CEP97

Overview
NameCEP97 (AFB74718.1)
Smed IDSMED30022009
Length (bp)2347
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of CEP97 (SMED30022009) t-SNE clustered cells

Violin plots show distribution of expression levels for CEP97 (SMED30022009) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of CEP97 (SMED30022009) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for CEP97 (SMED30022009) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30022009

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30022009SMESG000041551.1 dd_Smed_v4_11066_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30022009SMESG000041551.1 dd_Smed_v4_11066_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30022009SMESG000041551.1 dd_Smed_v4_11066_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of CEP97 vs. Ensembl Human
Match: CEP97 (centrosomal protein 97 [Source:HGNC Symbol;Acc:HGNC:26244])

HSP 1 Score: 247.669 bits (631), Expect = 4.381e-70
Identity = 119/238 (50.00%), Postives = 166/238 (69.75%), Query Frame = 1
Query:  151 VFILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKENPCLMKSSSEMEFDYRPYIINWCIDLKILDGEEINEKEKLIAEWLYTQGKGRIYKPGDHFELVNYLTKDCAFT 864
              IL+ N+I K++ L    +L QLS++ N+++++ G++ L+ L VL+L HN I  ++G+K L  L WLNL+ N +K +E +     L+HLDLSDN I++I ++S L  LKT L+HGN ITSL     +L  S+ ILSLAEN+I DL EIS+L SL  L+QLSI  NPC+M + S   FDYRPYI++WC++L++LDG  I++KE L AEWLY+QGKGR Y+PG H +LV YL   C  T
Sbjct:   40 TLILDKNQIIKLENLEKCKRLIQLSVANNRLVRMMGVAKLTLLRVLNLPHNSIGCVEGLKELVHLEWLNLAGNNLKAMEQINSCTALQHLDLSDNNISQIGDLSKLVSLKTLLLHGNIITSLRMAPAYLPRSLAILSLAENEIRDLNEISFLASLTELEQLSIMNNPCVMATPSIPGFDYRPYIVSWCLNLRVLDGYVISQKESLKAEWLYSQGKGRAYRPGQHIQLVQYLATVCPLT 277          
BLAST of CEP97 vs. Ensembl Human
Match: CEP97 (centrosomal protein 97 [Source:HGNC Symbol;Acc:HGNC:26244])

HSP 1 Score: 247.284 bits (630), Expect = 1.285e-69
Identity = 119/238 (50.00%), Postives = 166/238 (69.75%), Query Frame = 1
Query:  151 VFILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKENPCLMKSSSEMEFDYRPYIINWCIDLKILDGEEINEKEKLIAEWLYTQGKGRIYKPGDHFELVNYLTKDCAFT 864
              IL+ N+I K++ L    +L QLS++ N+++++ G++ L+ L VL+L HN I  ++G+K L  L WLNL+ N +K +E +     L+HLDLSDN I++I ++S L  LKT L+HGN ITSL     +L  S+ ILSLAEN+I DL EIS+L SL  L+QLSI  NPC+M + S   FDYRPYI++WC++L++LDG  I++KE L AEWLY+QGKGR Y+PG H +LV YL   C  T
Sbjct:   40 TLILDKNQIIKLENLEKCKRLIQLSVANNRLVRMMGVAKLTLLRVLNLPHNSIGCVEGLKELVHLEWLNLAGNNLKAMEQINSCTALQHLDLSDNNISQIGDLSKLVSLKTLLLHGNIITSLRMAPAYLPRSLAILSLAENEIRDLNEISFLASLTELEQLSIMNNPCVMATPSIPGFDYRPYIVSWCLNLRVLDGYVISQKESLKAEWLYSQGKGRAYRPGQHIQLVQYLATVCPLT 277          
BLAST of CEP97 vs. Ensembl Human
Match: CEP97 (centrosomal protein 97 [Source:HGNC Symbol;Acc:HGNC:26244])

HSP 1 Score: 168.703 bits (426), Expect = 7.739e-48
Identity = 86/186 (46.24%), Postives = 109/186 (58.60%), Query Frame = 1
Query:  307 IISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKENPCLMKSSSEMEFDYRPYIINWCIDLKILDGEEINEKEKLIAEWLYTQGKGRIYKPGDHFELVNYLTKDCAFT 864
            I  ++G+K L  L WLNL+ N                                   LKT L+HGN ITSL     +L  S+ ILSLAEN+I DL EIS+L SL  L+QLSI  NPC+M + S   FDYRPYI++WC++L++LDG  I++KE L AEWLY+QGKGR Y+PG H +LV YL   C  T
Sbjct:    1 IGCVEGLKELVHLEWLNLAGN----------------------------------NLKTLLLHGNIITSLRMAPAYLPRSLAILSLAENEIRDLNEISFLASLTELEQLSIMNNPCVMATPSIPGFDYRPYIVSWCLNLRVLDGYVISQKESLKAEWLYSQGKGRAYRPGQHIQLVQYLATVCPLT 152          
BLAST of CEP97 vs. Ensembl Human
Match: PPP1R7 (protein phosphatase 1 regulatory subunit 7 [Source:HGNC Symbol;Acc:HGNC:9295])

HSP 1 Score: 80.4925 bits (197), Expect = 2.091e-16
Identity = 60/169 (35.50%), Postives = 93/169 (55.03%), Query Frame = 1
Query:  142 RPKVFILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKEN 648
            + K   L  N I  I+ L     L++L +  NQI +I  L  L+ L +LD+S N + +I+G+  L  L  L L NN+I  IE+L    QL+ L+L  N I  I NI  L+ L++  +  N+IT L  +D   N++  +LS+  N+   LT+I  L +L NL++L +  N
Sbjct:   40 KVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRNIEGVDKLTRLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENIDTLTNLESLFLGKNKITKLQNLDALTNLT--VLSMQSNR---LTKIEGLQNLVNLRELYLSHN 203          

HSP 2 Score: 57.3806 bits (137), Expect = 1.498e-8
Identity = 47/131 (35.88%), Postives = 71/131 (54.20%), Query Frame = 1
Query:   76 EIMTIKIDLSNLGLKEVETIND--RPKVFILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNIS 462
            EI+ I  +L    L+ +E ++   R K   L +NKI+KI+ LS   QLQ L +  N+I  I  +  L+NL  L L  NKI  +  + +L  LT L++ +NR+  IE L+  + L+ L LS N I  I  + 
Sbjct:   86 EILDISFNL----LRNIEGVDKLTRLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLSHNGIEVIEGLE 212          

HSP 3 Score: 55.8398 bits (133), Expect = 5.430e-8
Identity = 34/83 (40.96%), Postives = 53/83 (63.86%), Query Frame = 1
Query:  160 LNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQ 408
            L SN+I  I+ + T T L+ L +  N+I ++  L  L+NLTVL +  N++  I+G+++L  L  L LS+N I+ IE LE N+Q
Sbjct:  134 LGSNRIRAIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLSHNGIEVIEGLENNVQ 216          

HSP 4 Score: 51.2174 bits (121), Expect = 1.661e-6
Identity = 52/159 (32.70%), Postives = 80/159 (50.31%), Query Frame = 1
Query:  238 QIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNL----------------------ITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKEN 648
            +I +I G   L  +  L L  N I  I+ ++ L  L  L+L +N+IK IE+LE   +L+ LD+S NL                      I+KI N+S L +L+   +  NRI ++  ID   N  +E L L +N+I   T++  L +L NL  LS++ N
Sbjct:   28 RIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRNIEGVDKLTRLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENIDTLTN--LESLFLGKNKI---TKLQNLDALTNLTVLSMQSN 181          
BLAST of CEP97 vs. Ensembl Human
Match: PPP1R7 (protein phosphatase 1 regulatory subunit 7 [Source:HGNC Symbol;Acc:HGNC:9295])

HSP 1 Score: 80.4925 bits (197), Expect = 2.627e-16
Identity = 60/169 (35.50%), Postives = 93/169 (55.03%), Query Frame = 1
Query:  142 RPKVFILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKEN 648
            + K   L  N I  I+ L     L++L +  NQI +I  L  L+ L +LD+S N + +I+G+  L  L  L L NN+I  IE+L    QL+ L+L  N I  I NI  L+ L++  +  N+IT L  +D   N++  +LS+  N+   LT+I  L +L NL++L +  N
Sbjct:   56 KVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRNIEGVDKLTRLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENIDTLTNLESLFLGKNKITKLQNLDALTNLT--VLSMQSNR---LTKIEGLQNLVNLRELYLSHN 219          

HSP 2 Score: 57.7658 bits (138), Expect = 1.684e-8
Identity = 47/131 (35.88%), Postives = 71/131 (54.20%), Query Frame = 1
Query:   76 EIMTIKIDLSNLGLKEVETIND--RPKVFILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNIS 462
            EI+ I  +L    L+ +E ++   R K   L +NKI+KI+ LS   QLQ L +  N+I  I  +  L+NL  L L  NKI  +  + +L  LT L++ +NR+  IE L+  + L+ L LS N I  I  + 
Sbjct:  102 EILDISFNL----LRNIEGVDKLTRLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLSHNGIEVIEGLE 228          

HSP 3 Score: 55.8398 bits (133), Expect = 6.824e-8
Identity = 34/83 (40.96%), Postives = 53/83 (63.86%), Query Frame = 1
Query:  160 LNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQ 408
            L SN+I  I+ + T T L+ L +  N+I ++  L  L+NLTVL +  N++  I+G+++L  L  L LS+N I+ IE LE N+Q
Sbjct:  150 LGSNRIRAIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLSHNGIEVIEGLENNVQ 232          

HSP 4 Score: 51.9878 bits (123), Expect = 1.433e-6
Identity = 52/159 (32.70%), Postives = 80/159 (50.31%), Query Frame = 1
Query:  238 QIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNL----------------------ITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKEN 648
            +I +I G   L  +  L L  N I  I+ ++ L  L  L+L +N+IK IE+LE   +L+ LD+S NL                      I+KI N+S L +L+   +  NRI ++  ID   N  +E L L +N+I   T++  L +L NL  LS++ N
Sbjct:   44 RIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRNIEGVDKLTRLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENIDTLTN--LESLFLGKNKI---TKLQNLDALTNLTVLSMQSN 197          
BLAST of CEP97 vs. Ensembl Celegans
Match: K10D2.8 (pep chromosome:WBcel235:III:5188726:5190175:1 gene:WBGene00189952.1 transcript:K10D2.8.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K10D2.8)

HSP 1 Score: 81.2629 bits (199), Expect = 2.671e-16
Identity = 59/163 (36.20%), Postives = 93/163 (57.06%), Query Frame = 1
Query:  160 LNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKEN 648
            LN N+I K++ L T   L  L +S N+I +I GLS L NL  L L HNKII+I+G+++   + +L   +NRI+ +E+L   + L+ L L  N I KI  +  +++LK   + GN +  +  +D      ++ +SLA+N I    +I  L  L NLK L + +N
Sbjct:   78 LNDNQIEKLENLETLVNLVFLDVSYNRITKIEGLSELINLEELHLVHNKIITIEGLETNTAMKYLEFGDNRIQKMENLSHLVNLERLFLGANQIRKIEGLDGMAQLKELSLPGNALQIIEGLDTL--SGLKSISLAQNGIR---KIDGLSGLTNLKSLDLNDN 235          

HSP 2 Score: 75.8702 bits (185), Expect = 1.890e-14
Identity = 58/163 (35.58%), Postives = 89/163 (54.60%), Query Frame = 1
Query:  160 LNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKEN 648
            L  N + KID     T L +L+++ NQI ++  L  L NL  LD+S+N+I  I+G+  L  L  L+L +N+I  IE LE N  +K+L+  DN I K+ N+S L  L+   +  N+I  +  +D      ++ LSL  N    L  I  L +L  LK +S+ +N
Sbjct:   56 LRWNLLKKIDHFQCLTSLTRLNLNDNQIEKLENLETLVNLVFLDVSYNRITKIEGLSELINLEELHLVHNKIITIEGLETNTAMKYLEFGDNRIQKMENLSHLVNLERLFLGANQIRKIEGLDGM--AQLKELSLPGNA---LQIIEGLDTLSGLKSISLAQN 213          

HSP 3 Score: 68.1662 bits (165), Expect = 5.591e-12
Identity = 62/236 (26.27%), Postives = 107/236 (45.34%), Query Frame = 1
Query:  136 NDRPKVFILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKENPCLMKSSSEMEFDYRPYIINWCIDLKILDGEEINEKEKLIAEWLYTQGKGRIYKPGDHFELVNYL 843
            N   K      N+I K++ LS    L++L +  NQI +I GL  ++ L  L L  N +  I+G+ +L+ L  ++L+ N I+ I+ L G   LK LDL+DN+I K+ N+     + + ++  N++                            ++  L  L NL  L+++ NP  + SS   ++ YR  +     D+K+LDG  I           + QG      P + +E+ + L
Sbjct:  136 NTAMKYLEFGDNRIQKMENLSHLVNLERLFLGANQIRKIEGLDGMAQLKELSLPGNALQIIEGLDTLSGLKSISLAQNGIRKIDGLSGLTNLKSLDLNDNIIEKLENVEQFKGISSLMIRKNKLNC------------------------WQDVRQLKKLENLTVLTMEMNP--LYSS---DYTYRNRVKEILPDVKLLDGFPI----------FWVQGDPYQPIPEEFYEVFDNL 332          

HSP 4 Score: 49.6766 bits (117), Expect = 4.997e-6
Identity = 47/162 (29.01%), Postives = 87/162 (53.70%), Query Frame = 1
Query:  163 NSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKEN 648
            N + I +I   +    + +LS+  ++I +I    +   +  L L  N +  ID  + L  LT LNL++N+I+ +E+LE  + L  LD+S N ITKI  +S L  L+   +  N+I ++  ++   N +++ L   +N+I  +  +S+   L NL++L +  N
Sbjct:   13 NGDIIKEIISHNVDEDITELSLIRHRIQKIWQFENTPGIRDLSLRWNLLKKIDHFQCLTSLTRLNLNDNQIEKLENLETLVNLVFLDVSYNRITKIEGLSELINLEELHLVHNKIITIEGLE--TNTAMKYLEFGDNRIQKMENLSH---LVNLERLFLGAN 169          
BLAST of CEP97 vs. Ensembl Celegans
Match: R02F11.4 (pep chromosome:WBcel235:V:4810865:4818663:-1 gene:WBGene00019842.1 transcript:R02F11.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R02F11.4)

HSP 1 Score: 80.1073 bits (196), Expect = 2.668e-15
Identity = 63/213 (29.58%), Postives = 103/213 (48.36%), Query Frame = 1
Query:  211 LQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKENPCLMKSSSEMEFDYRPYIINWCID-LKILDGEEINEKEKLIAEWLYTQGKGRIYKPGDHFELVNYLT 846
            L +L ++ NQ+ + N L    NL +LDLS+N +I      SL  L  LNLS N +  I  L   + L+ + L+DN   KIS+++ ++K                  L    +++ L ++ N I DL++ S L +   L++  +  NP +        FDYR YI   C + L  +DG++I ++ +   EWL  QG  +   PG+H  L   + 
Sbjct:  122 LLELHLARNQLKETNQLGRFENLKILDLSNN-LIEPPVSFSLKNLEILNLSGNFLNEIPDLSKCVALQTISLADN---KISDLTTITK------------------LICPTNLKNLDISSNSIEDLSQFSVLSTFKKLEEFVVAGNPSITSVLDSDLFDYRSYIFACCSEQLHTIDGQKIEDQVQTEGEWLALQGSIKKIGPGNHDALCQQIA 312          
BLAST of CEP97 vs. Ensembl Celegans
Match: sds-22 (Protein phosphatase 1 regulatory subunit SDS22 homolog [Source:UniProtKB/Swiss-Prot;Acc:P45969])

HSP 1 Score: 76.2554 bits (186), Expect = 1.181e-14
Identity = 64/184 (34.78%), Postives = 98/184 (53.26%), Query Frame = 1
Query:   91 KIDLSNLGLKEVETINDRPKV--FILNSNKITKIDK-LSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQL 633
            +IDL++     +  +   PK+    + +N +  I   +S+   L  L +  NQ+ +I+ L  L NL  LDLS+N+I  I+G+  L  L  L L +N+I+ IE+LE   QLK L+L DN I KI NI  L  L    +  N+I  L  ++    +S  +LSL  N+I    +I  +  L NLK+L
Sbjct:   40 EIDLTHTRADHIPDLTGFPKIEELRMRNNLLVSISPTISSLVTLTSLDLYENQLTEISHLESLVNLVSLDLSYNRIRQINGLDKLTKLETLYLVSNKIEKIENLEALTQLKLLELGDNRIKKIENIGHLVNLDELFIGKNKIRQLEGVETLQKLS--VLSLPGNRI---VKIENVEQLNNLKEL 218          

HSP 2 Score: 67.3958 bits (163), Expect = 1.051e-11
Identity = 50/153 (32.68%), Postives = 81/153 (52.94%), Query Frame = 1
Query:  160 LNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLF 618
            L  N++T+I  L +   L  L +S N+I QINGL  L+ L  L L  NKI  I+ +++L  L  L L +NRIK IE++   + L  L +  N I ++  +  L KL    + GNRI  +  ++   N  ++ L L++  + D+  +  L +L 
Sbjct:   88 LYENQLTEISHLESLVNLVSLDLSYNRIRQINGLDKLTKLETLYLVSNKIEKIENLEALTQLKLLELGDNRIKKIENIGHLVNLDELFIGKNKIRQLEGVETLQKLSVLSLPGNRIVKIENVEQLNN--LKELYLSDQGLQDIHGVEPLTNLL 238          

HSP 3 Score: 58.151 bits (139), Expect = 1.070e-8
Identity = 50/158 (31.65%), Postives = 86/158 (54.43%), Query Frame = 1
Query:   25 IQNLFVLAAGISKYQRSEIMTIKIDLSNLG---LKEVETIN---DRPKVFILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLK 480
            ++ L++++  I K +  E +T ++ L  LG   +K++E I    +  ++FI   NKI +++ + T  +L  LS+ GN+I++I  +  L+NL  L LS   +  I G++ L  L  L+++NN IK    +E    L     +DN +   S I  LSKLK
Sbjct:  127 LETLYLVSNKIEKIENLEALT-QLKLLELGDNRIKKIENIGHLVNLDELFI-GKNKIRQLEGVETLQKLSVLSLPGNRIVKIENVEQLNNLKELYLSDQGLQDIHGVEPLTNLLLLDVANNEIKTFSGVERLESLNDFWANDNKVESFSEIEQLSKLK 282          
BLAST of CEP97 vs. Ensembl Celegans
Match: C06A8.6 (pep chromosome:WBcel235:II:7772499:7773914:1 gene:WBGene00015516.1 transcript:C06A8.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C06A8.6)

HSP 1 Score: 75.485 bits (184), Expect = 2.817e-14
Identity = 54/137 (39.42%), Postives = 76/137 (55.47%), Query Frame = 1
Query:  169 NKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQI 579
            N+ITK++ L +   L+ L +S N+I +I  L  L+ L  L   HNKI  I+G+ +L  L +L L +NRI  IE+L+ NL+L  L L  N I  I N+  L KL    +  N IT +  I    N+  EI  LA+N I
Sbjct:   86 NQITKVENLDSLVNLESLDLSFNRITKIENLEKLTKLKTLFFVHNKITKIEGLDTLTELEYLELGDNRIAKIENLDNNLKLDRLFLGANQIRLIENVDHLKKLTVLSLPANAITVVDNISGLHNLK-EIY-LAQNGI 220          

