 (46.28%), Query Frame = 2
Query:  257 EGTAFVIGFYVTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEELKSK-PDDTEHWMNGVQRNMKCCGYKGSSDY----------TKVPGSCC--STSKC------EDSYTRGCESAWTELIQNNWVIFASXXXXXXXXXXXXXXFSMCLCC 763
            +   +  G+ + +  GA   ++   GCCGA  ES CLL  +F  L +I A E A   L  +Y+DKV   +        +    K  +      + +Q+  KCCG  G  D+          T VP SCC   T  C      +D  T+GC     +L+++N +I   + +G+ +I++L + F+M L C
Sbjct:   46 QSVKYATGYIIVIAAGALIALISFFGCCGAIKESRCLLAAFFTLLFIILATEAAGTALGFVYRDKVNQKLRQDMNNTLDSYGQKGKEGITLAYDLIQKMEKCCGINGYEDWQQTPFANGSSTLVPDSCCKKETKDCGSNFAQDDINTKGCLGTIMKLLKDNLMIVGGVGVGVAVIQILAMTFAMVLIC 233          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO46887 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNN8])

HSP 1 Score: 60.077 bits (144), Expect = 1.665e-10
Identity = 55/171 (32.16%), Postives = 85/171 (49.71%), Query Frame = 2
Query:  332 GCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEELK-SKPDDTEHWMNGVQRNMKCCGYKGSSDYTK----------VPGSCC---STSKCEDS--------YTRGCESAWTELIQNNWVIFASXXXXXXXXXXXXXXFSMCLCCTARSI 778
             CCGA  ES C+LGTYF  +  IF  E+ A VL  +Y+++++  +    +    E   S  D     ++ + R+ KCCG     D+ +          VP SCC   S SKC ++        Y RGC     + + NN  + +   + I +I+L+G+IF+ CLCC  R+I
Sbjct:   64 ACCGALKESQCMLGTYFGLVTAIFCLEVTAIVLAYVYRERIEKNLHGDIRSTMNEYHLSGHDAVTRAIDEIHRDFKCCGNAQYRDWFETKWAKTHPDMVPRSCCKDPSDSKCNENISKDPTKIYRRGCYMFVKKYLSNNLHVISGFGIWIAVIQLMGIIFATCLCCHIRTI 234          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO30884 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZI2])

HSP 1 Score: 59.6918 bits (143), Expect = 2.398e-10
Identity = 56/185 (30.27%), Postives = 95/185 (51.35%), Query Frame = 2
Query:  269 FVIGFYVTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEELKSKPDDTEHWMNGVQRNMKCCGYKGSSDYT--------KVPGSCCSTSKCE-----DSYTRGCESAWTELIQNNWVIFASXXXXXXXXXXXXXXFSMCLCCTARSIEY 784
            F+ G  + + +G    I+   GCCGA+ E+ C+L  +FI LL++   EIAA VL  + KDK++S +          +K  P + +  ++ +Q + +CCG KG SD+T          PGSCC     +        ++GC  A  + + +  +I A + +G+ +I++LG+I +M L C      Y
Sbjct:   49 FMSGSRLLIAVGCIITIIAFFGCCGAWKENKCMLILFFILLLIVLGLEIAAAVLGYINKDKIQSDLTDDI---IRNIKEYPKNNKAAIDAMQMDFECCGAKGPSDWTFYGQMKYKAGPGSCCGKPNNDACLPGTRNSKGCFEAMKDFVNDKLIIIAGLAIGLIVIQILGMILAMTLICRIHKGSY 230          
BLAST of Tetraspanin vs. Ensembl Medaka
Match: cd9a (CD9 antigen [Source:NCBI gene;Acc:101173781])

