Si:dkey-23f9.4

Overview
NameSi:dkey-23f9.4
Smed IDSMED30021990
Length (bp)1062
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Si:dkey-23f9.4 (SMED30021990) t-SNE clustered cells

Violin plots show distribution of expression levels for Si:dkey-23f9.4 (SMED30021990) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Si:dkey-23f9.4 (SMED30021990) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Si:dkey-23f9.4 (SMED30021990) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021990

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30021990SMESG000064423.1 SmedASXL_010578SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30021990SMESG000064423.1 dd_Smed_v6_13289_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30021990SMESG000064423.1 dd_Smed_v4_13289_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Si:dkey-23f9.4 vs. Ensembl Human
Match: HYLS1 (HYLS1 centriolar and ciliogenesis associated [Source:HGNC Symbol;Acc:HGNC:26558])

HSP 1 Score: 73.1738 bits (178), Expect = 5.066e-14
Identity = 66/202 (32.67%), Postives = 88/202 (43.56%), Query Frame = 3
Query:  423 MKRKTCRKRNSSNT----EDFISEPCTSRTYDSQNCANNNENYFRKVKFPQDP-----VDDIFN----YTGISIDPNDLSAHNNLPKRP---------SSKTSFIKPNLHRCDNIWQRHDPVSRYHSYKAAWNQKKAPGESPHKELRWAVKAAMMVKEVPKPRVAKVNSSRNQNLYVP-----PGENKRSNLRWQIRQELAN 947
            MKRK  R++         E  ISE   S T + Q+  +  +     V+F +D      V   FN    Y GIS D    S        P         S   SFI P L +      + D V+RY  YK  W+  + PGE   KELRW V+  M+ +  P+        S+ Q++YVP     P E KRS LRW +R +LAN
Sbjct:   94 MKRKVLRRKPDGEVLVTDESIISE-SESGTENDQDLWDLRQRLM-NVQFQEDKESSFDVSQKFNLPHEYQGISQDQLICSLQREGMGSPAYEQDLIVASRPKSFILPKLDQLSRNRGKTDRVARYFEYKRDWDSIRLPGEDHRKELRWGVREQMLCRAEPQ--------SKPQHIYVPNNYLVPTEKKRSALRWGVRCDLAN 285          
BLAST of Si:dkey-23f9.4 vs. Ensembl Human
Match: HYLS1 (HYLS1 centriolar and ciliogenesis associated [Source:HGNC Symbol;Acc:HGNC:26558])

HSP 1 Score: 73.1738 bits (178), Expect = 5.066e-14
Identity = 66/202 (32.67%), Postives = 88/202 (43.56%), Query Frame = 3
Query:  423 MKRKTCRKRNSSNT----EDFISEPCTSRTYDSQNCANNNENYFRKVKFPQDP-----VDDIFN----YTGISIDPNDLSAHNNLPKRP---------SSKTSFIKPNLHRCDNIWQRHDPVSRYHSYKAAWNQKKAPGESPHKELRWAVKAAMMVKEVPKPRVAKVNSSRNQNLYVP-----PGENKRSNLRWQIRQELAN 947
            MKRK  R++         E  ISE   S T + Q+  +  +     V+F +D      V   FN    Y GIS D    S        P         S   SFI P L +      + D V+RY  YK  W+  + PGE   KELRW V+  M+ +  P+        S+ Q++YVP     P E KRS LRW +R +LAN
Sbjct:   94 MKRKVLRRKPDGEVLVTDESIISE-SESGTENDQDLWDLRQRLM-NVQFQEDKESSFDVSQKFNLPHEYQGISQDQLICSLQREGMGSPAYEQDLIVASRPKSFILPKLDQLSRNRGKTDRVARYFEYKRDWDSIRLPGEDHRKELRWGVREQMLCRAEPQ--------SKPQHIYVPNNYLVPTEKKRSALRWGVRCDLAN 285          
BLAST of Si:dkey-23f9.4 vs. Ensembl Human
Match: HYLS1 (HYLS1 centriolar and ciliogenesis associated [Source:HGNC Symbol;Acc:HGNC:26558])