HSP 2 Score: 73.559 bits (179), Expect = 1.203e-13
Identity = 58/165 (35.15%), Postives = 85/165 (51.52%), Query Frame = 1
Query:  154 FILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKEN 648
            F    N I KI+ L   T L  L    NQI ++  L  L NL  LDLS N+I  I+ ++ L  L  L   +N+I  IE L+   +L++L+L DN I KI N+    KL    +  N+I  +  +D    ++  +LSL  N I  +  IS LH   NLK++ + +N
Sbjct:   59 FSFRWNLIKKIENLDCLTTLTHLEFYDNQITKVENLDSLVNLESLDLSFNRITKIENLEKLTKLKTLFFVHNKITKIEGLDTLTELEYLELGDNRIAKIENLDNNLKLDRLFLGANQIRLIENVDHLKKLT--VLSLPANAITVVDNISGLH---NLKEIYLAQN 218          

HSP 3 Score: 67.0106 bits (162), Expect = 1.588e-11
Identity = 42/116 (36.21%), Postives = 63/116 (54.31%), Query Frame = 1
Query:  160 LNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRI 507
            L  N+I KI+ L  + +L +L +  NQI  I  + HL  LTVL L  N I  +D I  L+ L  + L+ N IK +  ++ +L L+ LD + N + K+ NI  L  L  F   GN++
Sbjct:  149 LGDNRIAKIENLDNNLKLDRLFLGANQIRLIENVDHLKKLTVLSLPANAITVVDNISGLHNLKEIYLAQNGIKYVCGIDEHLPLEILDFNQNRLEKVENIHQLKTLTDFWARGNKL 264          

HSP 4 Score: 62.7734 bits (151), Expect = 3.467e-10
Identity = 53/152 (34.87%), Postives = 81/152 (53.29%), Query Frame = 1
Query:  160 LNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSL 615
            L+ N+ITKI+ L   T+L+ L    N+I +I GL  L+ L  L+L  N+I  I+ + +   L  L L  N+I+ IE+++   +L  L L  N IT + NIS L  LK   +  N I  +  ID  L   +EIL   +N++  +  I  L +L
Sbjct:  105 LSFNRITKIENLEKLTKLKTLFFVHNKITKIEGLDTLTELEYLELGDNRIAKIENLDNNLKLDRLFLGANQIRLIENVDHLKKLTVLSLPANAITVVDNISGLHNLKEIYLAQNGIKYVCGIDEHL--PLEILDFNQNRLEKVENIHQLKTL 254          

HSP 5 Score: 58.9214 bits (141), Expect = 6.513e-9
Identity = 47/156 (30.13%), Postives = 78/156 (50.00%), Query Frame = 1
Query:  112 GLKEVETINDRPKVFILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQI 579
            G+KE E I   P+           I+ +      + + ++ ++I +I   S L+++       N I  I+ +  L  LT L   +N+I  +E+L+  + L+ LDLS N ITKI N+  L+KLKT     N+IT +  +D      +E L L +N+I
Sbjct:   11 GVKEFEKIVVEPE----------DIEYVEIPADAKNVDLTRHRIKEIGDYSWLTHVEHFSFRWNLIKKIENLDCLTTLTHLEFYDNQITKVENLDSLVNLESLDLSFNRITKIENLEKLTKLKTLFFVHNKITKIEGLDTL--TELEYLELGDNRI 154          
BLAST of CEP97 vs. Ensembl Celegans
Match: slt-1 (Slit homolog 1 protein [Source:UniProtKB/Swiss-Prot;Acc:G5EFX6])

HSP 1 Score: 52.7582 bits (125), Expect = 1.174e-6
Identity = 52/161 (32.30%), Postives = 77/161 (47.83%), Query Frame = 1
Query:  217 QLSISGNQIIQI--NGLSHLSNLTVLDLSHNKIISI--DGIKSLNMLTWLNLSNNRIKNIEH--LEGNLQLKHLDLSDNLITKISNISF----------LSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKENP 651
            +L +  N+I +I  N  S L NL  L L  N+I++I      SL  L  L LS NRI+++     + NL+L HLDLS+N IT +S+             L K   F +  N I+S         +S+E+L+L  N++    E S        +QL +  NP
Sbjct:   48 RLDLQDNEITKIGPNDFSSLMNLKALQLMDNQIVTIHNQSFSSLVFLQKLRLSRNRIRHLPDNVFQNNLKLTHLDLSENDITVVSDAQLQGPEFLEVLNLDKNHIFCLENNVISSW--------VSLEVLTLNGNRLTTFEEPSNAR----FRQLDLFNNP 196          
BLAST of CEP97 vs. Ensembl Fly
Match: Cep97 (gene:FBgn0031575 transcript:FBtr0077504)

HSP 1 Score: 204.142 bits (518), Expect = 5.168e-55
Identity = 109/258 (42.25%), Postives = 165/258 (63.95%), Query Frame = 1
Query:   94 IDLSNLGLKEVETINDRPKV--FILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKENPCLMKSSSEMEFDYRPYIINWCIDLKILDGEEINEKEKLIAEWLYTQGKGRIYKPGDHFELVNYLTKDCAF 861
            ++LS   LK+V   +D   +   IL+ N++ KID + ++ +++ LS++ NQ++++ G+  L  L  L+LS N I+SI+G+K    L  LNL  N IK IEHL  N+ L+ L+L+DN I  IS++S+L  LK   +HGNR+T L + D  L  S+E L+LA+N I+DL EI  L  L NL  +SI +NPC+   +S   FDYRP+++NWC+ LK +DG  ++  E L AEWLY+QG+GR ++ G+   L  YL+  C  
Sbjct:   13 LNLSKQKLKKVPKQDDAHSIRQLILDENELQKIDNIDSYLKIETLSLARNQLLRMYGVCRLHCLRELNLSFNGILSIEGLKECIHLRVLNLEGNNIKTIEHLNTNVNLECLNLADNSIGSISDMSYLRNLKELYLHGNRLTHLRQCDKCLPTSLETLTLAKNSINDLNEICTLSHLSNLLSISIADNPCVTMINSLDGFDYRPFVLNWCMSLKYIDGFVVDPIESLKAEWLYSQGRGRQFRVGEQQGLAKYLSSVCPL 270          
BLAST of CEP97 vs. Ensembl Fly
Match: sds22 (gene:FBgn0028992 transcript:FBtr0083436)

HSP 1 Score: 82.4185 bits (202), Expect = 1.378e-16
Identity = 68/199 (34.17%), Postives = 104/199 (52.26%), Query Frame = 1
Query:   73 SEIMTIKIDLSNLGL--KEVETIND-----RPKVFILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKEN 648
             +I+TI  D   L L  + +E + +     R +   L  N I KI+ LS+   L +L +  NQI +I  L  L +L VLD+S N++  I+ +  L  L  +   +NRI  IE+L+    L  L+L DN + KI NI  L  L+   +  N+I  +  +D  +N  +EILSL  N+I    +I  L  L NL++L + EN
Sbjct:   32 EDIITIDPDCYELDLNHRRIEKLENFEPLTRIERLFLRWNLIKKIENLSSLKTLIELELYDNQITKIENLDDLPHLEVLDISFNRLTKIENLDKLVKLEKVYFVSNRITQIENLDMLTNLTMLELGDNKLKKIENIEMLVNLRQLFLGKNKIAKIENLDTLVN--LEILSLQANRI---VKIENLEKLANLRELYVSEN 225          

HSP 2 Score: 73.1738 bits (178), Expect = 1.618e-13
Identity = 54/170 (31.76%), Postives = 98/170 (57.65%), Query Frame = 1
Query:   88 IKIDLSNLGLKEVETINDRPKVFILN--SNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLT 591
            I+++L +  + ++E ++D P + +L+   N++TKI+ L    +L+++    N+I QI  L  L+NLT+L+L  NK+  I+ I+ L  L  L L  N+I  IE+L+  + L+ L L  N I KI N+  L+ L+   +  N + ++   +L  N  +E L LA+N++  + 
Sbjct:   86 IELELYDNQITKIENLDDLPHLEVLDISFNRLTKIENLDKLVKLEKVYFVSNRITQIENLDMLTNLTMLELGDNKLKKIENIEMLVNLRQLFLGKNKIAKIENLDTLVNLEILSLQANRIVKIENLEKLANLRELYVSENGVETIE--NLSENTKLETLDLAKNRLKGIA 253          

HSP 3 Score: 58.9214 bits (141), Expect = 6.458e-9
Identity = 36/99 (36.36%), Postives = 58/99 (58.59%), Query Frame = 1
Query:  160 LNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISN 456
            L  NK+ KI+ +     L+QL +  N+I +I  L  L NL +L L  N+I+ I+ ++ L  L  L +S N ++ IE+L  N +L+ LDL+ N +  I+N
Sbjct:  156 LGDNKLKKIENIEMLVNLRQLFLGKNKIAKIENLDTLVNLEILSLQANRIVKIENLEKLANLRELYVSENGVETIENLSENTKLETLDLAKNRLKGIAN 254          
BLAST of CEP97 vs. Ensembl Fly
Match: CG4168 (gene:FBgn0028888 transcript:FBtr0305559)

HSP 1 Score: 58.9214 bits (141), Expect = 1.789e-8
Identity = 47/161 (29.19%), Postives = 89/161 (55.28%), Query Frame = 1
Query:  187 DKLSTHTQLQQLSISGNQIIQINGLSHLSN-LTVLDLSHNKIISID--GIKSLNMLTWLNLSNNRIKNIEH--LEGNLQLKHLDLSDNLI--TKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKEN 648
            D+LS++  + QL IS N + + +  ++L+N L  L+L+HN++ S+       L  L  LN+++N + ++     +G   L+ LDLS N +   ++   S L KL+   ++ NR+ +L R ++F+N  +E L +AENQ+      ++    F L+ + +  N
Sbjct:  754 DELSSYMYIYQLDISHNHVTKSDSFTNLANTLRFLNLAHNQLGSLQSHAFGDLEFLEILNVAHNNLTSLRRRSFQGLNSLQELDLSHNQLDQLQVEQFSNLRKLRILRINSNRLRALPR-EVFMNTRLEFLDIAENQLSVWPVPAFTDIGFTLRSIQMSHN 913          
BLAST of CEP97 vs. Ensembl Fly
Match: CG4168 (gene:FBgn0028888 transcript:FBtr0343105)

HSP 1 Score: 58.9214 bits (141), Expect = 1.789e-8
Identity = 47/161 (29.19%), Postives = 89/161 (55.28%), Query Frame = 1
Query:  187 DKLSTHTQLQQLSISGNQIIQINGLSHLSN-LTVLDLSHNKIISID--GIKSLNMLTWLNLSNNRIKNIEH--LEGNLQLKHLDLSDNLI--TKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKEN 648
            D+LS++  + QL IS N + + +  ++L+N L  L+L+HN++ S+       L  L  LN+++N + ++     +G   L+ LDLS N +   ++   S L KL+   ++ NR+ +L R ++F+N  +E L +AENQ+      ++    F L+ + +  N
Sbjct:  754 DELSSYMYIYQLDISHNHVTKSDSFTNLANTLRFLNLAHNQLGSLQSHAFGDLEFLEILNVAHNNLTSLRRRSFQGLNSLQELDLSHNQLDQLQVEQFSNLRKLRILRINSNRLRALPR-EVFMNTRLEFLDIAENQLSVWPVPAFTDIGFTLRSIQMSHN 913          
BLAST of CEP97 vs. Ensembl Fly
Match: TbCMF46 (gene:FBgn0032163 transcript:FBtr0079898)

HSP 1 Score: 56.9954 bits (136), Expect = 5.034e-8
Identity = 46/125 (36.80%), Postives = 68/125 (54.40%), Query Frame = 1
Query:  277 LTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKENP 651
            +T + L    I+ ID +  +  LT L L+ N+I+ IEHLE    LK L+LS N IT+I N+  L KL+   +  NRI  +  I    N+   ILS+  N I  +  I  L  + +LK L+++ NP
Sbjct:   69 ITTMRLEFKNILRIDHLWMMPNLTKLCLNCNKIEVIEHLEMLTALKDLNLSFNYITRIENLEKLVKLEKLSLFSNRIRKIENIHTLQNLV--ILSIGNNLIDTVEGIERLRFVSSLKVLNLEGNP 191          

HSP 2 Score: 50.8322 bits (120), Expect = 4.694e-6
Identity = 43/130 (33.08%), Postives = 64/130 (49.23%), Query Frame = 1
Query:  130 TINDRPKVFILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNIS---FLSKLKTFLMHGNRIT 510
             + DR     L    I +ID L     L +L ++ N+I  I  L  L+ L  L+LS N I  I+ ++ L  L  L+L +NRI+ IE++     L  L + +NLI  +  I    F+S LK   + GN I 
Sbjct:   64 VVYDRITTMRLEFKNILRIDHLWMMPNLTKLCLNCNKIEVIEHLEMLTALKDLNLSFNYITRIENLEKLVKLEKLSLFSNRIRKIENIHTLQNLVILSIGNNLIDTVEGIERLRFVSSLKVLNLEGNPIA 193          
BLAST of CEP97 vs. Ensembl Zebrafish
Match: cep97 (centrosomal protein 97 [Source:ZFIN;Acc:ZDB-GENE-031030-11])

HSP 1 Score: 236.113 bits (601), Expect = 9.858e-68
Identity = 115/261 (44.06%), Postives = 174/261 (66.67%), Query Frame = 1
Query:   94 IDLSNLGLKEVETINDRP----KVFILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKENPCLMKSSSEMEFDYRPYIINWCIDLKILDGEEINEKEKLIAEWLYTQGKGRIYKPGDHFELVNYLTKDCAFT 864
            +DLS  GL+ +E    RP       IL+ N++ K++ L  +  LQQLS++ N+++++  +  L+ L VLDL +N I  I+G+K L  L  LNL+ N IK +E L   + L+HLDLSDN I++I ++S LS L+T L+HGN IT+L      L   + +LSLAEN+I DLTE+ YL  +  L+QLS+  NPC+   SS +  DYRPY+++WC+ L++LDG  + +KE L AEWLY+QG+GR+++PG+H +L+ YL++ C   
Sbjct:   17 LDLSARGLQRLEPQLFRPDSHTHTLILDQNQLMKLEHLEHNPDLQQLSVACNRLVRMMNVCRLTQLRVLDLQNNSIGCIEGLKELQQLERLNLAGNNIKVMEQLHHCVSLQHLDLSDNNISQIGDVSRLSALQTLLLHGNIITTLRSAPAHLPAHLRVLSLAENEIRDLTEVCYLAPVRGLQQLSLLSNPCVSCVSSAV-CDYRPYVLSWCLGLELLDGVAVTQKEGLKAEWLYSQGRGRVFRPGEHTQLLQYLSRTCPAA 276          
BLAST of CEP97 vs. Ensembl Zebrafish
Match: cep97 (centrosomal protein 97 [Source:ZFIN;Acc:ZDB-GENE-031030-11])

HSP 1 Score: 184.882 bits (468), Expect = 6.323e-53
Identity = 101/235 (42.98%), Postives = 148/235 (62.98%), Query Frame = 1
Query:   94 IDLSNLGLKEVETINDRP----KVFILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKENPCLMKSSSEMEFDYRPYIINWCIDLKILDGEEINEKEKLIAEWLYT 786
            +DLS  GL+ +E    RP       IL+ N++ K++ L  +  LQQLS++ N+++++  +  L+ L VLDL +N I  I+G+K L  L  LNL+ N IK            HLDLSDN I++I ++S LS L+T L+HGN IT+L      L   + +LSLAEN+I DLTE+ YL  +  L+QLS+  NPC+   SS +  DYRPY+++WC+ L++LDG  + +KE L AEWLY+
Sbjct:   19 LDLSARGLQRLEPQLFRPDSHTHTLILDQNQLMKLEHLEHNPDLQQLSVACNRLVRMMNVCRLTQLRVLDLQNNSIGCIEGLKELQQLERLNLAGNNIK------------HLDLSDNNISQIGDVSRLSALQTLLLHGNIITTLRSAPAHLPAHLRVLSLAENEIRDLTEVCYLAPVRGLQQLSLLSNPCVSCVSSAV-CDYRPYVLSWCLGLELLDGVAVTQKEGLKAEWLYS 240          
BLAST of CEP97 vs. Ensembl Zebrafish
Match: ppp1r7 (protein phosphatase 1, regulatory (inhibitor) subunit 7 [Source:NCBI gene;Acc:560323])

HSP 1 Score: 70.4774 bits (171), Expect = 2.007e-12
Identity = 54/142 (38.03%), Postives = 83/142 (58.45%), Query Frame = 1
Query:  160 LNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNI-SIEILSLAENQIH 582
            L SN+I  I+ L + + L+ L +  N+I Q+  L  L NLTVL +  N+I  ++G+++L  L  L LS+N I+ +E LE N +L  LD++ N I KI NIS L+ LK F M+ N+I +   +D   N   +E + L  N + 
Sbjct:  178 LGSNRIRVIENLDSLSSLESLFLGTNKITQLQNLDGLHNLTVLSIQSNRITKLEGLQNLVNLRELYLSHNGIEVMEGLENNKKLSTLDIAANRIKKIENISHLTDLKEFWMNDNQIENWADLDELKNAKGLETVYLERNPLQ 319          

HSP 2 Score: 62.003 bits (149), Expect = 9.409e-10
Identity = 58/172 (33.72%), Postives = 86/172 (50.00%), Query Frame = 1
Query:  160 LNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNI--------SIEI------------LSLAENQIHDLTEISYLHSL 615
            L  N+I K++ L   T+L+QL +S N + +I GL  L+ +  L L HNKI SI  +  L  L  L L +NRI+ IE+L+    L+ L L  N IT++ N+  L  L    +  NRIT L  +   +N+         IE+            L +A N+I  +  IS+L  L
Sbjct:  112 LYDNQIRKLENLQALTELEQLDVSFNLLRKIEGLDSLTKVKKLFLLHNKIASIANLDHLTSLQMLELGSNRIRVIENLDSLSSLESLFLGTNKITQLQNLDGLHNLTVLSIQSNRITKLEGLQNLVNLRELYLSHNGIEVMEGLENNKKLSTLDIAANRIKKIENISHLTDL 283          

HSP 3 Score: 62.003 bits (149), Expect = 9.751e-10
Identity = 55/169 (32.54%), Postives = 94/169 (55.62%), Query Frame = 1
Query:  142 RPKVFILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKEN 648
            + K   L  N I +I+ L +   L++L +  NQI ++  L  L+ L  LD+S N +  I+G+ SL  +  L L +N+I +I +L+    L+ L+L  N I  I N+  LS L++  +  N+IT L  +D   N++  +LS+  N+I   T++  L +L NL++L +  N
Sbjct:   84 KAKTISLRQNLIKRIENLESLVSLRELDLYDNQIRKLENLQALTELEQLDVSFNLLRKIEGLDSLTKVKKLFLLHNKIASIANLDHLTSLQMLELGSNRIRVIENLDSLSSLESLFLGTNKITQLQNLDGLHNLT--VLSIQSNRI---TKLEGLQNLVNLRELYLSHN 247          