HSP 1 Score: 68.5514 bits (166), Expect = 4.440e-13
Identity = 57/170 (33.53%), Postives = 91/170 (53.53%), Query Frame = 2
Query:  266 AFVIGFYVTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEELKSKPDD-TEHWMNGVQRNMKCCGYKGSSDYTKVPGSCCSTSKCEDSYTRGCESAWTELIQNNWVIFASXXXXXXXXXXXXXXFSMCLCCTAR 772
            AF  G YV +G GA  ++VG  GCCGA  ESPC+LG +F FLL++FA E+AAG+     + KV   +   + +  ++  S  D+  +  +  +Q  +KCCG    +D +    +C      E+   + C  A  E+  +   I A + + + ++ + G+IFSM LCC  R
Sbjct:   54 AFYAGVYVLIGAGALIMVVGFLGCCGAIRESPCMLGVFFFFLLILFAIEVAAGIWGFSNQTKVVEDISSFYMQTYKDYTSTGDERVKETLRLIQAQLKCCGPGKDTDES-FKETCPRGEPLEELLIKSCPDAIEEVFDSKLHIIAVVGITMGVVMVFGMIFSMLLCCAIR 222          
BLAST of Tetraspanin vs. Ensembl Medaka
Match: cd63 (CD63 molecule [Source:NCBI gene;Acc:101174188])

HSP 1 Score: 68.5514 bits (166), Expect = 7.022e-13
Identity = 49/157 (31.21%), Postives = 75/157 (47.77%), Query Frame = 2
Query:  287 VTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEELKSKPDDTEHWMNGVQRNMKCCGYKGSSDYT-------KVPGSCC----------STSKCEDSYTRGCESAWTELIQNN--WVIFAS 700
            V + +GA    +   GCCGA+ E  C++ T+ + L LI   EIAA +   ++++K+   V     K  E  K+  DD +  ++ +Q N+KCCG   SSD++        VP SCC          S       Y +GC      L++ N  WVI A+
Sbjct:   56 VIIAVGALIFFIAFFGCCGAWKEHYCMVTTFAVLLTLIIIIEIAAAIAGFVFRNKISPIVNEGLTKMIENYKNGTDDFKATVDQIQENLKCCGVNSSSDWSYLDSDGNSVPDSCCINKTKGCGKGSMKNAGTVYQKGCHDVIENLLKTNIQWVIVAA 212          
BLAST of Tetraspanin vs. Ensembl Medaka
Match: cd63 (CD63 molecule [Source:NCBI gene;Acc:101174188])

HSP 1 Score: 68.1662 bits (165), Expect = 8.893e-13
Identity = 49/157 (31.21%), Postives = 75/157 (47.77%), Query Frame = 2
Query:  287 VTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEELKSKPDDTEHWMNGVQRNMKCCGYKGSSDYT-------KVPGSCC----------STSKCEDSYTRGCESAWTELIQNN--WVIFAS 700
            V + +GA    +   GCCGA+ E  C++ T+ + L LI   EIAA +   ++++K+   V     K  E  K+  DD +  ++ +Q N+KCCG   SSD++        VP SCC          S       Y +GC      L++ N  WVI A+
Sbjct:   56 VIIAVGALIFFIAFFGCCGAWKEHYCMVTTFAVLLTLIIIIEIAAAIAGFVFRNKISPIVNEGLTKMIENYKNGTDDFKATVDQIQENLKCCGVNSSSDWSYLDSDGNSVPDSCCINKTKGCGKGSMKNAGTVYQKGCHDVIENLLKTNIQWVIVAA 212          
BLAST of Tetraspanin vs. Ensembl Medaka
Match: tspan2b (tetraspanin-2 [Source:NCBI gene;Acc:101157617])