HSP 1 Score: 73.1738 bits (178), Expect = 5.066e-14
Identity = 66/202 (32.67%), Postives = 88/202 (43.56%), Query Frame = 3
Query:  423 MKRKTCRKRNSSNT----EDFISEPCTSRTYDSQNCANNNENYFRKVKFPQDP-----VDDIFN----YTGISIDPNDLSAHNNLPKRP---------SSKTSFIKPNLHRCDNIWQRHDPVSRYHSYKAAWNQKKAPGESPHKELRWAVKAAMMVKEVPKPRVAKVNSSRNQNLYVP-----PGENKRSNLRWQIRQELAN 947
            MKRK  R++         E  ISE   S T + Q+  +  +     V+F +D      V   FN    Y GIS D    S        P         S   SFI P L +      + D V+RY  YK  W+  + PGE   KELRW V+  M+ +  P+        S+ Q++YVP     P E KRS LRW +R +LAN
Sbjct:   94 MKRKVLRRKPDGEVLVTDESIISE-SESGTENDQDLWDLRQRLM-NVQFQEDKESSFDVSQKFNLPHEYQGISQDQLICSLQREGMGSPAYEQDLIVASRPKSFILPKLDQLSRNRGKTDRVARYFEYKRDWDSIRLPGEDHRKELRWGVREQMLCRAEPQ--------SKPQHIYVPNNYLVPTEKKRSALRWGVRCDLAN 285          
BLAST of Si:dkey-23f9.4 vs. Ensembl Celegans
Match: hyls-1 (Hydrolethalus syndrome protein 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q95X94])

HSP 1 Score: 51.9878 bits (123), Expect = 2.137e-7
Identity = 20/45 (44.44%), Postives = 31/45 (68.89%), Query Frame = 3
Query:  705 QRHDPVSRYHSYKAAWNQKKAPGESPHKELRWAVKAAMMVKEVPK 839
            +++DPV+RYH YK+ W++  APGE     LRW V+  M+  +VP+
Sbjct:  207 KKYDPVTRYHFYKSEWDRHPAPGEMRRLSLRWKVREFMLRHDVPR 251          
BLAST of Si:dkey-23f9.4 vs. Ensembl Celegans
Match: hyls-1 (Hydrolethalus syndrome protein 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q95X94])

HSP 1 Score: 51.9878 bits (123), Expect = 2.137e-7
Identity = 20/45 (44.44%), Postives = 31/45 (68.89%), Query Frame = 3
Query:  705 QRHDPVSRYHSYKAAWNQKKAPGESPHKELRWAVKAAMMVKEVPK 839
            +++DPV+RYH YK+ W++  APGE     LRW V+  M+  +VP+
Sbjct:  207 KKYDPVTRYHFYKSEWDRHPAPGEMRRLSLRWKVREFMLRHDVPR 251          
BLAST of Si:dkey-23f9.4 vs. Ensembl Zebrafish
Match: si:dkey-23f9.4 (si:dkey-23f9.4 [Source:ZFIN;Acc:ZDB-GENE-141222-88])

HSP 1 Score: 70.8626 bits (172), Expect = 2.854e-13
Identity = 45/109 (41.28%), Postives = 59/109 (54.13%), Query Frame = 3
Query:  624 AHNNLPKRPSSKTSFIKPNL-HRCDNIWQRHDPVSRYHSYKAAWNQKKAPGESPHKELRWAVKAAMMVKEVPKPRVAKVNSSRNQNLYVPPGENKRSNLRWQIRQELAN 947
            +H+    RP  K SFI+P   H      ++ DPV++Y  YK  W   K PGE   KEL WA++  +M  + P PR  K     N   YV P E KRS LRW+IR +LA+
Sbjct:  231 SHSESDIRPRPK-SFIRPVFDHPHTRNLKKTDPVAKYLQYKQEWEMFKPPGEKSRKELHWAIREQLMY-QPPPPRPQKTFIPNN---YVVPTEKKRSALRWEIRHDLAH 334          
BLAST of Si:dkey-23f9.4 vs. Ensembl Zebrafish
Match: si:dkey-23f9.4 (si:dkey-23f9.4 [Source:ZFIN;Acc:ZDB-GENE-141222-88])

HSP 1 Score: 70.4774 bits (171), Expect = 4.661e-13
Identity = 45/109 (41.28%), Postives = 59/109 (54.13%), Query Frame = 3
Query:  624 AHNNLPKRPSSKTSFIKPNL-HRCDNIWQRHDPVSRYHSYKAAWNQKKAPGESPHKELRWAVKAAMMVKEVPKPRVAKVNSSRNQNLYVPPGENKRSNLRWQIRQELAN 947
            +H+    RP  K SFI+P   H      ++ DPV++Y  YK  W   K PGE   KEL WA++  +M  + P PR  K     N   YV P E KRS LRW+IR +LA+
Sbjct:  254 SHSESDIRPRPK-SFIRPVFDHPHTRNLKKTDPVAKYLQYKQEWEMFKPPGEKSRKELHWAIREQLMY-QPPPPRPQKTFIPNN---YVVPTEKKRSALRWEIRHDLAH 357          
BLAST of Si:dkey-23f9.4 vs. Ensembl Xenopus
Match: ENSXETT00000035138.1 (centriolar and ciliogenesis associated [Source:NCBI gene;Acc:101731869])