HSP 4 Score: 56.6102 bits (135), Expect = 6.137e-8
Identity = 47/156 (30.13%), Postives = 79/156 (50.64%), Query Frame = 1
Query:  238 QIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIH-------------------DLTEISYLHSLFNLKQLSIKEN 648
            +I +I GL  L     + L  N I  I+ ++SL  L  L+L +N+I+ +E+L+   +L+ LD+S NL+ KI  +  L+K+K   +  N+I S+  +D     S+++L L  N+I                     +T++  L  L NL  LSI+ N
Sbjct:   72 RIGKIEGLEVLLKAKTISLRQNLIKRIENLESLVSLRELDLYDNQIRKLENLQALTELEQLDVSFNLLRKIEGLDSLTKVKKLFLLHNKIASIANLDHL--TSLQMLELGSNRIRVIENLDSLSSLESLFLGTNKITQLQNLDGLHNLTVLSIQSN 225          
BLAST of CEP97 vs. Ensembl Zebrafish
Match: drc3 (dynein regulatory complex subunit 3 [Source:ZFIN;Acc:ZDB-GENE-061103-349])

HSP 1 Score: 71.2478 bits (173), Expect = 2.437e-12
Identity = 56/174 (32.18%), Postives = 94/174 (54.02%), Query Frame = 1
Query:  160 LNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSK---LKTFLMHGNRITSLYRIDLFLNISIEIL-----SLAENQIHDLTEISYLHSLFNLKQLSIKENPCL 657
            L+   I KI  L + + L +L +  N I +I GL +L+NLT LDLS NKI  I+G+++L  L  L+L NNRI  IE+L+   +L+ L L +N I ++ N+ +L +   L+T  + GN I    R   F++  +  L      L + Q  +     Y +++  ++Q  ++E   +
Sbjct:   41 LDYRNILKIYHLWSFSSLTKLQLDNNAIERIEGLENLTNLTWLDLSFNKIEVIEGLQTLVKLQDLSLFNNRISVIENLDTLQRLQVLSLGNNSIAQLENVIYLRRFQSLRTLNLAGNPICEEDRYKTFVSAYLPELVYLDYRLLDEQTRETANAKYQYAIEEMRQNEMQEQQAM 214          

HSP 2 Score: 60.4622 bits (145), Expect = 4.816e-9
Identity = 53/189 (28.04%), Postives = 91/189 (48.15%), Query Frame = 1
Query:  217 QLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKENPCLMKSSSEMEFDYRPYIINWCIDLKILDGEEINEKEKLIAEWLY 783
            +L +    I++I  L   S+LT L L +N I  I+G+++L  LTWL+LS N+I+ IE L+  ++L+ L L +N I+ I N+  L +L+                        +LSL  N I  L  + YL    +L+ L++  NP   +        Y+ ++  +  +L  LD   ++E+ +  A   Y
Sbjct:   38 ELRLDYRNILKIYHLWSFSSLTKLQLDNNAIERIEGLENLTNLTWLDLSFNKIEVIEGLQTLVKLQDLSLFNNRISVIENLDTLQRLQ------------------------VLSLGNNSIAQLENVIYLRRFQSLRTLNLAGNPICEEDR------YKTFVSAYLPELVYLDYRLLDEQTRETANAKY 196          
BLAST of CEP97 vs. Ensembl Zebrafish
Match: ppp1r42 (protein phosphatase 1, regulatory subunit 42 [Source:NCBI gene;Acc:431749])

HSP 1 Score: 66.2402 bits (160), Expect = 4.064e-11
Identity = 70/202 (34.65%), Postives = 96/202 (47.52%), Query Frame = 1
Query:  175 ITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDL-------SDNLITKISNISFLSKLKTFL-MHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHS-LFNLKQLSIKENPCLMKSSSEMEFDYRPYIINWCIDLKILDGEEINE 753
            I +ID LS    L  L +  NQI QI  L   SNLT L + +N I  I+ + SL+ L+ L L  N I  +E LE    LK L +        + L     +IS LS+    L +  N I  L+  DL     +  L  A+NQ+HD+ E+  + S  F L+ L +  NP   K        YR  +I  C  L  LDG++INE
Sbjct:   41 IEEIDDLSVCRNLTVLYLYDNQISQICNLGFASNLTHLYMQNNNISCIENLSSLHKLSKLFLGGNSITVVEGLEELKSLKELHVEGQKLPCGEKLAFDPHSISSLSETLCILNISKNNIDELW--DLAPLRKMTHLFAADNQLHDIQELETVFSQWFKLRLLDLSRNPVCHKPK------YRDRLITVCKFLDDLDGKQINE 234          
BLAST of CEP97 vs. Ensembl Xenopus
Match: CEP97 (centrosomal protein 97kDa [Source:NCBI gene;Acc:779623])

HSP 1 Score: 221.09 bits (562), Expect = 1.140e-60
Identity = 117/260 (45.00%), Postives = 172/260 (66.15%), Query Frame = 1
Query:   94 IDLSNLGLKEVET---INDRPKVFILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKENPCLMKSSSEMEFDYRPYIINWCIDLKILDGEEINEKEKLIAEWLYTQGKGRIYKPGDHFELVNYLTKDCAFT 864
            +DLS  GL+++       +  +  IL+ N+I K++ +     L QLS++ N+++++ G++ L +L VL+L HN I  ++G+K L  L WLNL+ N +K I+ +     L+HLDLSDN I++I ++S L  LKT L+HGN I SL      L  S+ ILSLAEN+I DL E+++L  L +L+QLSI  NPC+M + S   FDYRP+I++WC++LK+LDG  +++KE L AEWLY+QGKGR Y+ G H  LV YL   C  T
Sbjct:   18 VDLSGQGLQKLSPTLPFGNDTQTLILDKNQIIKLEHMEKCRNLVQLSVANNRLVRMMGVAKLIHLRVLNLPHNSIGYVEGLKDLVNLEWLNLAGNNLKIIDQINSCTSLQHLDLSDNNISQIGDLSKLKSLKTLLLHGNNIASLRAASACLPQSLTILSLAENEIRDLNEVAFLAGLADLEQLSIMNNPCVMATPSIPGFDYRPFIVSWCLNLKVLDGYVVSQKESLKAEWLYSQGKGRSYRLGQHIPLVQYLATVCPLT 277          

HSP 2 Score: 52.373 bits (124), Expect = 3.331e-6
Identity = 29/99 (29.29%), Postives = 53/99 (53.54%), Query Frame = 1
Query: 1411 NSEQSKI------KLNKIINSVIRIQAWWRSISTRLKNPIVRRYLSGREANRTRSHILFLQKQMQLYYESYEQQRKLNISQNQAIQFLLDQVKELTIWK 1689
            NS+QS +       LNKI  +  +IQ+ WR    R  NP V+        +R + HI+FL +++    +  E++R   + Q +A+++L +QV+ +  W+
Sbjct:  504 NSKQSSVLDQDASHLNKINTAATKIQSCWRGFYARKYNPKVKDVCYEIRLSRMQEHIVFLTEEVIRLKKEKEEERIQRLVQGEAVRYLWEQVQAIQQWQ 602          
BLAST of CEP97 vs. Ensembl Xenopus
Match: CEP97 (centrosomal protein 97kDa [Source:NCBI gene;Acc:779623])

HSP 1 Score: 220.705 bits (561), Expect = 1.192e-60
Identity = 117/260 (45.00%), Postives = 172/260 (66.15%), Query Frame = 1
Query:   94 IDLSNLGLKEVET---INDRPKVFILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKENPCLMKSSSEMEFDYRPYIINWCIDLKILDGEEINEKEKLIAEWLYTQGKGRIYKPGDHFELVNYLTKDCAFT 864
            +DLS  GL+++       +  +  IL+ N+I K++ +     L QLS++ N+++++ G++ L +L VL+L HN I  ++G+K L  L WLNL+ N +K I+ +     L+HLDLSDN I++I ++S L  LKT L+HGN I SL      L  S+ ILSLAEN+I DL E+++L  L +L+QLSI  NPC+M + S   FDYRP+I++WC++LK+LDG  +++KE L AEWLY+QGKGR Y+ G H  LV YL   C  T
Sbjct:    2 VDLSGQGLQKLSPTLPFGNDTQTLILDKNQIIKLEHMEKCRNLVQLSVANNRLVRMMGVAKLIHLRVLNLPHNSIGYVEGLKDLVNLEWLNLAGNNLKIIDQINSCTSLQHLDLSDNNISQIGDLSKLKSLKTLLLHGNNIASLRAASACLPQSLTILSLAENEIRDLNEVAFLAGLADLEQLSIMNNPCVMATPSIPGFDYRPFIVSWCLNLKVLDGYVVSQKESLKAEWLYSQGKGRSYRLGQHIPLVQYLATVCPLT 261          
BLAST of CEP97 vs. Ensembl Xenopus
Match: CEP97 (centrosomal protein 97kDa [Source:NCBI gene;Acc:779623])

HSP 1 Score: 221.09 bits (562), Expect = 1.249e-60
Identity = 119/261 (45.59%), Postives = 173/261 (66.28%), Query Frame = 1
Query:   94 IDLSNLGLKEVETI----NDRPKVFILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKENPCLMKSSSEMEFDYRPYIINWCIDLKILDGEEINEKEKLIAEWLYTQGKGRIYKPGDHFELVNYLTKDCAFT 864
            +DLS  GL+++       ND  +  IL+ N+I K++ +     L QLS++ N+++++ G++ L +L VL+L HN I  ++G+K L  L WLNL+ N +K I+ +     L+HLDLSDN I++I ++S L  LKT L+HGN I SL      L  S+ ILSLAEN+I DL E+++L  L +L+QLSI  NPC+M + S   FDYRP+I++WC++LK+LDG  +++KE L AEWLY+QGKGR Y+ G H  LV YL   C  T
Sbjct:   11 VDLSGQGLQKLSPTLPFGNDT-QTLILDKNQIIKLEHMEKCRNLVQLSVANNRLVRMMGVAKLIHLRVLNLPHNSIGYVEGLKDLVNLEWLNLAGNNLKIIDQINSCTSLQHLDLSDNNISQIGDLSKLKSLKTLLLHGNNIASLRAASACLPQSLTILSLAENEIRDLNEVAFLAGLADLEQLSIMNNPCVMATPSIPGFDYRPFIVSWCLNLKVLDGYVVSQKESLKAEWLYSQGKGRSYRLGQHIPLVQYLATVCPLT 270          

HSP 2 Score: 52.373 bits (124), Expect = 3.408e-6
Identity = 29/99 (29.29%), Postives = 53/99 (53.54%), Query Frame = 1
Query: 1411 NSEQSKI------KLNKIINSVIRIQAWWRSISTRLKNPIVRRYLSGREANRTRSHILFLQKQMQLYYESYEQQRKLNISQNQAIQFLLDQVKELTIWK 1689
            NS+QS +       LNKI  +  +IQ+ WR    R  NP V+        +R + HI+FL +++    +  E++R   + Q +A+++L +QV+ +  W+
Sbjct:  497 NSKQSSVLDQDASHLNKINTAATKIQSCWRGFYARKYNPKVKDVCYEIRLSRMQEHIVFLTEEVIRLKKEKEEERIQRLVQGEAVRYLWEQVQAIQQWQ 595          
BLAST of CEP97 vs. Ensembl Xenopus
Match: CEP97 (centrosomal protein 97kDa [Source:NCBI gene;Acc:779623])

HSP 1 Score: 221.09 bits (562), Expect = 1.261e-60
Identity = 119/261 (45.59%), Postives = 173/261 (66.28%), Query Frame = 1
Query:   94 IDLSNLGLKEVETI----NDRPKVFILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKENPCLMKSSSEMEFDYRPYIINWCIDLKILDGEEINEKEKLIAEWLYTQGKGRIYKPGDHFELVNYLTKDCAFT 864
            +DLS  GL+++       ND  +  IL+ N+I K++ +     L QLS++ N+++++ G++ L +L VL+L HN I  ++G+K L  L WLNL+ N +K I+ +     L+HLDLSDN I++I ++S L  LKT L+HGN I SL      L  S+ ILSLAEN+I DL E+++L  L +L+QLSI  NPC+M + S   FDYRP+I++WC++LK+LDG  +++KE L AEWLY+QGKGR Y+ G H  LV YL   C  T
Sbjct:   15 VDLSGQGLQKLSPTLPFGNDT-QTLILDKNQIIKLEHMEKCRNLVQLSVANNRLVRMMGVAKLIHLRVLNLPHNSIGYVEGLKDLVNLEWLNLAGNNLKIIDQINSCTSLQHLDLSDNNISQIGDLSKLKSLKTLLLHGNNIASLRAASACLPQSLTILSLAENEIRDLNEVAFLAGLADLEQLSIMNNPCVMATPSIPGFDYRPFIVSWCLNLKVLDGYVVSQKESLKAEWLYSQGKGRSYRLGQHIPLVQYLATVCPLT 274          

HSP 2 Score: 52.373 bits (124), Expect = 3.443e-6
Identity = 29/99 (29.29%), Postives = 53/99 (53.54%), Query Frame = 1
Query: 1411 NSEQSKI------KLNKIINSVIRIQAWWRSISTRLKNPIVRRYLSGREANRTRSHILFLQKQMQLYYESYEQQRKLNISQNQAIQFLLDQVKELTIWK 1689
            NS+QS +       LNKI  +  +IQ+ WR    R  NP V+        +R + HI+FL +++    +  E++R   + Q +A+++L +QV+ +  W+
Sbjct:  501 NSKQSSVLDQDASHLNKINTAATKIQSCWRGFYARKYNPKVKDVCYEIRLSRMQEHIVFLTEEVIRLKKEKEEERIQRLVQGEAVRYLWEQVQAIQQWQ 599          
BLAST of CEP97 vs. Ensembl Xenopus
Match: rbpms2 (RNA binding protein with multiple splicing 2 [Source:Xenbase;Acc:XB-GENE-490341])

HSP 1 Score: 80.1073 bits (196), Expect = 8.168e-15
Identity = 68/211 (32.23%), Postives = 112/211 (53.08%), Query Frame = 1
Query:  148 KVFILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKENPCLMKSSSEMEFDYRPYIINWCIDLKILDGEEINEKEKLIAEWL 780
            ++  L+ N IT+I  LS+   L  L +  N I +I+GLS L +L VL L  N+I  I  +++L  L  L+L  N+I  IE++    +L+ L+L+ N I ++ NI+ L  LK   +  N+IT L  +D     S+++L L+ N I  + +I  L    +L  +++  NP   +S       YR  I+   + L+ LD + I E+E+  A  L
Sbjct:  191 RLLYLHHNSITRIQNLSSLQHLIFLDLYDNNIEEISGLSSLRSLRVLMLGKNRIQKISNLENLKNLDVLDLHGNQIAKIENVSHLRELRVLNLARNQINQVENINGLDSLKELNLRDNKITFLRDVDTL--PSLQLLYLSFNNISRINDILCLADSTSLSDVTLDGNPIAQESW------YRQTILGHMLQLRQLDMKRITEEERRTASVL 393          
BLAST of CEP97 vs. Ensembl Mouse
Match: Cep97 (centrosomal protein 97 [Source:MGI Symbol;Acc:MGI:1921451])

HSP 1 Score: 245.358 bits (625), Expect = 3.768e-69
Identity = 118/238 (49.58%), Postives = 165/238 (69.33%), Query Frame = 1
Query:  151 VFILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKENPCLMKSSSEMEFDYRPYIINWCIDLKILDGEEINEKEKLIAEWLYTQGKGRIYKPGDHFELVNYLTKDCAFT 864
              IL+ N+I K++ L    QL QLS++ N+++++ G++ L+ L VL+L HN I  ++G+K L  L WLNL+ N +K +E +     L+HLDLSDN I +I ++S L  LKT L+HGN ITSL     +L  ++ ILSLAEN+I DL EIS+L SL  L+QLSI  NPC+M + S   FDYRP+I++WC++L++LDG  I++KE L AEWLY+QGKGR Y+PG H +LV YL   C  T
Sbjct:   40 TLILDKNQIIKLENLEKCKQLIQLSVANNRLVRMMGVAKLTQLRVLNLPHNSIGCVEGLKDLVHLEWLNLAGNNLKTMEQVNSCTALQHLDLSDNNIPQIGDVSKLISLKTLLLHGNIITSLRMAPAYLPRNLSILSLAENEIRDLNEISFLASLSELEQLSIMNNPCVMATPSIPGFDYRPFIVSWCLNLRVLDGYVISQKESLKAEWLYSQGKGRSYRPGQHIQLVQYLATVCPLT 277          
BLAST of CEP97 vs. Ensembl Mouse
Match: Cep97 (centrosomal protein 97 [Source:MGI Symbol;Acc:MGI:1921451])

HSP 1 Score: 223.787 bits (569), Expect = 6.489e-62
Identity = 106/203 (52.22%), Postives = 142/203 (69.95%), Query Frame = 1
Query:  256 GLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKENPCLMKSSSEMEFDYRPYIINWCIDLKILDGEEINEKEKLIAEWLYTQGKGRIYKPGDHFELVNYLTKDCAFT 864
            G++ L+ L VL+L HN I  ++G+K L  L WLNL+ N +K +E +     L+HLDLSDN I +I ++S L  LKT L+HGN ITSL     +L  ++ ILSLAEN+I DL EIS+L SL  L+QLSI  NPC+M + S   FDYRP+I++WC++L++LDG  I++KE L AEWLY+QGKGR Y+PG H +LV YL   C  T
Sbjct:    3 GVAKLTQLRVLNLPHNSIGCVEGLKDLVHLEWLNLAGNNLKTMEQVNSCTALQHLDLSDNNIPQIGDVSKLISLKTLLLHGNIITSLRMAPAYLPRNLSILSLAENEIRDLNEISFLASLSELEQLSIMNNPCVMATPSIPGFDYRPFIVSWCLNLRVLDGYVISQKESLKAEWLYSQGKGRSYRPGQHIQLVQYLATVCPLT 205          
BLAST of CEP97 vs. Ensembl Mouse
Match: Cep97 (centrosomal protein 97 [Source:MGI Symbol;Acc:MGI:1921451])

HSP 1 Score: 223.787 bits (569), Expect = 6.489e-62
Identity = 106/203 (52.22%), Postives = 142/203 (69.95%), Query Frame = 1
Query:  256 GLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKENPCLMKSSSEMEFDYRPYIINWCIDLKILDGEEINEKEKLIAEWLYTQGKGRIYKPGDHFELVNYLTKDCAFT 864
            G++ L+ L VL+L HN I  ++G+K L  L WLNL+ N +K +E +     L+HLDLSDN I +I ++S L  LKT L+HGN ITSL     +L  ++ ILSLAEN+I DL EIS+L SL  L+QLSI  NPC+M + S   FDYRP+I++WC++L++LDG  I++KE L AEWLY+QGKGR Y+PG H +LV YL   C  T
Sbjct:    3 GVAKLTQLRVLNLPHNSIGCVEGLKDLVHLEWLNLAGNNLKTMEQVNSCTALQHLDLSDNNIPQIGDVSKLISLKTLLLHGNIITSLRMAPAYLPRNLSILSLAENEIRDLNEISFLASLSELEQLSIMNNPCVMATPSIPGFDYRPFIVSWCLNLRVLDGYVISQKESLKAEWLYSQGKGRSYRPGQHIQLVQYLATVCPLT 205          
BLAST of CEP97 vs. Ensembl Mouse
Match: Cep97 (centrosomal protein 97 [Source:MGI Symbol;Acc:MGI:1921451])