HSP 1 Score: 66.6254 bits (161), Expect = 1.934e-12
Identity = 63/177 (35.59%), Postives = 91/177 (51.41%), Query Frame = 2
Query:  251 GAEGTAFVIGFYVTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEELKSKPDDTEHWMNGVQRNMKCCGYKGSSDYTKVPGSCCSTSKCEDSY--TRGCESAWTELIQNNWVIFASXXXXXXXXXXXXXXFSMCLCCTARS 775
            GA  T F IG Y+ +G G+  ++VG  GCCGA  ES CLLG++F  LL+IF +E+AAGV   L KDK+       ++K   E     ++    ++  Q  +KCCG               + S C DS   T+ CE+   E + N   I   + +GI  +  +G+IFSM LCC   +
Sbjct:   50 GAPDT-FFIGVYILIGAGSLVMMVGFFGCCGAVRESQCLLGSFFACLLIIFGSEVAAGVFAFLSKDKIIDDAQNFYKKEYSE-----NNNSTLISIYQDMLKCCG--------------TAQSPCPDSEPDTKNCETEIKEFLSNKLFIIGCVGIGIAGVMTIGMIFSMVLCCAIHN 206          
BLAST of Tetraspanin vs. Ensembl Medaka
Match: ENSORLT00000021688.2 (tetraspanin-8 [Source:NCBI gene;Acc:101157824])

HSP 1 Score: 65.4698 bits (158), Expect = 6.775e-12
Identity = 59/169 (34.91%), Postives = 91/169 (53.85%), Query Frame = 2
Query:  278 GFYVTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEELKSKPDDTEHWMNGVQRNMKCCG-YKGSSDYTKVPGSCC-----STSKCEDS-YTRGCESAWTELIQNNWVIFASXXXXXXXXXXXXXXFSMCLCC 763
            G  + + IG    ++   GC GAY ES C+L  +FIFLL+IF   +AAG+L  + +  V  +V  + QK T  L ++PD  +  +  +Q  +KCCG  +G +D+TK P SC      +T+ C+   Y   C      L++ N  +   I   I +I +LG+IFSM + C
Sbjct:   65 GVDLMIAIGVIVFVLAFLGCLGAYKESRCMLMMFFIFLLVIFTLLLAAGILGAVGEKTVNDWVRKELQKLT-PLSNQPDSVKKDLEALQAELKCCGIIQGPADWTKPPASCFCNGTDTTTTCKGGIYQTPCADQIINLMKQNMKVVLGISFAIAIIMILGMIFSMMIYC 232          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000043678.1 (SMESG000043678.1)

HSP 1 Score: 349.747 bits (896), Expect = 3.742e-121
Identity = 227/228 (99.56%), Postives = 227/228 (99.56%), Query Frame = 2
Query:  122 MCKACHSCIRILMMIFNXXXXXXXXXXXXXXXXXXXXXXXKNMGAEGTAFVIGFYVTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEELKSKPDDTEHWMNGVQRNMKCCGYKGSSDYTKVPGSCCSTSKCEDSYTRGCESAWTELIQNNWVIFASXXXXXXXXXXXXXXFSMCLCCTARSIEYDMVETRA 805
            MCKACHSCIRILMMIFNFIFVLCGLGLFGLGLYFYLTSFFKNMGAEGTAFVIGFYVTMGIGAFTLIVGACGCCGAYHESPCLLGTYFIFLLLIFAAEIAAGVLVVLYKDKVKSYVGVKFQKGTEELKSKPDDTEHWMNGVQRNMKCCGYKGSSDYTKVPGSCCSTSKCED YTRGCESAWTELIQNNWVIFASILLGIPLIELLGLIFSMCLCCTARSIEYDMVETRA
Sbjct:    1 MCKACHSCIRILMMIFNFIFVLCGLGLFGLGLYFYLTSFFKNMGAEGTAFVIGFYVTMGIGAFTLIVGACGCCGAYHESPCLLGTYFIFLLLIFAAEIAAGVLVVLYKDKVKSYVGVKFQKGTEELKSKPDDTEHWMNGVQRNMKCCGYKGSSDYTKVPGSCCSTSKCEDPYTRGCESAWTELIQNNWVIFASILLGIPLIELLGLIFSMCLCCTARSIEYDMVETRA 228          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000035080.1 (SMESG000035080.1)