HSP 1 Score: 65.855 bits (159), Expect = 1.934e-11
Identity = 40/97 (41.24%), Postives = 49/97 (50.52%), Query Frame = 3
Query:  663 SFIKPNLHRC-DNIWQRHDPVSRYHSYKAAWNQKKAPGESPHKELRWAVKAAMM-VKEVPKPRVAKVNSSRNQNLYVPPGENKRSNLRWQIRQELAN 947
            SFI+P  +   D   QR DPV RY  YK  W+  +   E   KELRW ++  MM     P PR     S    N YV P + KR  LRW +RQ+L N
Sbjct:  233 SFIRPPPYSLLDQYRQRSDPVGRYQEYKQKWDALQVALERSRKELRWGIREQMMSAPPQPAPR-----SVPPPNTYVIPTDKKRYALRWAVRQDLVN 324          
BLAST of Si:dkey-23f9.4 vs. Ensembl Mouse
Match: Hyls1 (HYLS1, centriolar and ciliogenesis associated [Source:MGI Symbol;Acc:MGI:1924082])

HSP 1 Score: 68.9366 bits (167), Expect = 1.137e-12
Identity = 72/226 (31.86%), Postives = 101/226 (44.69%), Query Frame = 3
Query:  378 SSVATVTSLSPSSYK-----MKRKTCRKRNSSNT----EDFISEPCTSRTYDSQNCANNNENYFRKVKFPQD---PV--DDIFN----YTGIS-------------IDPNDLSAHNNLPKRPSSKTSFIKPNLHRCDNIWQRHDPVSRYHSYKAAWNQKKAPGESPHKELRWAVKAAMMVKEVPKPRVAKVNSSRNQNLYVP-----PGENKRSNLRWQIRQELAN 947
            +S  T +++S +S K     MKRK  R++         E  ISE C S T +S     +  + F  ++F +    PV     FN    Y GIS             +DP        +  RP S   FI P L +      + D V+RY  YK  W+  + PGE   KELRW+V+  M+ +  P         S+ Q++YVP     P E KRS LRW +R +LAN
Sbjct:   88 ASRVTSSTVSETSQKCRKPVMKRKVLRRKPDGEVLVTDESVISE-CESGT-ESDLGLWDLRHRFMNLQFQEGTESPVVTSQKFNLPCEYQGISQEDQLICYLQREEMDPPVYEQDLIVASRPKS---FILPRLDQLSRNRGKIDRVARYFEYKRDWDSMRFPGEDHRKELRWSVRGQMLSRTEP--------PSKPQHVYVPNNYLVPTEKKRSALRWGVRCDLAN 300          
BLAST of Si:dkey-23f9.4 vs. UniProt/SwissProt
Match: sp|Q96M11|HYLS1_HUMAN (Hydrolethalus syndrome protein 1 OS=Homo sapiens OX=9606 GN=HYLS1 PE=1 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 2.433e-13
Identity = 66/202 (32.67%), Postives = 88/202 (43.56%), Query Frame = 3
Query:  423 MKRKTCRKRNSSNT----EDFISEPCTSRTYDSQNCANNNENYFRKVKFPQDP-----VDDIFN----YTGISIDPNDLSAHNNLPKRP---------SSKTSFIKPNLHRCDNIWQRHDPVSRYHSYKAAWNQKKAPGESPHKELRWAVKAAMMVKEVPKPRVAKVNSSRNQNLYVP-----PGENKRSNLRWQIRQELAN 947
            MKRK  R++         E  ISE   S T + Q+  +  +     V+F +D      V   FN    Y GIS D    S        P         S   SFI P L +      + D V+RY  YK  W+  + PGE   KELRW V+  M+ +  P+        S+ Q++YVP     P E KRS LRW +R +LAN
Sbjct:   94 MKRKVLRRKPDGEVLVTDESIISE-SESGTENDQDLWDLRQRLM-NVQFQEDKESSFDVSQKFNLPHEYQGISQDQLICSLQREGMGSPAYEQDLIVASRPKSFILPKLDQLSRNRGKTDRVARYFEYKRDWDSIRLPGEDHRKELRWGVREQMLCRAEPQ--------SKPQHIYVPNNYLVPTEKKRSALRWGVRCDLAN 285          