HSP 1 Score: 86.2705 bits (212), Expect = 3.350e-19
Identity = 46/109 (42.20%), Postives = 72/109 (66.06%), Query Frame = 1
Query:  154 FILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLK 480
             IL+ N+I K++ L    QL QLS++ N+++++ G++ L+ L VL+L HN I  ++G+K L  L WLNL+ N +K +E +     L+HLDLSDN I +I ++S L  LK
Sbjct:   41 LILDKNQIIKLENLEKCKQLIQLSVANNRLVRMMGVAKLTQLRVLNLPHNSIGCVEGLKDLVHLEWLNLAGNNLKTMEQVNSCTALQHLDLSDNNIPQIGDVSKLISLK 149          
BLAST of CEP97 vs. Ensembl Mouse
Match: Cep97 (centrosomal protein 97 [Source:MGI Symbol;Acc:MGI:1921451])

HSP 1 Score: 86.2705 bits (212), Expect = 3.665e-19
Identity = 46/110 (41.82%), Postives = 72/110 (65.45%), Query Frame = 1
Query:  154 FILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKT 483
             IL+ N+I K++ L    QL QLS++ N+++++ G++ L+ L VL+L HN I  ++G+K L  L WLNL+ N +K +E +     L+HLDLSDN I +I ++S L  LK 
Sbjct:   41 LILDKNQIIKLENLEKCKQLIQLSVANNRLVRMMGVAKLTQLRVLNLPHNSIGCVEGLKDLVHLEWLNLAGNNLKTMEQVNSCTALQHLDLSDNNIPQIGDVSKLISLKV 150          
BLAST of CEP97 vs. UniProt/SwissProt
Match: sp|Q9CZ62|CEP97_MOUSE (Centrosomal protein of 97 kDa OS=Mus musculus OX=10090 GN=Cep97 PE=1 SV=1)

HSP 1 Score: 245.358 bits (625), Expect = 2.635e-68
Identity = 118/238 (49.58%), Postives = 165/238 (69.33%), Query Frame = 1
Query:  151 VFILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKENPCLMKSSSEMEFDYRPYIINWCIDLKILDGEEINEKEKLIAEWLYTQGKGRIYKPGDHFELVNYLTKDCAFT 864
              IL+ N+I K++ L    QL QLS++ N+++++ G++ L+ L VL+L HN I  ++G+K L  L WLNL+ N +K +E +     L+HLDLSDN I +I ++S L  LKT L+HGN ITSL     +L  ++ ILSLAEN+I DL EIS+L SL  L+QLSI  NPC+M + S   FDYRP+I++WC++L++LDG  I++KE L AEWLY+QGKGR Y+PG H +LV YL   C  T
Sbjct:   40 TLILDKNQIIKLENLEKCKQLIQLSVANNRLVRMMGVAKLTQLRVLNLPHNSIGCVEGLKDLVHLEWLNLAGNNLKTMEQVNSCTALQHLDLSDNNIPQIGDVSKLISLKTLLLHGNIITSLRMAPAYLPRNLSILSLAENEIRDLNEISFLASLSELEQLSIMNNPCVMATPSIPGFDYRPFIVSWCLNLRVLDGYVISQKESLKAEWLYSQGKGRSYRPGQHIQLVQYLATVCPLT 277          
BLAST of CEP97 vs. UniProt/SwissProt
Match: sp|Q8IW35|CEP97_HUMAN (Centrosomal protein of 97 kDa OS=Homo sapiens OX=9606 GN=CEP97 PE=1 SV=1)

HSP 1 Score: 244.973 bits (624), Expect = 3.723e-68
Identity = 119/238 (50.00%), Postives = 166/238 (69.75%), Query Frame = 1
Query:  151 VFILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKENPCLMKSSSEMEFDYRPYIINWCIDLKILDGEEINEKEKLIAEWLYTQGKGRIYKPGDHFELVNYLTKDCAFT 864
              IL+ N+I K++ L    +L QLS++ N+++++ G++ L+ L VL+L HN I  ++G+K L  L WLNL+ N +K +E +     L+HLDLSDN I++I ++S L  LKT L+HGN ITSL     +L  S+ ILSLAEN+I DL EIS+L SL  L+QLSI  NPC+M + S   FDYRPYI++WC++L++LDG  I++KE L AEWLY+QGKGR Y+PG H +LV YL   C  T
Sbjct:   40 TLILDKNQIIKLENLEKCKRLIQLSVANNRLVRMMGVAKLTLLRVLNLPHNSIGCVEGLKELVHLEWLNLAGNNLKAMEQINSCTALQHLDLSDNNISQIGDLSKLVSLKTLLLHGNIITSLRMAPAYLPRSLAILSLAENEIRDLNEISFLASLTELEQLSIMNNPCVMATPSIPGFDYRPYIVSWCLNLRVLDGYVISQKESLKAEWLYSQGKGRAYRPGQHIQLVQYLATVCPLT 277          
BLAST of CEP97 vs. UniProt/SwissProt
Match: sp|Q6GPJ8|CEP97_XENLA (Centrosomal protein of 97 kDa OS=Xenopus laevis OX=8355 GN=cep97 PE=2 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 9.142e-60
Identity = 118/261 (45.21%), Postives = 174/261 (66.67%), Query Frame = 1
Query:   94 IDLSNLGLKEVETI----NDRPKVFILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKENPCLMKSSSEMEFDYRPYIINWCIDLKILDGEEINEKEKLIAEWLYTQGKGRIYKPGDHFELVNYLTKDCAFT 864
            +DLS  GL+++       ND  +  IL+ N+I K++ +     L QLS++ N+++++ G++ L +L VL+L HN I  ++G+K L  L W+NL+ N +K I+ +  +  L+HLDLSDN I++I ++S L  LKT L+HGN I SL      L  S+ ILSLAEN+I DL E+++L  L +L+QLSI  NPC+M + S   FDYRP+I++WC++LK+LDG  +++KE L AEWLY+QGKGR Y+ G H  LV YL   C  T
Sbjct:   15 VDLSGQGLQKLSPTLPFGNDT-QTLILDKNQIIKLEHVEKCRNLVQLSVANNRLVRMMGVAKLIHLRVLNLPHNSIGYVEGLKDLVHLEWINLAGNNLKIIDQINSSTSLQHLDLSDNNISQIGDLSKLKSLKTLLLHGNNIASLRAASACLPQSLTILSLAENEIRDLNEVAFLAGLVDLEQLSIMNNPCVMATPSIPGFDYRPFIVSWCLNLKVLDGYVVSQKESLKAEWLYSQGKGRSYRLGQHIPLVQYLATVCPLT 274          
BLAST of CEP97 vs. UniProt/SwissProt
Match: sp|Q0P5X1|LRIQ1_MOUSE (Leucine-rich repeat and IQ domain-containing protein 1 OS=Mus musculus OX=10090 GN=Lrriq1 PE=2 SV=2)

HSP 1 Score: 87.8113 bits (216), Expect = 2.583e-16
Identity = 59/200 (29.50%), Postives = 108/200 (54.00%), Query Frame = 1
Query:  160 LNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNIS--FLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEI-SYLHSLFNLKQLSIKENPCLMKSSSEMEFDYRPYIINWCIDLKILDGEEIN 750
            L+ NKIT+I  L +   LQ+L++  NQ+I   GL     +  LD SHN +  IDGI +  +L  + L  N ++    L  ++ L+ L L DN I+ +  +S  +L  L+   +  N + ++  + LF  +S+E L ++ N + DLT +  + ++ ++L++L +  NP L       E ++R  I+     L++L+G+ +N
Sbjct:  903 LSHNKITRISGLESLKYLQELTVDHNQLISTKGLCEAPTIVYLDCSHNHLTGIDGIGNCGLLQIIKLQGNYLREPPSLRNHVLLRELHLDDNSISSVEGLSSCWLPLLQYLSISQNSLATI--VPLFHLVSLEKLDVSNNCLSDLTNVMCWFNACYSLRELCLTGNPVL------QEINWRDSILKTLPALRVLNGDMLN 1094          
BLAST of CEP97 vs. UniProt/SwissProt
Match: sp|Q3T0W4|PP1R7_BOVIN (Protein phosphatase 1 regulatory subunit 7 OS=Bos taurus OX=9913 GN=PPP1R7 PE=1 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 5.156e-16
Identity = 65/187 (34.76%), Postives = 102/187 (54.55%), Query Frame = 1
Query:   94 IDLSNLGLKEVETIN--DRPKVFILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKEN 648
            +DL++  + ++E      + K   L  N I  I+ L     L++L +  NQI +I  L  L+ L VLD+S N + +I+GI  L  L  L L NN+I  IE++    QL+ L+L  N I  I NI  L+ L++  +  N+IT L  +D   N++  +LS+  N+   LT+I  L SL NL++L +  N
Sbjct:   81 VDLNHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEGLQSLRELDLYDNQIRRIENLDALTELEVLDISFNLLRNIEGIDKLTRLKKLFLVNNKINKIENISSLHQLQMLELGSNRIRAIENIDTLTNLESLFLGKNKITKLQNLDALTNLT--VLSMQSNR---LTKIEGLQSLVNLRELYLSHN 262          

HSP 2 Score: 77.411 bits (189), Expect = 9.349e-14
Identity = 47/114 (41.23%), Postives = 73/114 (64.04%), Query Frame = 1
Query:  160 LNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGN 501
            L SN+I  I+ + T T L+ L +  N+I ++  L  L+NLTVL +  N++  I+G++SL  L  L LS+N I+ IE L+ N +L  LD++ N I KI N+S L++L+ F M+ N
Sbjct:  193 LGSNRIRAIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQSLVNLRELYLSHNGIEVIEGLDNNNKLTMLDIASNRIKKIENVSHLTELQEFWMNDN 306          

HSP 3 Score: 53.9138 bits (128), Expect = 3.025e-6
Identity = 54/174 (31.03%), Postives = 87/174 (50.00%), Query Frame = 1
Query:  160 LNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEG--NLQ-----------LKHLD---------LSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSL 615
            L  N+I +I+ L   T+L+ L IS N +  I G+  L+ L  L L +NKI  I+ I SL+ L  L L +NRI+ IE+++   NL+           L++LD         +  N +TKI  +  L  L+   +  N I  +  +D   N  + +L +A N+I  +  +S+L  L
Sbjct:  127 LYDNQIRRIENLDALTELEVLDISFNLLRNIEGIDKLTRLKKLFLVNNKINKIENISSLHQLQMLELGSNRIRAIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQSLVNLRELYLSHNGIEVIEGLD--NNNKLTMLDIASNRIKKIENVSHLTEL 298          
BLAST of CEP97 vs. TrEMBL
Match: H6WA36 (CEP97 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1203.35 bits (3112), Expect = 0.000e+0
Identity = 681/685 (99.42%), Postives = 682/685 (99.56%), Query Frame = 1
Query:   82 MTIKIDLSNLGLKEVETINDRPKVFILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKENPCLMKSSSEMEFDYRPYIINWCIDLKILDGEEINEKEKLIAEWLYTQGKGRIYKPGDHFELVNYLTKDCAFTXXXXXXXXXXXXXXXXEQRKQLSSRKILSSRTNNNESDKDTIKFXXXXXXXXXXXXDDTDLNVSISLSANGNDTTNTSLLISDSLFLPIKPVNQXXXXXXXXXXVIRQKSNSIDSSYVPILKFSKENPKLCSKNTSKSILNSSLDESNSVVNDISYTKKDLFIRKYREESKNNVLPDQSNNSNSEQSKIKLNKIINSVIRIQAWWRSISTRLKNPIVRRYLSGREANRTRSHILFLQKQMQLYYESYEQQRKLNISQNQAIQFLLDQVKELTIWKEKFENDXXXXXXXXXXXXXXXXXXXTQFSQDINESVKEQLLNKIDNLEEQVTTLKESMWKIETAVHLYDENSRNDQNSPXXXXXXXXXXGDLNRVIYEVEKIYRNGTGKHSSNELESDNESFPMNDEKLQTLRHIDNAPANSSEIQDDK 2136
            MTIKIDLSNLGLKEVETINDRPKVFILNSNKITKIDKLSTHTQLQQLSISGNQIIQ NGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKENPCLMKSSSEMEFDYRPYIINWCIDLKILDGEEINEKEKLIAEWLYTQGKGRIYKPGDHFELVNYLTKDCAFTNLKNKSKLKNDLDNILEQRKQLSSRKILSSRTNNNESDKDT KFSSSKSRKLSNNLDDTDLNVSISLSANGNDTTNTSLLISDSLFLPIKPVNQSPSPKKSISPVIRQKSNSIDSSYVPILKFSKENPKLCSKNTSKSILNSSLDESNSVVNDISYTKKDLFIRKYREESKN VLPDQSNNSNSEQSKIKLNKIINSVIRIQAWWRSISTRLKNPIVRRYLSGREANRTRSHILFLQKQMQLYYESYEQQRKLNISQNQAIQFLLDQVKELTIWKEKFENDNKSQNSNKKETNESKKEISTQFSQDINESVKEQLLNKIDNLEEQVTTLKESMWKIETAVHLYDENSRNDQNSPIISESICSEEGDLNRVIYEVEKIYRNGTGKHSSNELESDNESFPMNDE+LQTLRHIDNAPANSSEIQDDK
Sbjct:    1 MTIKIDLSNLGLKEVETINDRPKVFILNSNKITKIDKLSTHTQLQQLSISGNQIIQTNGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKENPCLMKSSSEMEFDYRPYIINWCIDLKILDGEEINEKEKLIAEWLYTQGKGRIYKPGDHFELVNYLTKDCAFTNLKNKSKLKNDLDNILEQRKQLSSRKILSSRTNNNESDKDTTKFSSSKSRKLSNNLDDTDLNVSISLSANGNDTTNTSLLISDSLFLPIKPVNQSPSPKKSISPVIRQKSNSIDSSYVPILKFSKENPKLCSKNTSKSILNSSLDESNSVVNDISYTKKDLFIRKYREESKNKVLPDQSNNSNSEQSKIKLNKIINSVIRIQAWWRSISTRLKNPIVRRYLSGREANRTRSHILFLQKQMQLYYESYEQQRKLNISQNQAIQFLLDQVKELTIWKEKFENDNKSQNSNKKETNESKKEISTQFSQDINESVKEQLLNKIDNLEEQVTTLKESMWKIETAVHLYDENSRNDQNSPIISESICSEEGDLNRVIYEVEKIYRNGTGKHSSNELESDNESFPMNDEELQTLRHIDNAPANSSEIQDDK 685          
BLAST of CEP97 vs. TrEMBL
Match: A0A096M703 (Centrosomal protein 97 OS=Poecilia formosa OX=48698 PE=4 SV=1)

HSP 1 Score: 290.041 bits (741), Expect = 1.273e-84
Identity = 185/579 (31.95%), Postives = 284/579 (49.05%), Query Frame = 1
Query:   94 IDLSNLGLKEVE---TINDRPKVFILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKENPCLMKSSSEMEFDYRPYIINWCIDLKILDGEEINEKEKLIAEWLYTQGKGRIYKPGDHFELVNYLTKDCAFTXXXXXXXXXXXXXXXXEQRKQLSSRKILSSRTNNNESDKDTIKFXXXXXXXXXXXXDDTDLNVSISLSANGN--------------------------DTTNTSLLISDSLFLPIKPVNQXXXXXXXXXXVIRQKSNSIDSSYVPILKFSKENPKLCSKN----TSKSILNSSLDESNSVVNDISYTKKDLFIRK---------YREESKNNVLPDQSNNSNSEQSKIKLNKIINSVIRIQAWWRSISTRLKNPIVRRYLSGREANRTRSHILFLQKQMQLYYESYEQQRKLNISQNQAIQFLLDQVKELTIWKEKFEN 1704
            +DLS   +++++   T ++     IL+ N I K+D L     LQQLS++ N+++++ G+S L  L VL+L +N I  I+G++ L+ LTWLNLS N IK IE L   + L+HLDLSDN I+ I +++ L  LKT L+HGN IT+L  +   L   + ILSLAEN+I DL E+SYL  L  L+QLSI  NPC+M + S   FDYRPYI++WC++LK+LDG  + +KE L AEWLY+QGKGR Y+PG H +LV YL   C  T        ++     +  +++   R++L     +  S     +              +  +  +  +S + +                          D  N+SLL S+S FLP    +               ++   D S  P       NP     N    T K+   +      SV    + +K  + I K          + ESK+   P Q+N                + +RIQ+WWR    R  +P  +   S     R + HILFL  +++   + YE++R   + Q +A++FL  +++ +  WK+  EN
Sbjct:   18 VDLSARSMQKLDPSFTCSEDTHTLILDRNNIMKLDHLECCPSLQQLSVANNRLVRMMGVSQLRELRVLNLPNNSIGYIEGLRDLSHLTWLNLSGNNIKVIEQLNSCVCLQHLDLSDNNISAIGDLTKLEALKTLLLHGNSITTLRTVPAHLPAHLSILSLAENEIRDLNEVSYLAPLHELEQLSIMCNPCVMATPSLPGFDYRPYIMSWCLNLKVLDGYIVTQKEGLKAEWLYSQGKGRSYRPGQHVQLVQYLATVCPLTASPALETAEDAKLEKILSKQRFHQRQLLEETRGDCPSPPRPTQLDIESHSPSHAFPTEPVVQFNTWVSCDASHASLPVVRSPRITGEQIFLEDVQTDEDKINSSLLSSESTFLPF--TSDLDPQTAHTDSEDETETFEPD-SLAPKRPSQSRNPNPNKTNESSPTEKNQRKTGGGNITSVATTTAASKARVAIPKDPTEMPFDFGKAESKDAAKPAQAN---------------EAAVRIQSWWRGHYVRCFHPAAKEVRSEIRLRRMQEHILFLSDKLETMEKQYEEERLQRLVQEEAVKFLWKELQSMQQWKQSVEN 578          
BLAST of CEP97 vs. TrEMBL
Match: A0A3B3VY02 (Centrosomal protein 97 OS=Poecilia latipinna OX=48699 PE=4 SV=1)