HSP 1 Score: 82.4185 bits (202), Expect = 7.009e-18
Identity = 78/235 (33.19%), Postives = 125/235 (53.19%), Query Frame = 2
Query:  122 MCKACHSCIRILMMIFNXXXXXXXXXXXXXXXXXXXXXXXKNMGAEG---TAFVIGFYVTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKD-KVKSYVGVKFQKGTEELKSKPDDTEHWMNGVQRNMKCCGYKGSSDYTK------VPGSCCS------TSKCE--DSYTRGCESAWTELIQNNWVIFASXXXXXXXXXXXXXXFSMCLCCTAR 772
            M K C  CIRI +++ NF   L G+ + G  ++ Y  +   ++       T F       MGIG FT+ +   GC GAYHES  +LG YF  +L +FA+++A G L  +YKD K+ + + +  Q       +K +  E ++N VQ+ +KCCG    +DY K      +P SCC        +K E  +++T+GC+  + E  Q+   + + I++ +  IE LG+IFS+ LC + R
Sbjct:    1 MSKKCFHCIRIFVVVVNFTLFLIGIAILGTSIFLYTRTSNHDLTRSPDHYTEFKKILAFIMGIGIFTIALSLVGCFGAYHESQPILGIYFSVMLFLFASQVAVGSLYFVYKDEKLTTNLKISIQNYMNSKITKQE--EIFLNSVQKMLKCCGVDSVNDYIKKDTPSNIPFSCCDYEIHECKAKVEKKNAFTKGCKDKYKEFSQHKLGVISMIIIVMCTIEFLGMIFSVALCFSIR 233          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000021627.1 (SMESG000021627.1)

HSP 1 Score: 70.8626 bits (172), Expect = 7.424e-14
Identity = 54/180 (30.00%), Postives = 87/180 (48.33%), Query Frame = 2
Query:  281 FYVTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQKGTEELKSKPDDTEHWMNGVQRNMKCCGYKGSSDYTK-------------VPGSCC-STSKCED------SYTRGCESAWTELIQNNWVIFASXXXXXXXXXXXXXXFSMCLC 760
            F   + +G    ++  CGCCGA  ES  LLG Y +FL+LI   ++A G+  + YK K++  V    +    EL     D +   + +Q+ + CCG +G  D+ K              P SCC   ++C +      +++ GC S   E +Q  + IF  ++LGI   E+  +I + CLC
Sbjct:   56 FIGVLVLGIIIFVIAFCGCCGAVRESKLLLGMYIVFLMLIIFIQVALGIFAIFYKQKIEKSVSKTLKTAITELYGYDKDNDKITDNIQQILSCCGIEGPQDWEKSKWYIEKMNKSQMFPKSCCRDNAECYNKISGATAFSEGCVSRLREYLQRIFPIFIGVILGIAFFEIFVVICAFCLC 235          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000008659.1 (SMESG000008659.1)

HSP 1 Score: 60.8474 bits (146), Expect = 1.442e-10
Identity = 39/137 (28.47%), Postives = 62/137 (45.26%), Query Frame = 2
Query:  278 GFYVTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKVKSYVGVKFQK--GTEELKSKPDDTEHWMNGVQRNMKCCGYKGSSDYTKVPGSCCSTSKCEDSYTRGCESAWTELIQNN 682
            G Y+ + IG    I    GC GA  ESPCLL  + + +  IF   +AAG+  + +K K+   +G    +  G   + +   D    M+ +Q  ++CCG     DY + P   C       S  +GC  +  E ++ N
Sbjct:   53 GAYLFIFIGLIITITSFLGCYGAISESPCLLILFSMVIFFIFVVLMAAGLWAIAHKQKIDKKIGNSLSEIVGKISVNTATKDQIKIMDKIQNELQCCGVISHIDYVEKPPLSCGNDYITISTKKGCHESIKEFLKVN 189          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000019444.1 (SMESG000019444.1)