BLAST of Si:dkey-23f9.4 vs. UniProt/SwissProt
Match: sp|Q4R2Y2|HYLS1_MACFA (Hydrolethalus syndrome protein 1 homolog OS=Macaca fascicularis OX=9541 GN=HYLS1 PE=2 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 4.374e-13
Identity = 65/202 (32.18%), Postives = 87/202 (43.07%), Query Frame = 3
Query:  423 MKRKTCRKRNSSNT----EDFISEPCTSRTYDSQNCANNNENYFRKVKFPQDP-----VDDIFN----YTGISIDPNDLSAHNNLPKRP---------SSKTSFIKPNLHRCDNIWQRHDPVSRYHSYKAAWNQKKAPGESPHKELRWAVKAAMMVKEVPKPRVAKVNSSRNQNLYVP-----PGENKRSNLRWQIRQELAN 947
            MKRK  R++         E  ISE   S T + Q   +  +     V+F +D      +   FN    Y GIS D    S        P         S   SFI P L +      + D V+RY  YK  W+  + PGE   KELRW V+  M+ +  P+        S+ Q++YVP     P E KRS LRW +R +LAN
Sbjct:   94 MKRKVLRRKPDGEVLVTDESIISE-SESGTENDQGLWDLRQRLM-NVQFQEDKESSFDISQKFNPPHEYQGISQDQLICSLQREGMGSPAYEQDLIVASRPKSFILPKLDQLSRNRGKTDRVARYFEYKRDWDSIRLPGEDHRKELRWGVREQMLCRAEPQ--------SKPQHIYVPNNYLVPTEKKRSALRWGVRCDLAN 285          
BLAST of Si:dkey-23f9.4 vs. UniProt/SwissProt
Match: sp|A0A1L8ER70|HYLS1_XENLA (Hydrolethalus syndrome protein 1 homolog OS=Xenopus laevis OX=8355 GN=hyls-1 PE=1 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 2.355e-11
Identity = 39/96 (40.62%), Postives = 50/96 (52.08%), Query Frame = 3
Query:  663 SFIKPNLHRC-DNIWQRHDPVSRYHSYKAAWNQKKAPGESPHKELRWAVKAAMMVKEVPKPRVAKVNSSRNQNLYVPPGENKRSNLRWQIRQELAN 947
            SFI+P L+   D   QR DPV RY  YK  W+  +   E   KELRW ++  MM    P+P    V      N YV P + KR  LRW +R++L N
Sbjct:  231 SFIRPPLYSLLDQYRQRSDPVGRYQEYKQKWDALQGALERNRKELRWGIREQMM-SAPPQPAARSVLLP---NTYVIPTDKKRYALRWAVRRDLVN 322          
BLAST of Si:dkey-23f9.4 vs. UniProt/SwissProt
Match: sp|Q2KI52|HYLS1_BOVIN (Hydrolethalus syndrome protein 1 homolog OS=Bos taurus OX=9913 GN=HYLS1 PE=2 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 3.334e-11
Identity = 38/100 (38.00%), Postives = 53/100 (53.00%), Query Frame = 3
Query:  663 SFIKPNLHRCDNIWQRHDPVSRYHSYKAAWNQKKAPGESPHKELRWAVKAAMMVKEVPKPRVAKVNSSRNQNLYVP-----PGENKRSNLRWQIRQELAN 947
            SFI P L +      + D V+RY  YK  W+  + PGE   KELRW ++  M+ +   +        S+ Q++YVP     P E KRS LRW +R +LAN
Sbjct:  208 SFILPRLDQLSRNRGKVDRVARYFEYKRDWDSMRLPGEDHRKELRWGIREQMLCRAEAQ--------SKPQHIYVPNNYLVPTEKKRSALRWGVRCDLAN 299          
BLAST of Si:dkey-23f9.4 vs. UniProt/SwissProt
Match: sp|Q9CXX0|HYLS1_MOUSE (Hydrolethalus syndrome protein 1 homolog OS=Mus musculus OX=10090 GN=Hyls1 PE=2 SV=2)