HSP 1 Score: 291.967 bits (746), Expect = 6.336e-84
Identity = 187/573 (32.64%), Postives = 277/573 (48.34%), Query Frame = 1
Query:  130 TINDRPKVFILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKENPCLMKSSSEMEFDYRPYIINWCIDLKILDGEEINEKEKLIAEWLYTQGKGRIYKPGDHFELVNYLTKDCAFTXXXXXXXXXXXXXXXXEQRKQLSSRKILSSRTNNNESDKDTIKFXXXXXXXXXXXXDDTD-----LNVSISLSAN------------------------GNDTTNTSLLISDSLFLPIKPVNQXXXXXXXXXXVIRQKSNSIDSSYVPILKFSKENPKLCSKNTSKSILNSSLDESN----------SVVNDISYTKKDLFIRK---------YREESKNNVLPDQSNNSNSEQSKIKLNKIINSVIRIQAWWRSISTRLKNPIVRRYLSGREANRTRSHILFLQKQMQLYYESYEQQRKLNISQNQAIQFLLDQVKELTIWKEKFEN 1704
            T ++     IL+ N I K+D L     LQQLS++ N+++++ G+S L  L VL+L +N I  I+G++ L+ LTWLNLS N IK IE L   + L+HLDLSDN I+ I +++ L  LKT L+HGN IT+L  +   L   + ILSLAEN+I DL E+SYL  L  L+QLSI  NPC+M + S   FDYRPYI++WC++LK+LDG  + +KE L AEWLY+QGKGR Y+PG H +LV YL   C  T        ++     +  +++   R++L     +  S     +                D      N  +S  A+                          D  N+SLL S+S FLP                     S     ++ P    + + P          I  SS  E N          SV    + +K  + I K          + ESK+   P Q + S     K+ L +   + +RIQ+WWR    R  +P  +   S     R + HILFL  +++   + YE++R   + Q +A++FL  +++ +  WK+  EN
Sbjct:    9 TCSEDTHTLILDRNNIMKLDHLECCPSLQQLSVANNRLVRMMGVSQLRELRVLNLPNNSIGYIEGLRDLSHLTWLNLSGNNIKVIEQLNSCVCLQHLDLSDNNISAIGDLTKLEALKTLLLHGNSITTLRTVPAHLPAHLSILSLAENEIRDLNEVSYLAPLHELEQLSIMCNPCVMATPSLPGFDYRPYIMSWCLNLKVLDGYIVTQKEGLKAEWLYSQGKGRSYRPGQHVQLVQYLATVCPLTASPALETAEDAKLEKILSKQRFHQRQLLEETRGDCPSPPRPTQLDIESHSPSHAASQSGDEPVVQFNTWVSCDASHASLPVVRSPRITGEQIFLEDVQADEDKINSSLLSSESTFLPF--------TSDLDPQTAHTDSEDETETFEPD-SLAPKRPSQSRNPNPNKINESSPTEKNQRKTGGGNITSVATTTAASKARVAIPKDPTEMPFDFGKAESKDAGKPAQVSTSG---DKLNLLQANEAAVRIQSWWRGHYVRCFHPAAKEVRSEIRLRRMQEHILFLSDKLETMEKQYEEERLQRLVQEEAVKFLWKELQSMQQWKQSVEN 569          
BLAST of CEP97 vs. TrEMBL
Match: I3K9Y5 (Centrosomal protein 97 OS=Oreochromis niloticus OX=8128 PE=4 SV=1)

HSP 1 Score: 287.345 bits (734), Expect = 2.341e-83
Identity = 190/616 (30.84%), Postives = 302/616 (49.03%), Query Frame = 1
Query:   31 NLFVLAAGISKYQRSEIMTIKIDLSNLGLKEVE---TINDRPKVFILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKENPCLMKSSSEMEFDYRPYIINWCIDLKILDGEEINEKEKLIAEWLYTQGKGRIYKPGDHFELVNYLTKDCAFTXXXXXXXXXXXXXXXXEQRKQLSSRKIL----------------------SSRTNNNESDKDTIKFXXXXXXXXXXXXDDTDLNVSISLSA-------------NGNDTTNTSLLISDSLFLP----IKPVNQXXXXX-----------XXXXXVIRQKSNSIDSSYVPILK------FSKENPKLCSKNTSKSILNSSLDESNSVVNDISYTKKDLFIRKYREESKNNVLPDQSNNSNSEQSKIKLNKIINSVIRIQAWWRSISTRLKNPIVRRYLSGREANRTRSHILFLQKQMQLYYESYEQQRKLNISQNQAIQFLLDQVKELTIWKEKFE 1701
            NLF+L   +            +DLS  G++++E   T ++     IL+ N I K+D L     LQQLS++ N+++++ G+S L+ L VL+L +N I  I+G++ L  L WLNLS N IK IE L   + L+HLDLSDN I+ I +++ L  LKT L+HGN IT+L  +   L   + ILSLAEN+I DL E+SYL  L  L+QLSI  NPC+M + S   FDYRPY+++WC+ LK+LDG  + +KE L AEWLY+QGKGR Y+PG H +LV YL   C  T        ++     +  +++   R++L                       S T      ++  K           + D ++ ++ I                  G D  N+S+L S+S F+P    ++P +     +               P   +K N+ +  + PI++         E     +  TS  +L   +    ++ ND+     D    + +E  K      +S+ + ++++ IK          IQ+WWR   TR  +P+ R   S     R + HILFL +++    + YE++R   + Q +A++FL  + + +  WK+  E
Sbjct:    7 NLFILPGPV------------VDLSARGMQKLEPSFTCSEDTHTLILDGNNIMKLDHLERSPGLQQLSVASNRLVRMMGVSRLTELRVLNLPNNSIGYIEGLRDLPHLKWLNLSGNNIKVIEQLNNCVSLQHLDLSDNNISAIGDLTKLVALKTLLLHGNSITTLRTVPAHLPAQLSILSLAENEIRDLNEMSYLAPLHELEQLSIMSNPCVMATPSLPGFDYRPYVMSWCLSLKVLDGYVVTQKEGLKAEWLYSQGKGRSYRPGQHVQLVQYLATVCPVTASPALETAEDAKLEKILSKQRFHQRQLLEETRGGCCSPPRPTQLDVESHSPSHTVPQGGARELKKIEPVVRFNTWVSSDSSNPSLPIVCRPRLSEEQIYLEDVQTGEDKLNSSMLSSESTFIPFTSDLEPRSTHSDSEDETETFEPDSLAPKHPAQPKKQNANNPQHPPIVEQHERKTLEGEEVISATPTTSSGLLGVRV---TTLQNDLD---SDFGKAEVKEAQKQEEADSKSSMTEADRAAIK----------IQSWWRGHYTRCCHPMAREVRSEIRLRRMQEHILFLSEKLDHVQKQYEEERLQRLVQEEALKFLWKEFQAMQQWKQSVE 594          
BLAST of CEP97 vs. TrEMBL
Match: A0A3B4A939 (Centrosomal protein 97 OS=Periophthalmus magnuspinnatus OX=409849 PE=4 SV=1)

HSP 1 Score: 281.952 bits (720), Expect = 3.241e-80
Identity = 182/560 (32.50%), Postives = 296/560 (52.86%), Query Frame = 1
Query:  130 TINDRPKVFILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKENPCLMKSSSEMEFDYRPYIINWCIDLKILDGEEINEKEKLIAEWLYTQGKGRIYKPGDHFELVNYLTKDCAFTXXXXXXXXXXXXXXXXEQRKQLSSRKILSSRTNNNESDKDTIKFXXXXXXXXXXXXD-----DTDLNVS---ISLSANGN----------------DTTNTSLLISDSLFLPIKPVNQXXXXXXXXXXVIRQKSNSIDS-------SYVPILKFSKENPKLCSKNTSKSILNSSLDESNSV----VNDISYTKKDLFIRKYREESKNNVLPDQSNNSNSEQSKIKLNKIINSVIRIQAWWRSISTRLKNPIVRRYLSGREANRTRSHILFLQKQMQLYYESYEQQRKLNISQNQAIQFLLDQVKELTIWKEKFEN 1704
            T ++     IL+ N+I K+D +  +  LQQLS++ N+++++ G+S L+ L VL+L +N I  I+G++ +  L WLNLS N IK IE L   + L+HLDLSDN I+ I +++ L +LKT L+HGN IT+L  +   L + + ILSLAEN+I DL E+SYL  L +L+QLSI  NPC+M + S   FDYRPYI++WC++LK+LDG  +++KE L AEWLY+QGKGR ++PG H +LV YL   C  T+       ++     + ++++L  +++L  R  +  S    ++          +        +T +N     +SL  N +                D  N+++L S+S F+P K          S   +    S+S D        S  P +   K N    SK    S L    +   SV    +N  S +   +  +   ++   + + +Q     +E++K++ NK   + I+IQ+WWR   TR  NP  +   +     R + HILFL +++    + YE +R   + Q + ++FL  +++ +  WK   E+
Sbjct:   32 TCSEDTHTLILDRNQIMKLDYMERNPGLQQLSVASNRLVRMMGVSRLTELRVLNLPNNSIGYIEGLRDMPYLKWLNLSGNNIKVIEQLNNCVSLQHLDLSDNNISVIGDLTKLIELKTLLLHGNSITTLRTVPAHLPVHLSILSLAENEIRDLNEVSYLAPLQDLEQLSIMSNPCVMATPSLPGFDYRPYIMSWCLNLKVLDGYVVSQKEGLKAEWLYSQGKGRSFRPGQHVQLVQYLATVCPLTSSPALETAEDAKLEKILRKQRLHQKQLLEERRVDCPSPPRPVQLDVEAHSASLSQEGPVLQINTWVNCEAAHVSLPVNHSPRLDEPIYLEDMQTDVDKLNSNMLSSESTFVPFK----------SELELHTGPSDSEDETETFEPDSLAPKISEPKRN---NSKREHHSPLTPKQEACASVTLLNINSNSGSLPQIMAKPCYDKCVRSEVSEQ-----TEETKLESNK---AAIKIQSWWRGQYTRFLNPKAKEVRNEIRLRRMQDHILFLSERLDGVQQQYEDERLQRMVQEETVKFLWKELQSMQEWKRSVEH 570          
BLAST of CEP97 vs. Ensembl Cavefish
Match: cep97 (centrosomal protein 97 [Source:ZFIN;Acc:ZDB-GENE-031030-11])

HSP 1 Score: 131.724 bits (330), Expect = 1.204e-31
Identity = 51/93 (54.84%), Postives = 70/93 (75.27%), Query Frame = 1
Query:  586 LTEISYLHSLFNLKQLSIKENPCLMKSSSEMEFDYRPYIINWCIDLKILDGEEINEKEKLIAEWLYTQGKGRIYKPGDHFELVNYLTKDCAFT 864
            L+++SYL  L +L+QLSI  NPC+M + S   FDYRPY+++WC++LK+LDG  +++KE L AEWLY+QGKGR Y+PG H +LV YL   C  T
Sbjct:    5 LSQVSYLAPLLDLEQLSIMNNPCVMDTPSLPGFDYRPYVVSWCLNLKVLDGYIVSQKEGLKAEWLYSQGKGRTYRPGQHIQLVQYLASTCPLT 97          
BLAST of CEP97 vs. Ensembl Cavefish
Match: drc3 (dynein regulatory complex subunit 3 [Source:ZFIN;Acc:ZDB-GENE-061103-349])

HSP 1 Score: 75.8702 bits (185), Expect = 5.911e-14
Identity = 58/182 (31.87%), Postives = 90/182 (49.45%), Query Frame = 1
Query:  217 QLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKENPCLMKSSSEMEFDYRPYIINWCIDLKILDGEEINEKEK 762
            QL +   +I+QI+ L   ++LT L L++N I  I G++ L  L WL+LS N+IK IE LE  ++L+ L LS+N I  I  +  L  L                        EILSL EN I  +  + YL    NL+ L++  NP         E +Y+ +++ +  DL  LD   ++E+ +
Sbjct:   47 QLRLEYKKILQIDHLWEFTSLTKLQLNNNSIEKIQGLEKLTNLLWLDLSFNKIKMIEGLEALVKLQTLSLSNNQIPAIEKMDTLEHL------------------------EILSLGENVISQIDNVIYLRRFKNLRSLNLARNPIC------QETNYKIFVVAYLPDLVYLDFRLVDEQTR 198          

HSP 2 Score: 72.7886 bits (177), Expect = 5.453e-13
Identity = 45/107 (42.06%), Postives = 67/107 (62.62%), Query Frame = 1
Query:  160 LNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLK 480
            L   KI +ID L   T L +L ++ N I +I GL  L+NL  LDLS NKI  I+G+++L  L  L+LSNN+I  IE ++    L+ L L +N+I++I N+ +L + K
Sbjct:   50 LEYKKILQIDHLWEFTSLTKLQLNNNSIEKIQGLEKLTNLLWLDLSFNKIKMIEGLEALVKLQTLSLSNNQIPAIEKMDTLEHLEILSLGENVISQIDNVIYLRRFK 156          
BLAST of CEP97 vs. Ensembl Cavefish
Match: ppp1r7 (protein phosphatase 1 regulatory subunit 7 [Source:NCBI gene;Acc:111191999])

HSP 1 Score: 73.9442 bits (180), Expect = 1.044e-13
Identity = 49/123 (39.84%), Postives = 74/123 (60.16%), Query Frame = 1
Query:  160 LNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRID 528
            L SN+I  I+ L   T L  L +  N+I ++  L  L NLTVL +  N+I  ++G++++  L  L LS+N I+ IE LE N +L  LD++ N I KI NIS L+ L+ F M+ N+I +   +D
Sbjct:  179 LGSNRIRIIENLDALTSLDSLFLGTNKITKLQNLDGLHNLTVLSIQSNRITKLEGLQNMVNLRELYLSHNGIEVIEGLENNKKLTTLDIAANRIKKIENISHLTDLQEFWMNDNQIENWSDLD 301          

HSP 2 Score: 70.4774 bits (171), Expect = 1.511e-12
Identity = 57/187 (30.48%), Postives = 102/187 (54.55%), Query Frame = 1
Query:   94 IDLSNLGLKEVETIN--DRPKVFILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKEN 648
            +DL +  + ++E +    + K   L  N I KI+ L + + L++L +  NQI ++  L  L+ L  LD+S N +  I+G++ L  +  L L +N+I +I +LE    L  L+L  N I  I N+  L+ L +  +  N+IT L  +D   N++  +LS+  N+I   T++  L ++ NL++L +  N
Sbjct:   67 VDLVHCRIGKIEGLEVLQKAKTLSLRQNLIKKIENLESLSSLRELDLYDNQIRKLENLQALTELEQLDVSFNLLRKIEGLERLTKVKKLFLLHNKISSIANLEHLTSLHMLELGSNRIRIIENLDALTSLDSLFLGTNKITKLQNLDGLHNLT--VLSIQSNRI---TKLEGLQNMVNLRELYLSHN 248          

HSP 3 Score: 69.707 bits (169), Expect = 2.896e-12
Identity = 64/210 (30.48%), Postives = 106/210 (50.48%), Query Frame = 1
Query:   52 GISKYQRSEIMTIKIDLSNLGLKEVETINDRPKVFILN--SNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNI--------SIEI------------LSLAENQIHDLTEISYLHSL 615
            G+   Q+++ ++++ +L    +K++E +     +  L+   N+I K++ L   T+L+QL +S N + +I GL  L+ +  L L HNKI SI  ++ L  L  L L +NRI+ IE+L+    L  L L  N ITK+ N+  L  L    +  NRIT L  +   +N+         IE+            L +A N+I  +  IS+L  L
Sbjct:   79 GLEVLQKAKTLSLRQNL----IKKIENLESLSSLRELDLYDNQIRKLENLQALTELEQLDVSFNLLRKIEGLERLTKVKKLFLLHNKISSIANLEHLTSLHMLELGSNRIRIIENLDALTSLDSLFLGTNKITKLQNLDGLHNLTVLSIQSNRITKLEGLQNMVNLRELYLSHNGIEVIEGLENNKKLTTLDIAANRIKKIENISHLTDL 284          
BLAST of CEP97 vs. Ensembl Cavefish
Match: lrguk (leucine rich repeats and guanylate kinase domain containing [Source:NCBI gene;Acc:103023555])

HSP 1 Score: 73.559 bits (179), Expect = 5.554e-13
Identity = 67/239 (28.03%), Postives = 106/239 (44.35%), Query Frame = 1
Query:  193 LSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEG-------------------------------------------NLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITS---LYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKENPCLMKSSSEMEFDYRPYIINWCIDLKILDGEEINEKEKLIA 771
            LS +T L++L +  N+I  ++ +SH+ NL +LD SHN++ +  G +    L  +N S+N+I  ++ L                                             NL LKHL L  NLI KI N+  L  L+   +  NRI S   L  + L  +I+ E      N I ++ E+SYLH +  L++L++K NP       + + DYR  +I     L  LD   +   +K+ A
Sbjct:   43 LSEYTHLRKLELPYNKIKDLSCVSHMPNLIILDASHNELSTFFGFQPPKYLKEVNFSHNQISEMKDLSAYFSLNKLILDYNSITEIKGVEKCSSLIHFSIAHNKISRISGLNNLPLKHLCLRGNLIKKIENLHTLRALQFLDISSNRIHSLSGLQNLPLLGSINFE-----SNMISEIKEVSYLHDILLLRELNLKRNPV------QEQPDYRMMVIFLLNRLTELDELAVTAVDKVTA 270          
BLAST of CEP97 vs. Ensembl Cavefish
Match: ENSAMXT00000021515.2 (leucine rich repeat containing 49 [Source:NCBI gene;Acc:103024138])

HSP 1 Score: 69.707 bits (169), Expect = 8.968e-12
Identity = 67/220 (30.45%), Postives = 105/220 (47.73%), Query Frame = 1
Query:  160 LNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGN---RITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNL-----KQLSIKENPCLMKSSS--EMEFDYRPYIINWC---------IDLKILDGEEINEKEK 762
            L    + +   L    +L+ L++  N I  +  L+HL  L  LDL  N++  +  I SL+ L  L L  NRI+ I  L+   +L  LDL +N I+K+ N+S LS+L+   + GN   R+ +L+ +D     S+  L+L  N I  +TE+  L  L  L        S  E  CL  S S  E+  D  P     C         + L++LD + I ++E+
Sbjct:  174 LKCRGLMEFPHLDGMNKLRLLNLQHNLISDLPHLAHLKRLAFLDLYDNRLTDMSAISSLSALRVLMLGKNRIQRICGLDNLTKLDVLDLHNNQISKMENLSHLSELRVLNLAGNCICRVENLHGLD-----SLTELNLRYNHISSVTEVDLLSCLQRLFLSSNSISSFDELACLGLSCSLCELTLDGNPVAQESCYKQAALRCVLPLRLLDMKRITDEER 388          

HSP 2 Score: 57.3806 bits (137), Expect = 4.677e-8
Identity = 38/108 (35.19%), Postives = 60/108 (55.56%), Query Frame = 1
Query:  148 KVFILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLS 471
            +V +L  N+I +I  L   T+L  L +  NQI ++  LSHLS L VL+L+ N I  ++ +  L+ LT LNL  N I ++  ++    L+ L LS N I+    ++ L 
Sbjct:  236 RVLMLGKNRIQRICGLDNLTKLDVLDLHNNQISKMENLSHLSELRVLNLAGNCICRVENLHGLDSLTELNLRYNHISSVTEVDLLSCLQRLFLSSNSISSFDELACLG 343          

HSP 3 Score: 55.8398 bits (133), Expect = 1.686e-7
Identity = 39/116 (33.62%), Postives = 64/116 (55.17%), Query Frame = 1
Query:  271 SNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNIS-IEILSLAENQIHDLTEISYLHSL 615
            ++L  LDL    ++    +  +N L  LNL +N I ++ HL    +L  LDL DN +T +S IS LS L+  ++  NRI  +  +D   N++ +++L L  NQI  +  +S+L  L
Sbjct:  167 ASLDRLDLKCRGLMEFPHLDGMNKLRLLNLQHNLISDLPHLAHLKRLAFLDLYDNRLTDMSAISSLSALRVLMLGKNRIQRICGLD---NLTKLDVLDLHNNQISKMENLSHLSEL 279          
BLAST of CEP97 vs. Ensembl Sea Lamprey
Match: cep97 (centrosomal protein 97 [Source:ZFIN;Acc:ZDB-GENE-031030-11])