HSP 1 Score: 57.3806 bits (137), Expect = 3.980e-9
Identity = 37/116 (31.90%), Postives = 56/116 (48.28%), Query Frame = 2
Query:  263 TAFVIGFYVTMGIGAFTLIVGACGCCGAYHESPCLLGTYXXXXXXXXXXXXXXGVLVVLYKDKV-----KSYVGVKFQKGTEELKSKPDDTEHWMNGVQRNMKCCGYKGSSDYTKV 595
            + F I   + + +GAFT I G CGCCGA  ES CLL  Y   +  +  A++A G+   + ++K      KS + +  +     L S P         +   MKCCG KG +D+  +
Sbjct:   62 SLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLVAAVIVAQVAVGIYASVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGI 177          
The following BLAST results are available for this feature:
BLAST of Tetraspanin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CD97.749e-1333.92CD9 molecule [Source:HGNC Symbol;Acc:HGNC:1709][more]
CD97.749e-1333.92CD9 molecule [Source:HGNC Symbol;Acc:HGNC:1709][more]
CD97.749e-1333.92CD9 molecule [Source:HGNC Symbol;Acc:HGNC:1709][more]
CD94.955e-1025.64CD9 molecule [Source:HGNC Symbol;Acc:HGNC:1709][more]
CD532.029e-932.31CD53 molecule [Source:HGNC Symbol;Acc:HGNC:1686][more]
back to top
BLAST of Tetraspanin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tsp-171.143e-632.56Tetraspanin-17 [Source:UniProtKB/Swiss-Prot;Acc:Q... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tsp42Ea2.479e-1136.59gene:FBgn0029508 transcript:FBtr0086171[more]
Tsp42Ea2.479e-1136.59gene:FBgn0029508 transcript:FBtr0086173[more]
Tsp42Ea2.479e-1136.59gene:FBgn0029508 transcript:FBtr0086172[more]
Tsp96F4.196e-1128.31gene:FBgn0027865 transcript:FBtr0330163[more]
Tsp96F9.279e-1128.64gene:FBgn0027865 transcript:FBtr0330164[more]
back to top
BLAST of Tetraspanin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tspan343.213e-1332.77tetraspanin 34 [Source:ZFIN;Acc:ZDB-GENE-060825-20... [more]
cd82b6.236e-1232.84CD82 molecule b [Source:ZFIN;Acc:ZDB-GENE-030131-2... [more]
cd82b6.236e-1232.84CD82 molecule b [Source:ZFIN;Acc:ZDB-GENE-030131-2... [more]
cd9b6.610e-1234.88CD9 molecule b [Source:ZFIN;Acc:ZDB-GENE-040426-27... [more]
cd9b8.667e-1234.88CD9 molecule b [Source:ZFIN;Acc:ZDB-GENE-040426-27... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arsh6.559e-1235.51arylsulfatase family member H [Source:Xenbase;Acc:... [more]
cd92.971e-1134.88CD9 protein [Source:NCBI gene;Acc:549743][more]
tspan14.631e-1131.21tetraspanin 1 [Source:NCBI gene;Acc:548861][more]
tspan15.003e-1131.21tetraspanin 1 [Source:NCBI gene;Acc:548861][more]
cd826.252e-1031.47CD82 molecule [Source:NCBI gene;Acc:394799][more]
back to top
BLAST of Tetraspanin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cd92.820e-1534.12CD9 antigen [Source:MGI Symbol;Acc:MGI:88348][more]
Cd637.595e-1132.96CD63 antigen [Source:MGI Symbol;Acc:MGI:99529][more]
Cd637.595e-1132.96CD63 antigen [Source:MGI Symbol;Acc:MGI:99529][more]
Cd637.595e-1132.96CD63 antigen [Source:MGI Symbol;Acc:MGI:99529][more]
Cd632.173e-934.29CD63 antigen [Source:MGI Symbol;Acc:MGI:99529][more]
back to top
BLAST of Tetraspanin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P40240|CD9_MOUSE1.973e-1434.12CD9 antigen OS=Mus musculus OX=10090 GN=Cd9 PE=1 S... [more]
sp|P30932|CD9_BOVIN1.268e-1332.77CD9 antigen OS=Bos taurus OX=9913 GN=CD9 PE=2 SV=2[more]
sp|P40241|CD9_RAT7.999e-1332.94CD9 antigen OS=Rattus norvegicus OX=10116 GN=Cd9 P... [more]
sp|Q8WMQ3|CD9_PIG1.008e-1235.09CD9 antigen OS=Sus scrofa OX=9823 GN=CD9 PE=2 SV=3[more]
sp|P21926|CD9_HUMAN3.721e-1233.92CD9 antigen OS=Homo sapiens OX=9606 GN=CD9 PE=1 SV... [more]
back to top
BLAST of Tetraspanin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C1L5Z07.647e-2735.17Tetraspanin OS=Schistosoma japonicum OX=6182 PE=2 ... [more]