HSP 1 Score: 60.077 bits (144), Expect = 6.013e-9
Identity = 68/221 (30.77%), Postives = 97/221 (43.89%), Query Frame = 3
Query:  378 SSVATVTSLSPSSYK-----MKRKTCRKRNSSNT----EDFISEPCTSRTYDSQNCANNNENYFRKVKFPQD---PV--DDIFN----YTGIS-------------IDPNDLSAHNNLPKRPSSKTSFIKPNLHRCDNIWQRHDPVSRYHSYKAAWNQKKAPGESPHKELRWAVKAAMMVKEVPKPRVAKVNSSRNQNLYVPPGENKRSNLRWQIRQELAN 947
            +S  T +++S +S K     MKRK  R++         E  ISE C S T +S     +  + F  ++F +    PV     FN    Y GIS             +DP        +  RP S   FI P L +      + D V+RY  YK  W+  + PGE   KELRW+V+  M+ +  P         S+ Q++YVP   N    LRW +R +LAN
Sbjct:   88 ASRVTSSTVSETSQKCRKPVMKRKVLRRKPDGEVLVTDESVISE-CESGT-ESDLGLWDLRHRFMNLQFQEGTESPVVTSQKFNLPCEYQGISQEDQLICYLQREEMDPPVYEQDLIVASRPKS---FILPRLDQLSRNRGKIDRVARYFEYKRDWDSMRFPGEDHRKELRWSVRGQMLSRTEP--------PSKPQHVYVP--NNYLVPLRWGVRCDLAN 293          
BLAST of Si:dkey-23f9.4 vs. TrEMBL
Match: H2Z5A3 (HYLS1_C domain-containing protein OS=Ciona savignyi OX=51511 PE=4 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 5.452e-16
Identity = 73/235 (31.06%), Postives = 102/235 (43.40%), Query Frame = 3
Query:  321 ETNEWFIEGSNSEFDNDDGSSVATVTSLSPSSYKMKRKTCRKRNSSNTEDFISEPCTSRTYDSQNCANNNENYFRKVKFPQDPVDDIFNYTGISIDPND-----LSAHNNLPKRPSSK---------------------TSFIKPNLH--RCDNIWQRHDPVSRYHSYKAAWNQKKAPGESPHKELRWAVKAAMMVKEVPKPRVAKVNSSRNQNLYVPPGENKRSNLRWQIRQEL 941
            E ++W    +++  D+D   S     S+S      KRK  RK              T R Y+     +NN                ++   G S+D +D     +S H +LP RP++                       SFI+PN       N+ ++ DPV++YH YK  W+  KAPGE  HK LRW VKA MM KE P PR  +V +    N YV P   KRS LRW++R  +
Sbjct:   33 EPSQWTDHFTDTTMDSD--RSQTPDGSISSQKVIRKRKVLRKEIDG----------TPRVYNESLVEDNNR---------------MYRIQGRSLDDSDPSLSRVSPHISLPPRPNTARPMIKDHYRSVFEEFTNKQQPPSFIRPNTSNPHTRNL-KKVDPVNKYHQYKELWSNVKAPGEKSHKALRWEVKAQMMYKEEPAPRPQRVYAP---NTYVVPTSKKRSALRWEVRHAM 236          
BLAST of Si:dkey-23f9.4 vs. TrEMBL
Match: M4AIS9 (Si:dkey-23f9.4 OS=Xiphophorus maculatus OX=8083 PE=4 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 5.239e-14
Identity = 56/183 (30.60%), Postives = 87/183 (47.54%), Query Frame = 3
Query:  423 MKRKTCRKRNSSN--------TEDFISEPCTSRTYDSQNCANNNENYFRKVKFPQDPVDDIFNYTGISIDPNDLSAHNNLPKRPSSKTSFIKPNLHRCDNIWQRHDPVSRYHSYKAAWNQKKAPGESPHKELRWAVKAAMMVKEVPKPRVAKVNSSRNQNLYVPPGENKRSNLRWQIRQELAN 947
            +KRK  RKR   +        T+D     C        +  ++ ++Y       Q    D  ++T +     D+   ++   RP  K SFI+P +  C   ++++DPV+RY  YK  W+  + PG++  K LRW +K  +  + +PKPR   V      N Y  P + KRS LRW IR +LAN
Sbjct:  167 IKRKVLRKRKGKSFICSESIYTDDSDVSSCLEERMAELDLISDRKDYDADENNSQGSESDAVDFTALK-SYIDVVTQSDREVRPKPK-SFIRPVM--CQRAFKKNDPVTRYFQYKEMWDAFQVPGDNVRKALRWEIKEKLSFQPLPKPRRVYV-----PNTYTVPTQKKRSELRWTIRNDLAN 340          