HSP 1 Score: 245.743 bits (626), Expect = 1.602e-71
Identity = 114/263 (43.35%), Postives = 175/263 (66.54%), Query Frame = 1
Query:   73 SEIMTIKIDLSNLGLKEVETIN--DRPKVFILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKENPCLMKSSSEMEFDYRPYIINWCIDLKILDGEEINEKEKLIAEWLYTQGKGRIYKPGDHFELVNYLTKDC 855
            SE+    +DLS+ GL  +  ++        +L+SN + K+D + +   L QLS + N ++++ G++ LS+L  L+L  N I +I+G+K L  L WLNL+ N IK IEHL G   L ++DLSDN I+ + ++S LS L+T L+HGN +TSL      L   + ILSLAEN+I DLTE+S+L  L +L+QLS+ +NPC++ + S    D+RPY+++WC+ L++LDG  + +KE L AEWLY+QG+GR ++PG H +L+ YL + C
Sbjct:   11 SEVAGRVVDLSDRGLVRLSAVSLPTDACTLVLDSNNLAKLDGVESCRHLMQLSAAENSLVRMGGVARLSSLKQLNLPRNSIPAIEGLKDLCHLQWLNLAGNSIKTIEHLNGCTSLTYVDLSDNNISHLGDMSKLSNLRTLLLHGNMVTSLRTAPTHLPPQLGILSLAENEITDLTEMSHLSCLRSLEQLSVMKNPCMLSAPSAPACDHRPYVLSWCLTLRVLDGHVVTQKESLKAEWLYSQGRGRSFRPGQHAQLIGYLAQVC 273          

HSP 2 Score: 54.6842 bits (130), Expect = 5.913e-8
Identity = 24/83 (28.92%), Postives = 46/83 (55.42%), Query Frame = 1
Query: 1450 NSVIRIQAWWRSISTRLKNPIVRRYLSGREANRTRSHILFLQKQMQLYYESYEQQRKLNISQNQAIQFLLDQVKELTIWKEKF 1698
            ++ +RIQA WR    R  +  VR         R + H+++L ++++     +E +R+  + Q +A+++L  QV+ L  WKE+F
Sbjct:  570 SAAVRIQAAWRGYRAREHDERVRAARGEMRLRRLQEHVVYLAQELERLRSMHEAERRERLVQTEAVKYLWSQVRTLHEWKEEF 652          
BLAST of CEP97 vs. Ensembl Sea Lamprey
Match: ppp1r7 (protein phosphatase 1, regulatory (inhibitor) subunit 7 [Source:NCBI gene;Acc:560323])

HSP 1 Score: 78.5666 bits (192), Expect = 6.373e-16
Identity = 61/188 (32.45%), Postives = 106/188 (56.38%), Query Frame = 1
Query:   91 KIDLSNLGLKEVETIN--DRPKVFILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKEN 648
            ++DL++  + ++E +    + KV  L  N I +I+ L + T L++L +  N + +I  L  L NL +LD+S N +  I+G+ +L  +  L L +N+I  IE+L    +L+ L+++ N I  I NI  L  L +  +  N+IT L  +D   N++  +LS+  N+I   T+I  L SL NL++L +  N
Sbjct:   60 EVDLNHCRIGKIERLEILMKVKVLCLRQNMIAQIENLESLTTLRELDLYDNVLKKIENLDTLVNLEMLDISFNVLRKIEGLDTLRKVRKLFLVSNKITKIENLNSLTELRMLEVASNRIRVIENIETLKNLDSLFIGKNKITKLQNLDSLTNLT--VLSIQSNRI---TKIEGLSSLVNLQELYLSHN 242          

HSP 2 Score: 76.6406 bits (187), Expect = 3.181e-15
Identity = 57/169 (33.73%), Postives = 95/169 (56.21%), Query Frame = 1
Query:   94 IDLSNLGLKEVETINDRPKV--FILNSNKITKIDKLSTHTQLQQLSISGNQI----------------------IQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRID 528
            +D+S   L+++E ++   KV    L SNKITKI+ L++ T+L+ L ++ N+I                       ++  L  L+NLTVL +  N+I  I+G+ SL  L  L LS+N I+ IE LE N +L  LD++ N + +I N+  L++L+ F M+ N+I++   +D
Sbjct:  127 LDISFNVLRKIEGLDTLRKVRKLFLVSNKITKIENLNSLTELRMLEVASNRIRVIENIETLKNLDSLFIGKNKITKLQNLDSLTNLTVLSIQSNRITKIEGLSSLVNLQELYLSHNGIEVIEGLENNKKLTTLDIAANRVRRIENVGHLTELQEFWMNDNQISNWNDVD 295          

HSP 3 Score: 51.6026 bits (122), Expect = 3.470e-7
Identity = 40/137 (29.20%), Postives = 76/137 (55.47%), Query Frame = 1
Query:  214 QQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNL 624
            +++ ++  +I +I  L  L  + VL L  N I  I+ ++SL  L  L+L +N +K IE+L+  + L+ LD+S N++ KI  +  L K++   +  N+IT +  ++      + +L +A N+I  +  I  L +L +L
Sbjct:   59 EEVDLNHCRIGKIERLEILMKVKVLCLRQNMIAQIENLESLTTLRELDLYDNVLKKIENLDTLVNLEMLDISFNVLRKIEGLDTLRKVRKLFLVSNKITKIENLNSL--TELRMLEVASNRIRVIENIETLKNLDSL 193          
BLAST of CEP97 vs. Ensembl Sea Lamprey
Match: LRRC49 (leucine rich repeat containing 49 [Source:HGNC Symbol;Acc:HGNC:25965])

HSP 1 Score: 77.411 bits (189), Expect = 6.045e-15
Identity = 73/237 (30.80%), Postives = 112/237 (47.26%), Query Frame = 1
Query:  130 TINDR---PKVFILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNI-SIEILSLAENQIHDLTEISYLHSLFNL-----------KQLSIKENPCLMKSSSE-----MEFDYRPYIINWCIDLKILDGEEINEKEKLIAEWL 780
            T+ +R   P+   L+S  +T    L     L+ LS+  N I +   LSHL  L  LDL  N++  I G+ +L  L  L L  NRI+ I  LE   +L  LDL  N I +I N+S LS+L+   + GN+IT    +D    + S+  L+L  N I  + E+  L SL  L             + ++E P L + + +      E  YR   +     L+ LD + + E+E+ +A  L
Sbjct:   24 TVEERAYNPERLNLDSRGMTMCPILDGEEDLRLLSLQHNLIRRAQHLSHLRRLVFLDLYANELEEISGLYNLRSLRVLMLGKNRIRKITSLESLTKLDVLDLHGNQIVRIENLSHLSELRVLNLAGNQITH---VDSLRGLHSLAELNLRRNNISSMKEVDCLPSLQRLFLSYNNIANFDGIVCLREAPSLCEVALDGNPLAQEACYRQTALRHMGQLRQLDMKRVTEEERRLASLL 257          
BLAST of CEP97 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006793.1 (pep scaffold:Pmarinus_7.0:GL478186:28720:41038:-1 gene:ENSPMAG00000006137.1 transcript:ENSPMAT00000006793.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.6178 bits (148), Expect = 5.596e-11
Identity = 38/121 (31.40%), Postives = 67/121 (55.37%), Query Frame = 1
Query:  115 LKEVETINDRPKVFILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRI-----KNIEHLEG-NLQLKHLDLSDNLITKISNI 459
            L++V  ++ R +   L+ N+I +++ L    QL  L +S N++ +I GL+ L+ L  L+LS N + S+ G++ L  + WLN+S NRI       +  L G + QL HL+   N +  +  +
Sbjct:    4 LRDV-PLHSRLRAVNLHCNQIARLEGLGRLPQLAHLDLSSNRLERIEGLASLACLRTLNLSCNHLTSVQGLQGLACMHWLNVSYNRITDLVGSGLRDLHGPDYQLSHLEAHGNRLADVDAL 123          
BLAST of CEP97 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004940.1 (pep scaffold:Pmarinus_7.0:GL476356:339323:347865:-1 gene:ENSPMAG00000004448.1 transcript:ENSPMAT00000004940.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.225 bits (134), Expect = 2.194e-8
Identity = 57/177 (32.20%), Postives = 92/177 (51.98%), Query Frame = 1
Query:  286 LDLSHNKIISI-DGIKSLNMLTWLNLSNNRIKNIEHLEGNLQ-LKHLDLSDNLITKISN-ISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKENPCLMKSSSEMEFDYRPYI--INWCIDLKILDGEEINEKEKLIAEWLYTQGKGR 801
            L+L+ N++  I D I  L  L  L LSNN ++ + H  GNL+ L+ LDL +N +  + N I++L  L+  ++  N++TSL R    L  S+  L + ENQ+  + E   + +L NL++L + +NP L     E+    +  I  I  C  L  L G  ++     I ++L  QG  R
Sbjct:  356 LNLATNQLTKIPDDISELTSLEILVLSNNLLRKLPHGLGNLRKLRELDLEENKLESLPNEIAYLKDLQKLVLTNNQLTSLPRGIGHL-CSLTHLMVGENQLTHVPE--EIGTLENLEELYLNDNPNLHNLPFELALCSKLLIMSIENC-PLSQLPGPIVSSGPSFIIQYLKMQGPYR 528          
BLAST of CEP97 vs. Ensembl Yeast
Match: SDS22 (Regulatory subunit of the type 1 protein phosphatase (PP1) Glc7p; whether it functions as a positive or negative regulator of Glc7p is controversial; involved in the regulation of Glc7p nuclear localization and function [Source:SGD;Acc:S000001676])

HSP 1 Score: 53.9138 bits (128), Expect = 4.545e-8
Identity = 57/150 (38.00%), Postives = 83/150 (55.33%), Query Frame = 1
Query:  211 LQQLSISGNQIIQINGLSHLSNLTVLDLSH--NKIISIDG-IKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNIS-IEILSLAENQIHDLTEISYLHSLFNLKQLSIKEN 648
            L+QL +  N I  I+ +  L +  ++DL    NKI  I   +  L  LT L+LS N+IK+I++LE    L++L    N I+KI N+S L  LK   + GN++ S+   D F  +S +E + L +N I  L     LH L NLK LSI+ N
Sbjct:   68 LKQLCLRQNLIESISEVEVLPHDKIVDLDFYDNKIKHISSNVNKLTKLTSLDLSFNKIKHIKNLENLTDLENLYFVQNSISKIENLSTLKSLKNLELGGNKVHSI-EPDSFEGLSNLEEIWLGKNSIPRLIN---LHPLKNLKILSIQSN 213          

HSP 2 Score: 46.9802 bits (110), Expect = 7.654e-6
Identity = 49/146 (33.56%), Postives = 80/146 (54.79%), Query Frame = 1
Query:  115 LKEVETINDRPKVFILNSNKITKIDKLSTHTQLQQLSISGNQI--IQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNIS 546
            +K +E + D   ++ +  N I+KI+ LST   L+ L + GN++  I+ +    LSNL  + L  N I  +  +  L  L  L++ +N++K IE+LE    L+ L LS N ITKI  +    KL T  +  N+ITSL  ++   N++
Sbjct:  128 IKNLENLTDLENLYFV-QNSISKIENLSTLKSLKNLELGGNKVHSIEPDSFEGLSNLEEIWLGKNSIPRLINLHPLKNLKILSIQSNKLKKIENLEELTNLEELYLSHNFITKIEGLEKNLKLTTLDVTSNKITSLENLNHLSNLT 272          
BLAST of CEP97 vs. Ensembl Nematostella
Match: EDO35299 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLU3])

HSP 1 Score: 87.4261 bits (215), Expect = 1.051e-18
Identity = 63/147 (42.86%), Postives = 81/147 (55.10%), Query Frame = 1
Query:  142 RPKVFILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLS----KLKTFLMHGNRITSLYRIDLFLNISIEILSLAE 570
            RPK      ++IT I  L  H+ L  L++  N I +I GL HL NL  LDLS N+I  I+G+ SL  L  LNLS NRI  +E LE   +L  LDLS N I  +S +  L      L T  +HGNRI SL   + F++  I  +SL E
Sbjct:   13 RPKEICWIDSQITSIKSLKLHSNLVTLNLHSNHISKIEGLQHLQNLRHLDLSSNQISHIEGLTSLGYLRVLNLSCNRIYLVEGLENLRKLTKLDLSYNFIENVSGLKDLHGNGYSLTTLYLHGNRIASL---EHFISSVIGCISLKE 156          
BLAST of CEP97 vs. Ensembl Nematostella
Match: EDO38690 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC72])

HSP 1 Score: 79.337 bits (194), Expect = 4.573e-15
Identity = 53/169 (31.36%), Postives = 82/169 (48.52%), Query Frame = 1
Query:   94 IDLSNLGLKEVETIND--RPKVFILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTE 594
            +DLSN GL+++E + +   P+  + N+N+I+K++ L     LQQLS++ N+++++ G+S    L VLDLS+N I++I+G                                                 K  T L+HGN I SL  +   L  SI  LSLAEN++ DLTE
Sbjct:   20 LDLSNRGLRKIEPLPEGLSPQTLLYNNNEISKLENLQFFAHLQQLSLANNRLVEMRGISQAQGLKVLDLSNNSIMNIEG---------------------------------------------KLCGKFCTLLLHGNLIPSLRPVPEVLPKSIITLSLAENELKDLTE 143          
BLAST of CEP97 vs. Ensembl Nematostella
Match: EDO44937 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU20])

HSP 1 Score: 75.485 bits (184), Expect = 7.691e-15
Identity = 57/159 (35.85%), Postives = 86/159 (54.09%), Query Frame = 1
Query:  148 KVFILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNL 624
            K   L  N+I K++ L T T L++L    NQI +I  L  L NL +LDLS N I  I+ + SL  L  L L  N+I  IE LE   +L  ++L  N I  +  +  L+KL++  +  N+IT L  +      S+++LS+  N+I +L  + +L SL  L
Sbjct:   52 KSLCLRRNEIKKLENLETLTSLEELDFYDNQISKIENLDRLVNLRILDLSFNVIKVIENLNSLTKLEKLYLVQNKIGRIEGLEHLTELTMVELGANKIRVLEGLEHLTKLESLFVGKNKITELQNLSGL--CSLKVLSIQSNRIVELKGLEHLDSLEEL 208          

HSP 2 Score: 66.6254 bits (161), Expect = 8.579e-12
Identity = 41/116 (35.34%), Postives = 70/116 (60.34%), Query Frame = 1
Query:  160 LNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRI 507
            L +NKI  ++ L   T+L+ L +  N+I ++  LS L +L VL +  N+I+ + G++ L+ L  L +S+N I+ I+ LE   +L  LDL+ N I +ISN+  L  L+ F  + N++
Sbjct:  144 LGANKIRVLEGLEHLTKLESLFVGKNKITELQNLSGLCSLKVLSIQSNRIVELKGLEHLDSLEELYISHNGIEEIKGLESLTKLNTLDLASNRIKRISNVGHLLNLEEFWFNDNQL 259          

HSP 3 Score: 63.929 bits (154), Expect = 5.896e-11
Identity = 49/156 (31.41%), Postives = 87/156 (55.77%), Query Frame = 1
Query:   25 IQNLFVLAAGISKYQRSEIMTIKIDLSNLG------LKEVETINDRPKVFILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSK 474
            ++ L+++   I + +  E +T ++ +  LG      L+ +E +     +F+   NKIT++  LS    L+ LSI  N+I+++ GL HL +L  L +SHN I  I G++SL  L  L+L++NRIK I ++   L L+    +DN +    ++  L+K
Sbjct:  117 LEKLYLVQNKIGRIEGLEHLT-ELTMVELGANKIRVLEGLEHLTKLESLFV-GKNKITELQNLSGLCSLKVLSIQSNRIVELKGLEHLDSLEELYISHNGIEEIKGLESLTKLNTLDLASNRIKRISNVGHLLNLEEFWFNDNQLEHWEDLDELAK 270          

HSP 4 Score: 63.5438 bits (153), Expect = 8.248e-11
Identity = 49/167 (29.34%), Postives = 91/167 (54.49%), Query Frame = 1
Query:  148 KVFILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSL----FNLKQLS 636
            ++  L+ N I  I+ L++ T+L++L +  N+I +I GL HL+ LT+++L  NKI  ++G++ L  L  L +  N+I  +++L G   LK L +  N I ++  +  L  L+   +  N I  +  ++    ++   L LA N+I  ++ + +L +L    FN  QL 
Sbjct:   96 RILDLSFNVIKVIENLNSLTKLEKLYLVQNKIGRIEGLEHLTELTMVELGANKIRVLEGLEHLTKLESLFVGKNKITELQNLSGLCSLKVLSIQSNRIVELKGLEHLDSLEELYISHNGIEEIKGLESLTKLN--TLDLASNRIKRISNVGHLLNLEEFWFNDNQLE 260          
BLAST of CEP97 vs. Ensembl Nematostella
Match: EDO45771 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSA0])

HSP 1 Score: 76.6406 bits (187), Expect = 1.960e-14
Identity = 65/201 (32.34%), Postives = 105/201 (52.24%), Query Frame = 1
Query:  169 NKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKENPCLMKSSSEMEFDYRPYIINWCIDLKILDGEEINEKEKLIA 771
            N I  I  L+   +L  L I  NQI +I+GLS L +L VL L  N+I  I+ +++L  L  L+L  NRI  IE+L    +L+ L+L+ N I K+ NIS +  L    +  N+I ++  +D   N  ++ L L+ N I    +I+ L    ++ +LS+  NP         +  Y+  ++     L+ LD + I E+E+ IA
Sbjct:   59 NLIRNIQHLANLRRLIFLDIYDNQIEEISGLSSLKSLRVLMLGKNRIRKINNLEALTKLDVLDLHGNRISKIENLSHLTELRVLNLAGNEILKVCNISGMRSLAELNLRRNKICTVEEVDRLSN--LQRLFLSFNCISRFEDINCLTRSTSITELSLDGNP------FASDVTYKQTVLKSVTCLRQLDMKRITEEERRIA 251          
BLAST of CEP97 vs. Ensembl Nematostella
Match: EDO38071 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDZ3])

HSP 1 Score: 68.9366 bits (167), Expect = 3.225e-12
Identity = 59/185 (31.89%), Postives = 87/185 (47.03%), Query Frame = 1
Query:  229 SGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKENPCLMKSSSEMEFDYRPYIINWCIDLKILDGEEINEKEKLIAEWLY 783
               +I +  G+    N+  L L    I+ ID + S   LT L L NN I+ IE L+  + L+ LDLS N I  I  +  L+KLK   ++ NRIT +  +D   N+   + S+  N +  L  + YL    NL+ L++  NP    S       Y+ Y+I    DL  LD   I+E  +  A   Y
Sbjct:   30 EAGRIAKQEGID-FENVLALRLDFKNILKIDNLWSFVNLTTLQLDNNIIEKIEGLDMLVNLQWLDLSFNNIEVIEGLDKLTKLKDLTLYNNRITKIENMDSLTNLH--VFSIGNNSLKQLDNVIYLRRFKNLRTLNLSFNPFCEDSK------YKEYVIAHLPDLVYLDFRLIDETAREAATERY 205          