A0A095A6B61.451e-2635.59Tetraspanin OS=Schistosoma haematobium OX=6185 GN=... [more]
Q86D971.512e-2635.59Tetraspanin OS=Schistosoma mansoni OX=6183 GN=Smp_... [more]
Q5C1906.819e-2536.36Tetraspanin (Fragment) OS=Schistosoma japonicum OX... [more]
A0A4Z2DLZ31.310e-2436.26Tetraspanin OS=Schistosoma japonicum OX=6182 GN=EW... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cd82a1.384e-1333.11CD82 antigen [Source:NCBI gene;Acc:103021753][more]
cd82a1.460e-1333.11CD82 antigen [Source:NCBI gene;Acc:103021753][more]
cd82b5.416e-1329.50CD82 antigen-like [Source:NCBI gene;Acc:107197274][more]
zgc:640511.177e-1131.30leukocyte surface antigen CD53-like [Source:NCBI g... [more]
cd81a1.371e-1131.43CD81 molecule [Source:NCBI gene;Acc:103037709][more]
back to top
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tspan4a7.756e-930.38tetraspanin 4a [Source:ZFIN;Acc:ZDB-GENE-040718-38... [more]
ENSPMAT00000005284.18.087e-930.06pep scaffold:Pmarinus_7.0:GL480552:16638:25636:-1 ... [more]
tspan3a2.375e-829.63tetraspanin 3a [Source:ZFIN;Acc:ZDB-GENE-030131-77... [more]
tspan4a3.821e-729.31tetraspanin 4a [Source:ZFIN;Acc:ZDB-GENE-040718-38... [more]
cd82b5.245e-734.55CD82 molecule b [Source:ZFIN;Acc:ZDB-GENE-030131-2... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO475927.057e-1333.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO382882.240e-1231.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO475939.005e-1128.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468871.665e-1032.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO308842.398e-1030.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cd9a4.440e-1333.53CD9 antigen [Source:NCBI gene;Acc:101173781][more]
cd637.022e-1331.21CD63 molecule [Source:NCBI gene;Acc:101174188][more]
cd638.893e-1331.21CD63 molecule [Source:NCBI gene;Acc:101174188][more]
tspan2b1.934e-1235.59tetraspanin-2 [Source:NCBI gene;Acc:101157617][more]
ENSORLT00000021688.26.775e-1234.91tetraspanin-8 [Source:NCBI gene;Acc:101157824][more]
back to top
BLAST of Tetraspanin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000043678.13.742e-12199.56SMESG000043678.1[more]
SMESG000035080.17.009e-1833.19SMESG000035080.1[more]
SMESG000021627.17.424e-1430.00SMESG000021627.1[more]
SMESG000008659.11.442e-1028.47SMESG000008659.1[more]
SMESG000019444.13.980e-931.90SMESG000019444.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022014 ID=SMED30022014|Name=Tetraspanin|organism=Schmidtea mediterranea sexual|type=transcript|length=1106bp
GTAATTGAATGATCTGTACTCGACCTCTGATTCTTATTTAAAATCAAATC
TCCATCTTAAAATTTAAACTAGTTATTTATTTAATTTTTTTCGATAAAAA
CTACTTAATTGATAAATCACTATGTGTAAAGCATGTCACAGTTGTATTCG
GATATTGATGATGATATTTAATTTTATTTTTGTGTTGTGTGGGTTGGGTT
TGTTCGGTCTCGGATTATACTTTTATCTAACGAGTTTCTTCAAGAATATG
GGCGCAGAAGGAACGGCATTTGTTATTGGATTTTATGTCACTATGGGAAT
TGGAGCATTTACATTGATTGTTGGTGCATGCGGTTGCTGCGGAGCGTACC
ACGAAAGTCCATGTCTACTGGGAACTTATTTTATATTTCTCTTATTGATT
TTTGCTGCCGAAATCGCTGCTGGAGTTTTAGTAGTTCTTTACAAAGACAA
AGTAAAATCATATGTTGGAGTTAAATTTCAAAAAGGTACCGAAGAGTTGA
AATCTAAACCCGATGACACTGAACATTGGATGAACGGAGTGCAGAGAAAT
ATGAAATGTTGCGGTTACAAAGGTTCAAGTGACTATACAAAGGTACCTGG
ATCATGCTGTTCAACCTCAAAGTGTGAAGATTCTTATACACGGGGTTGTG
AAAGTGCTTGGACAGAGTTGATTCAAAACAATTGGGTGATTTTTGCCAGT
ATTCTTCTTGGTATTCCACTTATTGAATTGCTGGGCCTAATATTCTCAAT
GTGTCTCTGCTGTACGGCACGAAGCATTGAGTACGACATGGTCGAGACAA
GAGCGTAAAGGTTCTGAAGATACATTTGCAAAATATACAAAGATTTTTTT
TCATTAATGATTTGAGTGAACCGATACGATTGAAGATCACAAGACCTTAT
ATTTATAAATGTATAATTATTAATATTATTTAAATGTTTGTATAATATTA
ACAAATTTATTTAATCCATCTCATATTCCTAATTTGTTGATAAAGCTTTT
ATTTTTATTTGTATCTAATACTAGTCGATTTGTCCTCTGTCCTAGTCATA
ATAATAATTATTATTATTATAATCTATTTCAGAACGTTGTCAACAAATTG
TCAGCT
back to top