BLAST of Si:dkey-23f9.4 vs. TrEMBL
Match: A0A2T7NXH6 (HYLS1_C domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_13532 PE=4 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 1.406e-13
Identity = 39/81 (48.15%), Postives = 53/81 (65.43%), Query Frame = 3
Query:  705 QRHDPVSRYHSYKAAWNQKKAPGESPHKELRWAVKAAMMVKEVPKPRVAKVNSSRNQNLYVPPGENKRSNLRWQIRQELAN 947
            +R DPV+RYH  K AW+ +KAPGE  HK LRW ++  M+V+E+P+ +  K+      N YV P E KRS L WQIR ++A 
Sbjct:  251 RRMDPVNRYHEMKQAWSLQKAPGEKLHKRLRWNIREQMLVQEIPEKKQHKIFVP---NSYVVPTEKKRSALCWQIRMDMAQ 328          
BLAST of Si:dkey-23f9.4 vs. TrEMBL
Match: H2XVG6 (hydrolethalus syndrome protein 1 homolog OS=Ciona intestinalis OX=7719 GN=LOC100179155 PE=4 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 6.408e-13
Identity = 44/98 (44.90%), Postives = 58/98 (59.18%), Query Frame = 3
Query:  663 SFIKP---NLHRCDNIWQRHDPVSRYHSYKAAWNQKKAPGESPHKELRWAVKAAMMVKEVPKPRVAKVNSSRNQNLYVPPGENKRSNLRWQIRQELAN 947
            SFI+P   N H  +   ++ DPV++YH YK  W+  KAPGE  H+ LRW VKA MM KE P P+  +V      N YV P   KRS LRW++R  + +
Sbjct:  260 SFIRPSTTNPHTRN--LKKVDPVNKYHQYKEFWSNIKAPGEKSHRNLRWEVKAQMMYKEEPAPKPQRVYVP---NTYVVPTSKKRSALRWEVRHAMEH 352          
BLAST of Si:dkey-23f9.4 vs. TrEMBL
Match: A0A3Q2YHZ9 (HYLS1_C domain-containing protein OS=Hippocampus comes OX=109280 PE=4 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 9.452e-13
Identity = 80/303 (26.40%), Postives = 122/303 (40.26%), Query Frame = 3
Query:  159 ENLNFSLDEIRQQLNLFGYSDIPVXXXXXXXXXXXXXXXXXTNLKSSTVTPRNRETNEWFIEGSNSE----------FDNDDGSSVATVTSLS------PSSYK-----------MKRKTCRKRNSSNTEDFISEPCTSRTYDSQNCANNNENYFRKVKFPQ----------DPVDDIFNYTGISIDPNDLSAHNNLPKRPSSKTSFIKPNLHRCDNIWQRHDPVSRYHSYKAAWNQKKAPGESPHKELRWAVKAAMMVKEVPKPRVAKVNSSRNQNLYVPPGENKRSNLRWQIRQELANPDV 956
            +NL+FS +EIRQQL L GY+D+P         D      K  + + +  T R  E    F   S+ E            N  G   A VTS        P +Y            +KRK  RKR   +        C    Y  ++ + +  +   +++  +          D V+ +   T + +     S  +   K  S K   + P + +   +W    P  RY  YK  W+Q K PGE  H+ELRW ++  +      +P   K   S   N YV P + KRS LRW++R  +A+P +
Sbjct:    2 DNLDFSEEEIRQQLALLGYADVP---------DRRLREFKRGDSRVARPTTRKPEDRPPFCARSDHENPLFPDLERLIQNGGGPDDAPVTSAGDRGEPGPPAYTEEKGDRFGRRFIKRKVLRKREGRSLV------CDESIYSQEDGSASLPDRLSQLRLGEAENHHAGVLSDSVEGVSLSTSM-VRTRSRSESDFRAKPKSCKLPPVSPGV-KDGQLWS---PPPRYFHYKQLWDQLKLPGERDHRELRWEIRERLAY----RPPAPKARRSLAANGYVIPTDKKRSALRWEVRSLMAHPHL 280          
BLAST of Si:dkey-23f9.4 vs. Ensembl Cavefish
Match: si:dkey-23f9.4 (HYLS1 centriolar and ciliogenesis associated [Source:NCBI gene;Acc:103038191])