HSP 2 Score: 57.7658 bits (138), Expect = 1.179e-8
Identity = 59/209 (28.23%), Postives = 93/209 (44.50%), Query Frame = 1
Query:  160 LNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKENPCLMKSSSEMEFDYRPYIINWCIDLKILDGEEINEKEKLIAEWLYT 786
            L+   I KID L +   L  L +  N I +I GL  L NL  LDLS N I  I+G+  L  L  L L NNRI  IE+++    L    + +N + ++ N+ +L + K          +L  ++L  N   E     E  I  L ++ YL   F L   + +E      ++   ++     + +  +  K  D EE   KE+L+ +  Y 
Sbjct:   50 LDFKNILKIDNLWSFVNLTTLQLDNNIIEKIEGLDMLVNLQWLDLSFNNIEVIEGLDKLTKLKDLTLYNNRITKIENMDSLTNLHVFSIGNNSLKQLDNVIYLRRFK----------NLRTLNLSFNPFCEDSKYKEYVIAHLPDLVYLD--FRLIDETARE-----AATERYKYSIEEMVHDETVAQKKQDEEEARNKERLLHKAAYV 241          
BLAST of CEP97 vs. Ensembl Medaka
Match: cep97 (centrosomal protein 97 [Source:NCBI gene;Acc:101155238])

HSP 1 Score: 174.866 bits (442), Expect = 5.589e-46
Identity = 86/161 (53.42%), Postives = 113/161 (70.19%), Query Frame = 1
Query:  382 IEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKENPCLMKSSSEMEFDYRPYIINWCIDLKILDGEEINEKEKLIAEWLYTQGKGRIYKPGDHFELVNYLTKDCAFT 864
            IE L   + L+HLDLSDN I+ I +++ L+ LKT L+HGN IT+L  +   L   + ILSLAEN+I DL E+SYL SL  L+QLSI  NPC+M + S   FDYRPYI++WC++LK+LDG  + +KE L AEWLY+QGKGR ++PG H +L  YL   C  T
Sbjct:    1 IEQLYSCVSLQHLDLSDNNISTIGDLTKLAALKTLLLHGNSITTLRTVPAHLPAHLSILSLAENEIRDLNEVSYLASLHELEQLSIMSNPCVMATPSLPGFDYRPYIMSWCLNLKVLDGYVVTQKEGLKAEWLYSQGKGRSFRPGQHVQLSQYLATVCPLT 161          

HSP 2 Score: 50.8322 bits (120), Expect = 5.470e-6
Identity = 22/84 (26.19%), Postives = 44/84 (52.38%), Query Frame = 1
Query: 1453 SVIRIQAWWRSISTRLKNPIVRRYLSGREANRTRSHILFLQKQMQLYYESYEQQRKLNISQNQAIQFLLDQVKELTIWKEKFEN 1704
            + ++IQ+WWR   TR  +P  +         R + HI+FL  +++   +  E +R   + Q +A++FL  +++ +  WK+  E 
Sbjct:  360 AAVKIQSWWRGQHTRCCHPTAKEVRGEIRLRRMQDHIVFLTDKLENVQKQLEDERLQRLVQEEAMKFLWKELQAVQQWKQSVEQ 443          
BLAST of CEP97 vs. Ensembl Medaka
Match: ppp1r7 (protein phosphatase 1 regulatory subunit 7 [Source:NCBI gene;Acc:101158055])

HSP 1 Score: 75.0998 bits (183), Expect = 4.881e-14
Identity = 54/142 (38.03%), Postives = 83/142 (58.45%), Query Frame = 1
Query:  160 LNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNI-SIEILSLAENQIH 582
            L SN+I  I+ L   T L  L +  N+I ++  L  L NL+VL +  N+I  I+G+++L  L  L LS+N I+ IE LE N +L  LD++ N + KI NIS L++L+ F M+ N+I +   +D   N  S+E + L  N + 
Sbjct:  179 LGSNRIRVIENLDGLTSLTSLFLGTNKINKLQNLDALHNLSVLSIQSNRITKIEGLQNLVNLKELYLSHNGIEVIEGLENNKKLTTLDIAANRVKKIENISHLTELQEFWMNDNQIENWSDLDELKNAKSLETVYLERNPLQ 320          

HSP 2 Score: 71.633 bits (174), Expect = 6.360e-13
Identity = 60/187 (32.09%), Postives = 101/187 (54.01%), Query Frame = 1
Query:   94 IDLSNLGLKEVETIN--DRPKVFILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKEN 648
            +DL +  + ++E +    + K   L  N I KI+ L + + L++L +  NQI ++  L +L+ L  LD+S N +  I+ ++ L  L  L L +N+I  I +LE    L+ L+L  N I  I N+  L+ L +  +  N+I  L  +D   N+S  +LS+  N+I   T+I  L +L NLK+L +  N
Sbjct:   67 VDLVHCRIGKIEGLEVLQKAKTLSLRQNLIKKIENLESLSSLRELDLYDNQIRKLENLDNLTELEQLDVSFNILRKIENLERLTQLKKLFLVHNKITGIANLEHFSFLEMLELGSNRIRVIENLDGLTSLTSLFLGTNKINKLQNLDALHNLS--VLSIQSNRI---TKIEGLQNLVNLKELYLSHN 248          

HSP 3 Score: 67.0106 bits (162), Expect = 1.794e-11
Identity = 60/210 (28.57%), Postives = 104/210 (49.52%), Query Frame = 1
Query:   52 GISKYQRSEIMTIKIDLSNLGLKEVETINDRPKVFILN--SNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNI--------SIEI------------LSLAENQIHDLTEISYLHSL 615
            G+   Q+++ ++++ +L    +K++E +     +  L+   N+I K++ L   T+L+QL +S N + +I  L  L+ L  L L HNKI  I  ++  + L  L L +NRI+ IE+L+G   L  L L  N I K+ N+  L  L    +  NRIT +  +   +N+         IE+            L +A N++  +  IS+L  L
Sbjct:   79 GLEVLQKAKTLSLRQNL----IKKIENLESLSSLRELDLYDNQIRKLENLDNLTELEQLDVSFNILRKIENLERLTQLKKLFLVHNKITGIANLEHFSFLEMLELGSNRIRVIENLDGLTSLTSLFLGTNKINKLQNLDALHNLSVLSIQSNRITKIEGLQNLVNLKELYLSHNGIEVIEGLENNKKLTTLDIAANRVKKIENISHLTEL 284          
BLAST of CEP97 vs. Ensembl Medaka
Match: ppp1r7 (protein phosphatase 1 regulatory subunit 7 [Source:NCBI gene;Acc:101158055])

HSP 1 Score: 73.9442 bits (180), Expect = 1.614e-13
Identity = 54/142 (38.03%), Postives = 83/142 (58.45%), Query Frame = 1
Query:  160 LNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNI-SIEILSLAENQIH 582
            L SN+I  I+ L   T L  L +  N+I ++  L  L NL+VL +  N+I  I+G+++L  L  L LS+N I+ IE LE N +L  LD++ N + KI NIS L++L+ F M+ N+I +   +D   N  S+E + L  N + 
Sbjct:  218 LGSNRIRVIENLDGLTSLTSLFLGTNKINKLQNLDALHNLSVLSIQSNRITKIEGLQNLVNLKELYLSHNGIEVIEGLENNKKLTTLDIAANRVKKIENISHLTELQEFWMNDNQIENWSDLDELKNAKSLETVYLERNPLQ 359          

HSP 2 Score: 71.2478 bits (173), Expect = 9.844e-13
Identity = 60/187 (32.09%), Postives = 101/187 (54.01%), Query Frame = 1
Query:   94 IDLSNLGLKEVETIN--DRPKVFILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKEN 648
            +DL +  + ++E +    + K   L  N I KI+ L + + L++L +  NQI ++  L +L+ L  LD+S N +  I+ ++ L  L  L L +N+I  I +LE    L+ L+L  N I  I N+  L+ L +  +  N+I  L  +D   N+S  +LS+  N+I   T+I  L +L NLK+L +  N
Sbjct:  106 VDLVHCRIGKIEGLEVLQKAKTLSLRQNLIKKIENLESLSSLRELDLYDNQIRKLENLDNLTELEQLDVSFNILRKIENLERLTQLKKLFLVHNKITGIANLEHFSFLEMLELGSNRIRVIENLDGLTSLTSLFLGTNKINKLQNLDALHNLS--VLSIQSNRI---TKIEGLQNLVNLKELYLSHN 287          

HSP 3 Score: 66.6254 bits (161), Expect = 3.017e-11
Identity = 60/210 (28.57%), Postives = 104/210 (49.52%), Query Frame = 1
Query:   52 GISKYQRSEIMTIKIDLSNLGLKEVETINDRPKVFILN--SNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNI--------SIEI------------LSLAENQIHDLTEISYLHSL 615
            G+   Q+++ ++++ +L    +K++E +     +  L+   N+I K++ L   T+L+QL +S N + +I  L  L+ L  L L HNKI  I  ++  + L  L L +NRI+ IE+L+G   L  L L  N I K+ N+  L  L    +  NRIT +  +   +N+         IE+            L +A N++  +  IS+L  L
Sbjct:  118 GLEVLQKAKTLSLRQNL----IKKIENLESLSSLRELDLYDNQIRKLENLDNLTELEQLDVSFNILRKIENLERLTQLKKLFLVHNKITGIANLEHFSFLEMLELGSNRIRVIENLDGLTSLTSLFLGTNKINKLQNLDALHNLSVLSIQSNRITKIEGLQNLVNLKELYLSHNGIEVIEGLENNKKLTTLDIAANRVKKIENISHLTEL 323          
BLAST of CEP97 vs. Ensembl Medaka
Match: drc3 (dynein regulatory complex subunit 3 [Source:NCBI gene;Acc:101162841])

HSP 1 Score: 68.5514 bits (166), Expect = 1.509e-11
Identity = 56/167 (33.53%), Postives = 86/167 (51.50%), Query Frame = 1
Query:   85 TIKIDL----SNLGLKEVETINDRPKVFILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFL---MHGNRIT-----SLYRIDLFLNISI 549
            +IK DL     N+ L E + I        L    I +ID L  +T L +L ++ N I +I GL  L NLT L+LS N+I  I G+ SL  L  LNLSNN+I  IE+++    L H  +  NL+ ++ N+ +L + K  +   M GN  +       + +  F N+++
Sbjct:   21 SIKSDLMSKEDNICLPEADVIK-------LEYQNIQRIDSLQEYTSLVRLDLNNNLIKKIQGLDSLINLTWLNLSFNRIEKIQGLTSLQKLKVLNLSNNQITVIENMDTLDNLTHFFIGCNLLNQLENVLYLKRFKKLVHIYMKGNLFSNEDDYQFFIVAFFPNLTV 180          
BLAST of CEP97 vs. Ensembl Medaka
Match: drc3 (dynein regulatory complex subunit 3 [Source:NCBI gene;Acc:101162841])

HSP 1 Score: 67.781 bits (164), Expect = 2.198e-11
Identity = 47/133 (35.34%), Postives = 74/133 (55.64%), Query Frame = 1
Query:  175 ITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFL---MHGNRIT-----SLYRIDLFLNISI 549
            I +ID L  +T L +L ++ N I +I GL  L NLT L+LS N+I  I G+ SL  L  LNLSNN+I  IE+++    L H  +  NL+ ++ N+ +L + K  +   M GN  +       + +  F N+++
Sbjct:   36 IQRIDSLQEYTSLVRLDLNNNLIKKIQGLDSLINLTWLNLSFNRIEKIQGLTSLQKLKVLNLSNNQITVIENMDTLDNLTHFFIGCNLLNQLENVLYLKRFKKLVHIYMKGNLFSNEDDYQFFIVAFFPNLTV 168          
BLAST of CEP97 vs. Planmine SMEST
Match: SMESG000041551.1 (SMESG000041551.1)

HSP 1 Score: 1205.28 bits (3117), Expect = 0.000e+0
Identity = 682/685 (99.56%), Postives = 683/685 (99.71%), Query Frame = 1
Query:   82 MTIKIDLSNLGLKEVETINDRPKVFILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKENPCLMKSSSEMEFDYRPYIINWCIDLKILDGEEINEKEKLIAEWLYTQGKGRIYKPGDHFELVNYLTKDCAFTXXXXXXXXXXXXXXXXEQRKQLSSRKILSSRTNNNESDKDTIKFXXXXXXXXXXXXDDTDLNVSISLSANGNDTTNTSLLISDSLFLPIKPVNQXXXXXXXXXXVIRQKSNSIDSSYVPILKFSKENPKLCSKNTSKSILNSSLDESNSVVNDISYTKKDLFIRKYREESKNNVLPDQSNNSNSEQSKIKLNKIINSVIRIQAWWRSISTRLKNPIVRRYLSGREANRTRSHILFLQKQMQLYYESYEQQRKLNISQNQAIQFLLDQVKELTIWKEKFENDXXXXXXXXXXXXXXXXXXXTQFSQDINESVKEQLLNKIDNLEEQVTTLKESMWKIETAVHLYDENSRNDQNSPXXXXXXXXXXGDLNRVIYEVEKIYRNGTGKHSSNELESDNESFPMNDEKLQTLRHIDNAPANSSEIQDDK 2136
            MTIKIDLSNLGLKEVETINDRPKVFILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKENPCLMKSSSEMEFDYRPYIINWCIDLKILDGEEINEKEKLIAEWLYTQGKGRIYKPGDHFELVNYLTKDCAFTNLKNKSKLKNDLDNILEQRKQLSSRKILSSRTNNNESDKDT KFSSSKSRKLSNNLDDTDLNVSISLSANGNDTTNTSLLISDSLFLPIKPVNQSPSPKKSISPVIRQKSNSIDSSYVPILKFSKENPKLCSKNTSKSILNSSLDESNSVVNDISYTKKDLFIRKYREESKN VLPDQSNNSNSEQSKIKLNKIINSVIRIQAWWRSISTRLKNPIVRRYLSGREANRTRSHILFLQKQMQLYYESYEQQRKLNISQNQAIQFLLDQVKELTIWKEKFENDNKSQNSNKKETNESKKEISTQFSQDINESVKEQLLNKIDNLEEQVTTLKESMWKIETAVHLYDENSRNDQNSPIISESICSEEGDLNRVIYEVEKIYRNGTGKHSSNELESDNESFPMNDE+LQTLRHIDNAPANSSEIQDDK
Sbjct:    1 MTIKIDLSNLGLKEVETINDRPKVFILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKENPCLMKSSSEMEFDYRPYIINWCIDLKILDGEEINEKEKLIAEWLYTQGKGRIYKPGDHFELVNYLTKDCAFTNLKNKSKLKNDLDNILEQRKQLSSRKILSSRTNNNESDKDTTKFSSSKSRKLSNNLDDTDLNVSISLSANGNDTTNTSLLISDSLFLPIKPVNQSPSPKKSISPVIRQKSNSIDSSYVPILKFSKENPKLCSKNTSKSILNSSLDESNSVVNDISYTKKDLFIRKYREESKNKVLPDQSNNSNSEQSKIKLNKIINSVIRIQAWWRSISTRLKNPIVRRYLSGREANRTRSHILFLQKQMQLYYESYEQQRKLNISQNQAIQFLLDQVKELTIWKEKFENDNKSQNSNKKETNESKKEISTQFSQDINESVKEQLLNKIDNLEEQVTTLKESMWKIETAVHLYDENSRNDQNSPIISESICSEEGDLNRVIYEVEKIYRNGTGKHSSNELESDNESFPMNDEELQTLRHIDNAPANSSEIQDDK 685          
BLAST of CEP97 vs. Planmine SMEST
Match: SMESG000026105.1 (SMESG000026105.1)

HSP 1 Score: 73.9442 bits (180), Expect = 7.101e-14
Identity = 53/129 (41.09%), Postives = 77/129 (59.69%), Query Frame = 1
Query:  160 LNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNL-QLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNI 543
            L SN I +I+ L + T+L QL +  N+I ++  L  + NLTVL +  N+I  IDG+ +L  L  L LS+N I  IE+L GNL +L  LDLS N I+K+ N+S L  L+ F  + N +     ID  +N+
Sbjct:  142 LGSNSIKRIENLDSLTKLDQLYLGKNKISKLENLDFMKNLTVLSIQGNRITQIDGLDNLINLEQLYLSHNGISKIENL-GNLTKLTTLDLSSNRISKVENLSHLKILEEFWFNDNNLADWNSIDELVNL 269          

HSP 2 Score: 67.3958 bits (163), Expect = 8.568e-12
Identity = 58/170 (34.12%), Postives = 90/170 (52.94%), Query Frame = 1
Query:  115 LKEVETINDRPKVFILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNL 624
            ++ +ETI++  +   L  N+ITKI+ L     L  L +S N+I  I  +  L  LT L   +NKI +I+ + SL  +  L L +N IK IE+L+   +L  L L  N I+K+ N+ F+  L    + GNRIT +  +D  +N  +E L L+ N I  +  +  L  L  L
Sbjct:   61 IENLETISETLEELDLYDNQITKIENLDKLVNLSILDLSFNRIKLIENIDKLIKLTKLYFVNNKIRTIENLNSLVNIEMLELGSNSIKRIENLDSLTKLDQLYLGKNKISKLENLDFMKNLTVLSIQGNRITQIDGLDNLIN--LEQLYLSHNGISKIENLGNLTKLTTL 228          
BLAST of CEP97 vs. Planmine SMEST
Match: SMESG000047633.1 (SMESG000047633.1)

HSP 1 Score: 70.4774 bits (171), Expect = 6.276e-13
Identity = 59/202 (29.21%), Postives = 99/202 (49.01%), Query Frame = 1
Query:  166 SNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKENPCLMKSSSEMEFDYRPYIINWCIDLKILDGEEINEKEKLIA 771
            + +I K + LS   ++Q L +S   I++++ L    NLT L L +N I  I G+  L  L WL+LS N I+ IE ++  + ++ L L +N I K+ N+  L +L                        ++LS+  N I DL  + YL +  +LK +++  NPC  K       ++R  ++ +   L  LD + INE+E+ I 
Sbjct:   31 AGQIAKAEGLS-FEKVQSLRLSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQL------------------------QVLSIGNNLIDDLNNLKYLRTFKSLKAINLSGNPCCEKD------EFRVVVLAYLPQLIYLDYKLINEEERKIC 201          

HSP 2 Score: 64.3142 bits (155), Expect = 7.752e-11
Identity = 44/109 (40.37%), Postives = 65/109 (59.63%), Query Frame = 1
Query:  160 LNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTF 486
            L+   I ++D L     L +L +  N I +I+GL+HL +L  LDLS N I  I+GI SL  +  L L NNRIK +E+LE   QL+ L + +NLI  ++N+ +L   K+ 
Sbjct:   50 LSYKNILEVDNLWWFKNLTKLQLDNNIIEKISGLNHLISLKWLDLSFNNIEIIEGIDSLVNIEDLTLFNNRIKKMENLEHLKQLQVLSIGNNLIDDLNNLKYLRTFKSL 158          
BLAST of CEP97 vs. Planmine SMEST
Match: SMESG000011491.1 (SMESG000011491.1)