protein sequence of SMED30022014-orf-1

>SMED30022014-orf-1 ID=SMED30022014-orf-1|Name=SMED30022014-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=229bp
MCKACHSCIRILMMIFNFIFVLCGLGLFGLGLYFYLTSFFKNMGAEGTAF
VIGFYVTMGIGAFTLIVGACGCCGAYHESPCLLGTYFIFLLLIFAAEIAA
GVLVVLYKDKVKSYVGVKFQKGTEELKSKPDDTEHWMNGVQRNMKCCGYK
GSSDYTKVPGSCCSTSKCEDSYTRGCESAWTELIQNNWVIFASILLGIPL
IELLGLIFSMCLCCTARSIEYDMVETRA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000301Tetraspanin
IPR018499Tetraspanin/Peripherin
IPR008952Tetraspanin_EC2_sf
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000301TetraspaninPRINTSPR00259TMFOURcoord: 190..216
score: 32.23
coord: 77..105
score: 44.83
coord: 11..34
score: 33.07
coord: 50..76
score: 33.1
IPR000301TetraspaninPIRSFPIRSF002419Tetraspanincoord: 1..227
e-value: 1.1E-50
score: 169.7
IPR018499Tetraspanin/PeripherinPFAMPF00335Tetraspanincoord: 9..214
e-value: 4.5E-48
score: 164.0
IPR008952Tetraspanin, EC2 domain superfamilyGENE3DG3DSA:1.10.1450.10coord: 106..187
e-value: 1.5E-11
score: 45.9
IPR008952Tetraspanin, EC2 domain superfamilySUPERFAMILYSSF48652Tetraspanincoord: 107..187
NoneNo IPR availablePANTHERPTHR19282:SF163CD9 ANTIGENcoord: 4..219
NoneNo IPR availablePANTHERPTHR19282TETRASPANINcoord: 4..219
NoneNo IPR availableCDDcd03127tetraspanin_LELcoord: 106..187
e-value: 1.64527E-14
score: 64.8331
NoneNo IPR availableTMHMMTMhelixcoord: 85..107
NoneNo IPR availableTMHMMTMhelixcoord: 188..210
NoneNo IPR availableTMHMMTMhelixcoord: 13..35
NoneNo IPR availableTMHMMTMhelixcoord: 50..72