HSP 1 Score: 71.2478 bits (173), Expect = 3.151e-13
Identity = 42/110 (38.18%), Postives = 62/110 (56.36%), Query Frame = 3
Query:  624 AHNNLPKRPSSKTSFIKPNL-HRCDNIWQRHDPVSRYHSYKAAWNQKKAPGESPHKELRWAVKAAMMVK-EVPKPRVAKVNSSRNQNLYVPPGENKRSNLRWQIRQELAN 947
            + N++ ++P +   FI+P + H      +++DPV++Y  YK  W   K PGE   KEL WA++  +M +   PKP+   V      N YV P E KRS LRW +R +LAN
Sbjct:  407 SENDIRQQPKA---FIRPAMDHPHTRNLKKNDPVAKYFQYKQDWEMFKPPGEKNRKELHWAIREQLMYQPPPPKPQRTYV-----PNTYVVPTEKKRSALRWAVRHDLAN 508          
BLAST of Si:dkey-23f9.4 vs. Ensembl Cavefish
Match: si:dkey-23f9.4 (HYLS1 centriolar and ciliogenesis associated [Source:NCBI gene;Acc:103038191])

HSP 1 Score: 69.707 bits (169), Expect = 5.329e-13
Identity = 40/97 (41.24%), Postives = 55/97 (56.70%), Query Frame = 3
Query:  663 SFIKPNL-HRCDNIWQRHDPVSRYHSYKAAWNQKKAPGESPHKELRWAVKAAMMVK-EVPKPRVAKVNSSRNQNLYVPPGENKRSNLRWQIRQELAN 947
            +FI+P + H      +++DPV++Y  YK  W   K PGE   KEL WA++  +M +   PKP+   V      N YV P E KRS LRW +R +LAN
Sbjct:  225 AFIRPAMDHPHTRNLKKNDPVAKYFQYKQDWEMFKPPGEKNRKELHWAIREQLMYQPPPPKPQRTYV-----PNTYVVPTEKKRSALRWAVRHDLAN 316          
BLAST of Si:dkey-23f9.4 vs. Ensembl Cavefish
Match: si:dkey-23f9.4 (HYLS1 centriolar and ciliogenesis associated [Source:NCBI gene;Acc:103038191])

HSP 1 Score: 70.0922 bits (170), Expect = 5.349e-13
Identity = 40/97 (41.24%), Postives = 55/97 (56.70%), Query Frame = 3
Query:  663 SFIKPNL-HRCDNIWQRHDPVSRYHSYKAAWNQKKAPGESPHKELRWAVKAAMMVK-EVPKPRVAKVNSSRNQNLYVPPGENKRSNLRWQIRQELAN 947
            +FI+P + H      +++DPV++Y  YK  W   K PGE   KEL WA++  +M +   PKP+   V      N YV P E KRS LRW +R +LAN
Sbjct:  264 AFIRPAMDHPHTRNLKKNDPVAKYFQYKQDWEMFKPPGEKNRKELHWAIREQLMYQPPPPKPQRTYV-----PNTYVVPTEKKRSALRWAVRHDLAN 355          
BLAST of Si:dkey-23f9.4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009660.1 (pep scaffold:Pmarinus_7.0:GL478031:10292:15688:1 gene:ENSPMAG00000008727.1 transcript:ENSPMAT00000009660.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.0922 bits (170), Expect = 2.008e-15
Identity = 35/77 (45.45%), Postives = 46/77 (59.74%), Query Frame = 3
Query:  714 DPVSRYHSYKAAWNQKKAPGESPHKELRWAVKAAMMVKEVPKPRVAKVNSSRNQNLYVPPGENKRSNLRWQIRQELA 944
            DPV++Y  YK  W   K PGE   K LRW ++  M+ KE P PR  +V +    N YV P E KRS LRW++R ++A
Sbjct:   13 DPVAKYFQYKQEWENFKPPGECNRKNLRWNIREHMLYKEEPLPRPQRVFAP---NTYVVPTEKKRSALRWEVRHDMA 86          
BLAST of Si:dkey-23f9.4 vs. Ensembl Nematostella
Match: EDO48640 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJ97])

HSP 1 Score: 71.2478 bits (173), Expect = 5.557e-14
Identity = 65/201 (32.34%), Postives = 87/201 (43.28%), Query Frame = 3
Query:  375 GSSVATVTSLSPSSYKM--KRKTCRKRNSSN---TEDFISEPCTSRTYDSQNCANNNENYFRKVKFPQDPVDDIFNYTGISIDPNDLSAHNNLPKRPSSKT--SFIKPNL-HRCDNIWQRHDPVSRYHSYKAAWNQKKAPGESPHKELRWAVKAAMMVKEV---PKPRVAKVNSSRNQNLYVPPGENKRSNLRWQIRQELA 944
             S  ++V        KM  KRK  R++N       E F S    S   D        E   R +     P+     Y  I  +P D         R +SK   S+I+P+  H      ++ DPV+RYH +K  W  +KAPGE     LRW V+  M+ +EV   P+ R A  N       YV P E KR +LRWQ+R  LA
Sbjct:  133 ASETSSVDQFERPKSKMAKKRKVMRRKNGEARVFDESFTSTDSASTVTDISEL----EQQLRDL-----PLRGDHKYDDILQEPQDYRPWEG---RQASKALPSYIRPSTSHPHTRGIKKIDPVNRYHQFKYEWEHQKAPGEKNRNLLRWNVRGQMLQQEVYERPQRRYAPNN-------YVVPTEKKRQSLRWQVRTSLA 314          
BLAST of Si:dkey-23f9.4 vs. Ensembl Medaka
Match: si:dkey-23f9.4 (HYLS1 centriolar and ciliogenesis associated [Source:NCBI gene;Acc:101157913])