HSP 1 Score: 65.0846 bits (157), Expect = 1.582e-10
Identity = 69/228 (30.26%), Postives = 101/228 (44.30%), Query Frame = 1
Query:  145 PKVFILNSNKITKIDKLSTHTQLQQLSISGNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDLFLNIS----------------------IEILSLAENQIHDLTEISYLHSLFNLKQLSIKENPCLMKSSSEMEFDYRPYIINWCIDLKILDGEEINEKEK 762
            P    L+   +T    L     L+ L+   N I QI  L  L  L +LDL  N+I  I G+++L  L  L L  NRI  IE LE   +L  LDL  N I  I NI+ LS L+   + GN IT L  +    ++S                      ++ + L+ N +  +++ S L  L +L +LSI  NP     SS      R  +I     L +LD ++I E ++
Sbjct:  101 PDRISLDRQNLTSCPILENEENLRLLNYQYNYINQIQHLDKLRKLILLDLYDNRIERISGLETLKSLRVLMLGRNRISKIEGLESLTRLDVLDLHANSIQVIENINHLSDLRVLNLAGNVITCLTNLRGLYSLSEVNIRRNCVESVIDINSTNCPNLQRIFLSFNHLGRISDFSCLIDLGSLNELSIDNNPISSNGSS------RSAVIFNFPQLNLLDTKQITEDDR 322          
BLAST of CEP97 vs. Planmine SMEST
Match: SMESG000004118.1 (SMESG000004118.1)

HSP 1 Score: 64.3142 bits (155), Expect = 2.623e-10
Identity = 56/183 (30.60%), Postives = 89/183 (48.63%), Query Frame = 1
Query:  250 INGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKNIEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRI-DLFLNISIEILSLAENQIHDLTEISYLHS-LFNLKQLSIKENPCLMKSSSEMEFDYRPYIINWCIDLKILDGEEINEKEKLIAEWLYTQG 792
            I  L     L  L L  N I  I+ ++ L  L  L LS N I  IE++   + L  +DLS NL+ KI N+  L K    ++  N++  +  + +L    +I +L L  NQI D   I  + + + +L+ L ++ N   MK+      +YR ++IN C +L  LD   + EK++  AE     G
Sbjct:  194 IENLDEYVGLRCLFLETNGISKIENLEMLTELRCLYLSKNLISRIENIATLVNLDSIDLSHNLVAKIENLRNLPKFTKLILAHNKVQKISDLEELIYCDNISVLDLQHNQIDDPNVIEEIFAKMKSLRVLYLQGNQ-FMKNVK----NYRKHVINLCKNLTYLDERPVFEKDRACAEAFCRGG 371          
The following BLAST results are available for this feature:
BLAST of CEP97 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CEP974.381e-7050.00centrosomal protein 97 [Source:HGNC Symbol;Acc:HGN... [more]
CEP971.285e-6950.00centrosomal protein 97 [Source:HGNC Symbol;Acc:HGN... [more]
CEP977.739e-4846.24centrosomal protein 97 [Source:HGNC Symbol;Acc:HGN... [more]
PPP1R72.091e-1635.50protein phosphatase 1 regulatory subunit 7 [Source... [more]
PPP1R72.627e-1635.50protein phosphatase 1 regulatory subunit 7 [Source... [more]
back to top
BLAST of CEP97 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
K10D2.82.671e-1636.20pep chromosome:WBcel235:III:5188726:5190175:1 gene... [more]
R02F11.42.668e-1529.58pep chromosome:WBcel235:V:4810865:4818663:-1 gene:... [more]
sds-221.181e-1434.78Protein phosphatase 1 regulatory subunit SDS22 hom... [more]
C06A8.62.817e-1439.42pep chromosome:WBcel235:II:7772499:7773914:1 gene:... [more]
slt-11.174e-632.30Slit homolog 1 protein [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of CEP97 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cep975.168e-5542.25gene:FBgn0031575 transcript:FBtr0077504[more]
sds221.378e-1634.17gene:FBgn0028992 transcript:FBtr0083436[more]
CG41681.789e-829.19gene:FBgn0028888 transcript:FBtr0305559[more]
CG41681.789e-829.19gene:FBgn0028888 transcript:FBtr0343105[more]
TbCMF465.034e-836.80gene:FBgn0032163 transcript:FBtr0079898[more]
back to top
BLAST of CEP97 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cep979.858e-6844.06centrosomal protein 97 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
cep976.323e-5342.98centrosomal protein 97 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
ppp1r72.007e-1238.03protein phosphatase 1, regulatory (inhibitor) subu... [more]
drc32.437e-1232.18dynein regulatory complex subunit 3 [Source:ZFIN;A... [more]
ppp1r424.064e-1134.65protein phosphatase 1, regulatory subunit 42 [Sour... [more]
back to top
BLAST of CEP97 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CEP971.140e-6045.00centrosomal protein 97kDa [Source:NCBI gene;Acc:77... [more]
CEP971.192e-6045.00centrosomal protein 97kDa [Source:NCBI gene;Acc:77... [more]
CEP971.249e-6045.59centrosomal protein 97kDa [Source:NCBI gene;Acc:77... [more]
CEP971.261e-6045.59centrosomal protein 97kDa [Source:NCBI gene;Acc:77... [more]
rbpms28.168e-1532.23RNA binding protein with multiple splicing 2 [Sour... [more]
back to top
BLAST of CEP97 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cep973.768e-6949.58centrosomal protein 97 [Source:MGI Symbol;Acc:MGI:... [more]
Cep976.489e-6252.22centrosomal protein 97 [Source:MGI Symbol;Acc:MGI:... [more]
Cep976.489e-6252.22centrosomal protein 97 [Source:MGI Symbol;Acc:MGI:... [more]
Cep973.350e-1942.20centrosomal protein 97 [Source:MGI Symbol;Acc:MGI:... [more]
Cep973.665e-1941.82centrosomal protein 97 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of CEP97 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9CZ62|CEP97_MOUSE2.635e-6849.58Centrosomal protein of 97 kDa OS=Mus musculus OX=1... [more]
sp|Q8IW35|CEP97_HUMAN3.723e-6850.00Centrosomal protein of 97 kDa OS=Homo sapiens OX=9... [more]
sp|Q6GPJ8|CEP97_XENLA9.142e-6045.21Centrosomal protein of 97 kDa OS=Xenopus laevis OX... [more]
sp|Q0P5X1|LRIQ1_MOUSE2.583e-1629.50Leucine-rich repeat and IQ domain-containing prote... [more]
sp|Q3T0W4|PP1R7_BOVIN5.156e-1634.76Protein phosphatase 1 regulatory subunit 7 OS=Bos ... [more]
back to top
BLAST of CEP97 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H6WA360.000e+099.42CEP97 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1[more]
A0A096M7031.273e-8431.95Centrosomal protein 97 OS=Poecilia formosa OX=4869... [more]
A0A3B3VY026.336e-8432.64Centrosomal protein 97 OS=Poecilia latipinna OX=48... [more]
I3K9Y52.341e-8330.84Centrosomal protein 97 OS=Oreochromis niloticus OX... [more]
A0A3B4A9393.241e-8032.50Centrosomal protein 97 OS=Periophthalmus magnuspin... [more]
back to top
BLAST of CEP97 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cep971.204e-3154.84centrosomal protein 97 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
drc35.911e-1431.87dynein regulatory complex subunit 3 [Source:ZFIN;A... [more]
ppp1r71.044e-1339.84protein phosphatase 1 regulatory subunit 7 [Source... [more]
lrguk5.554e-1328.03leucine rich repeats and guanylate kinase domain c... [more]
ENSAMXT00000021515.28.968e-1230.45leucine rich repeat containing 49 [Source:NCBI gen... [more]
back to top
BLAST of CEP97 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cep971.602e-7143.35centrosomal protein 97 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
ppp1r76.373e-1632.45protein phosphatase 1, regulatory (inhibitor) subu... [more]
LRRC496.045e-1530.80leucine rich repeat containing 49 [Source:HGNC Sym... [more]
ENSPMAT00000006793.15.596e-1131.40pep scaffold:Pmarinus_7.0:GL478186:28720:41038:-1 ... [more]
ENSPMAT00000004940.12.194e-832.20pep scaffold:Pmarinus_7.0:GL476356:339323:347865:-... [more]
back to top
BLAST of CEP97 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SDS224.545e-838.00Regulatory subunit of the type 1 protein phosphata... [more]
back to top
BLAST of CEP97 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO352991.051e-1842.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO386904.573e-1531.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO449377.691e-1535.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO457711.960e-1432.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380713.225e-1231.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of CEP97 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cep975.589e-4653.42centrosomal protein 97 [Source:NCBI gene;Acc:10115... [more]
ppp1r74.881e-1438.03protein phosphatase 1 regulatory subunit 7 [Source... [more]
ppp1r71.614e-1338.03protein phosphatase 1 regulatory subunit 7 [Source... [more]
drc31.509e-1133.53dynein regulatory complex subunit 3 [Source:NCBI g... [more]
drc32.198e-1135.34dynein regulatory complex subunit 3 [Source:NCBI g... [more]
back to top
BLAST of CEP97 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000041551.10.000e+099.56SMESG000041551.1[more]
SMESG000026105.17.101e-1441.09SMESG000026105.1[more]
SMESG000047633.16.276e-1329.21SMESG000047633.1[more]
SMESG000011491.11.582e-1030.26SMESG000011491.1[more]
SMESG000004118.12.623e-1030.60SMESG000004118.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30022009
GenBankAFB74718.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30022009 ID=SMED30022009|Name=CEP97|organism=Schmidtea mediterranea sexual|type=transcript|length=2347bp
ATGTGAACTTACTTTGTTTAAAATATCCAAAATTTATTTGTATTAGCAGC
AGGTATTTCAAAATATCAACGGAGTGAAATAATGACAATCAAAATTGATT
TAAGTAATCTAGGGTTGAAAGAAGTTGAGACTATTAATGATAGACCTAAA
GTATTTATTCTCAATTCAAATAAAATAACAAAAATTGATAAACTGTCAAC
ACATACACAATTACAACAGTTATCAATTAGTGGAAATCAAATTATTCAAA
TTAATGGTCTATCTCATTTATCCAATTTAACAGTTCTTGATTTGTCACAC
AACAAAATAATTAGTATTGATGGTATTAAAAGCCTTAACATGCTGACATG
GTTAAATCTTTCAAATAACAGAATAAAAAATATTGAACATTTAGAAGGCA
ATTTGCAGTTGAAACATCTAGATTTGTCAGATAACTTAATTACAAAAATT
TCCAATATTTCGTTCCTAAGCAAATTGAAGACTTTTCTTATGCACGGAAA
CAGAATTACGAGTCTATATAGGATCGATTTATTTTTAAACATATCGATTG
AAATTTTGTCACTTGCTGAAAATCAAATTCACGATTTAACGGAGATTTCA
TATCTTCATTCGTTATTTAATTTGAAACAGTTATCAATTAAAGAAAATCC
ATGCTTAATGAAATCTTCAAGTGAAATGGAATTTGACTATCGTCCATACA
TTATTAATTGGTGTATCGATTTGAAAATTCTTGATGGAGAAGAGATAAAC
GAGAAAGAGAAATTGATTGCTGAATGGTTATATACGCAAGGTAAAGGAAG
GATTTATAAGCCCGGAGATCATTTCGAGCTCGTTAATTATTTAACCAAGG
ATTGTGCATTTACCAATCTCAAGAACAAATCAAAATTGAAAAATGATTTA
GACAATATTCTAGAGCAGAGAAAGCAACTTTCGTCCAGGAAGATTCTTTC
TTCTCGTACAAATAATAATGAATCTGATAAAGATACGATTAAGTTTTCCA
GTTCAAAATCGAGAAAACTTTCAAATAACCTTGATGATACAGATTTAAAT
GTGTCCATTTCTCTGAGTGCGAATGGCAATGACACTACCAATACAAGTTT
GCTCATATCAGATAGTTTGTTTCTGCCCATTAAACCAGTAAATCAATCTC
CAAGTCCGAAAAAATCAATTTCTCCCGTAATTAGACAAAAATCCAATTCA
ATTGACTCCTCTTACGTTCCAATATTAAAATTCTCCAAAGAAAATCCCAA
GCTCTGCTCAAAAAATACCTCGAAATCCATTTTAAATTCCTCTCTTGATG
AATCCAATTCGGTGGTCAATGATATATCATACACAAAGAAAGATTTGTTT
ATCAGAAAATATAGAGAAGAATCAAAAAATAACGTTTTACCCGATCAATC
AAATAACAGTAACTCAGAACAAAGCAAAATTAAACTTAATAAAATCATAA
ATAGTGTTATTCGAATTCAGGCGTGGTGGAGAAGCATTTCAACAAGATTA
AAGAATCCTATTGTGAGACGGTATTTAAGTGGCCGCGAAGCAAACCGTAC
TCGGTCTCATATTTTATTTTTACAAAAACAAATGCAGCTTTATTATGAAA
GTTATGAACAGCAAAGGAAACTTAATATTTCTCAAAATCAAGCCATTCAA
TTCTTACTTGATCAGGTTAAAGAACTTACTATATGGAAAGAGAAATTCGA
AAATGATAACAAATCTCAAAATTCAAATAAAAAAGAAACTAATGAATCGA
AAAAAGAAATTAGTACACAATTTTCTCAGGATATAAACGAATCTGTCAAA
GAGCAACTGTTGAATAAAATAGACAATCTTGAAGAACAAGTCACTACTTT
GAAAGAATCTATGTGGAAAATTGAAACGGCAGTGCATCTCTATGATGAAA
ATAGTAGAAATGATCAAAATTCACCTATAATTTCAGAATCAATCTGTTCT
GAAGAGGGAGACTTAAACAGAGTTATTTACGAAGTAGAAAAAATATACAG
AAACGGTACAGGAAAACATTCATCGAATGAGTTGGAATCCGACAACGAAA
GTTTTCCAATGAACGATGAAAAATTACAAACTCTGAGACATATTGACAAT
GCTCCTGCAAATAGCTCAGAAATTCAAGATGATAAATAACAATTTACTTT
CAGCATTTTTACTTTTTATAAACGGAATTTTATAATAAAAATAAAATTGT
TGAATTTTTGTTTTATGCAAATTATTTAGATTAAGATAATAAATTTCAAC
TCTTGAAATGGCGTCCAGTCACTGCGTTTCAAATTGTTGTTGTGAAATGT
TATTATAATTGAACGGTTCTTGTTTTGCTTATTATTTTTCTAGTAGC
back to top

protein sequence of SMED30022009-orf-1

>SMED30022009-orf-1 ID=SMED30022009-orf-1|Name=SMED30022009-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=686bp
MTIKIDLSNLGLKEVETINDRPKVFILNSNKITKIDKLSTHTQLQQLSIS
GNQIIQINGLSHLSNLTVLDLSHNKIISIDGIKSLNMLTWLNLSNNRIKN
IEHLEGNLQLKHLDLSDNLITKISNISFLSKLKTFLMHGNRITSLYRIDL
FLNISIEILSLAENQIHDLTEISYLHSLFNLKQLSIKENPCLMKSSSEME
FDYRPYIINWCIDLKILDGEEINEKEKLIAEWLYTQGKGRIYKPGDHFEL
VNYLTKDCAFTNLKNKSKLKNDLDNILEQRKQLSSRKILSSRTNNNESDK
DTIKFSSSKSRKLSNNLDDTDLNVSISLSANGNDTTNTSLLISDSLFLPI
KPVNQSPSPKKSISPVIRQKSNSIDSSYVPILKFSKENPKLCSKNTSKSI
LNSSLDESNSVVNDISYTKKDLFIRKYREESKNNVLPDQSNNSNSEQSKI
KLNKIINSVIRIQAWWRSISTRLKNPIVRRYLSGREANRTRSHILFLQKQ
MQLYYESYEQQRKLNISQNQAIQFLLDQVKELTIWKEKFENDNKSQNSNK
KETNESKKEISTQFSQDINESVKEQLLNKIDNLEEQVTTLKESMWKIETA
VHLYDENSRNDQNSPIISESICSEEGDLNRVIYEVEKIYRNGTGKHSSNE
LESDNESFPMNDEKLQTLRHIDNAPANSSEIQDDK*
back to top
Aliases
The feature 'CEP97' has the following synonyms
Synonym
CEP97
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005813centrosome
GO:0005829cytosol
GO:0032991macromolecular complex
GO:0034451centriolar satellite
GO:0005634nucleus
GO:0005694chromosome
GO:0070062extracellular exosome
Vocabulary: biological process
TermDefinition
GO:1901673regulation of mitotic spindle assembly
GO:1902018negative regulation of cilium assembly
GO:0007059chromosome segregation
GO:0035307positive regulation of protein dephosphorylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
Vocabulary: INTERPRO
TermDefinition
IPR025875Leu-rich_rpt_4
IPR003591Leu-rich_rpt_typical-subtyp
IPR032675LRR_dom_sf
IPR001611Leu-rich_rpt
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 536..556
NoneNo IPR availableCOILSCoilCoilcoord: 566..600
NoneNo IPR availableCOILSCoilCoilcoord: 266..286
NoneNo IPR availableSMARTSM00365LRR_sd22_2coord: 153..177
e-value: 500.0
score: 1.7
coord: 85..106
e-value: 64.0
score: 9.0
coord: 41..62
e-value: 0.94
score: 18.5
coord: 129..150
e-value: 320.0
score: 3.3
coord: 107..128
e-value: 0.0015
score: 27.8
coord: 19..40
e-value: 220.0
score: 4.6
coord: 63..84
e-value: 0.04
score: 23.1
NoneNo IPR availablePFAMPF14580LRR_9coord: 91..239
e-value: 1.8E-15
score: 56.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 542..558
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 542..561
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 287..312
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 293..307
NoneNo IPR availablePANTHERPTHR45973:SF2CENTROSOMAL PROTEIN OF 97 KDAcoord: 5..299
NoneNo IPR availablePANTHERPTHR45973:SF2CENTROSOMAL PROTEIN OF 97 KDAcoord: 380..656
NoneNo IPR availablePANTHERPTHR45973FAMILY NOT NAMEDcoord: 5..299
NoneNo IPR availablePANTHERPTHR45973FAMILY NOT NAMEDcoord: 380..656
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 23..229
IPR003591Leucine-rich repeat, typical subtypeSMARTSM00369LRR_typ_2coord: 63..84
e-value: 21.0
score: 10.5
coord: 109..130
e-value: 74.0
score: 6.2
coord: 85..108
e-value: 30.0
score: 9.3
IPR025875Leucine rich repeat 4PFAMPF12799LRR_4coord: 42..83
e-value: 4.3E-7
score: 30.2
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 153..229
e-value: 6.3E-13
score: 50.2
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 1..152
e-value: 4.8E-29
score: 102.6
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 87..108
score: 9.044
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 131..152
score: 5.602
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 155..176
score: 7.242
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 109..130
score: 10.084
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 65..86
score: 9.799
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 21..42
score: 5.486
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 43..64
score: 8.351