HSP 1 Score: 69.3218 bits (168), Expect = 7.562e-13
Identity = 43/102 (42.16%), Postives = 57/102 (55.88%), Query Frame = 3
Query:  645 RPSSKTSFIKPNLHRCDNIWQRHDPVSRYHSYKAAWNQKKAPGESPHKELRWAVKAAMMVK-EVPKPRVAKVNSSRNQNLYVPPGENKRSNLRWQIRQELAN 947
            RP  K SFI+P   R    +++ DPV++Y  YK  W   K PGE   K LRW ++  +  +   PKPR   V +S     YV P E KRS LRW++R +LAN
Sbjct:  240 RPKPK-SFIRPV--RNQQAFKKSDPVAKYFEYKQLWEMFKLPGEKDRKALRWEIRERLAYQPPPPKPRRVFVPNS-----YVVPTEKKRSALRWEVRNQLAN 333          
BLAST of Si:dkey-23f9.4 vs. Ensembl Medaka
Match: si:dkey-23f9.4 (HYLS1 centriolar and ciliogenesis associated [Source:NCBI gene;Acc:101157913])

HSP 1 Score: 59.3066 bits (142), Expect = 1.856e-9
Identity = 33/77 (42.86%), Postives = 42/77 (54.55%), Query Frame = 3
Query:  720 VSRYHSYKAAWNQKKAPGESPHKELRWAVKAAMMVK-EVPKPRVAKVNSSRNQNLYVPPGENKRSNLRWQIRQELAN 947
            + RY  YK  W   K PGE   K LRW ++  +  +   PKPR   V +S     YV P E KRS LRW++R +LAN
Sbjct:  258 LCRYFEYKQLWEMFKLPGEKDRKALRWEIRERLAYQPPPPKPRRVFVPNS-----YVVPTEKKRSALRWEVRNQLAN 329          
BLAST of Si:dkey-23f9.4 vs. Planmine SMEST
Match: SMESG000064423.1 (SMESG000064423.1)

HSP 1 Score: 573.163 bits (1476), Expect = 0.000e+0
Identity = 296/297 (99.66%), Postives = 296/297 (99.66%), Query Frame = 3
Query:   75 MNYEDNCSEYHSSITGNDYDIYSSATLPENLNFSLDEIRQQLNLFGYSDIPVXXXXXXXXXXXXXXXXXTNLKSSTVTPRNRETNEWFIEGSNSEFDNDDGSSVATVTSLSPSSYKMKRKTCRKRNSSNTEDFISEPCTSRTYDSQNCANNNENYFRKVKFPQDPVDDIFNYTGISIDPNDLSAHNNLPKRPSSKTSFIKPNLHRCDNIWQRHDPVSRYHSYKAAWNQKKAPGESPHKELRWAVKAAMMVKEVPKPRVAKVNSSRNQNLYVPPGENKRSNLRWQIRQELANPDVYFD 965
            MNYEDNCSEYHSSITGNDYDIYSSATLPENLNFSLDEIRQQLNLFGYSDIPVDKLLIIKKDLDDIIAKDTNLKSSTVTPRNRETNEWFIEGSNSEFDNDDGSSVATVTSLSPSSYKMKRKTCRKRNSSNTEDFISEPCTSRTYDSQNCANNNENYFRKVKFPQDPVDDIFNYTGISIDPNDLSAHNNL KRPSSKTSFIKPNLHRCDNIWQRHDPVSRYHSYKAAWNQKKAPGESPHKELRWAVKAAMMVKEVPKPRVAKVNSSRNQNLYVPPGENKRSNLRWQIRQELANPDVYFD
Sbjct:    1 MNYEDNCSEYHSSITGNDYDIYSSATLPENLNFSLDEIRQQLNLFGYSDIPVDKLLIIKKDLDDIIAKDTNLKSSTVTPRNRETNEWFIEGSNSEFDNDDGSSVATVTSLSPSSYKMKRKTCRKRNSSNTEDFISEPCTSRTYDSQNCANNNENYFRKVKFPQDPVDDIFNYTGISIDPNDLSAHNNLSKRPSSKTSFIKPNLHRCDNIWQRHDPVSRYHSYKAAWNQKKAPGESPHKELRWAVKAAMMVKEVPKPRVAKVNSSRNQNLYVPPGENKRSNLRWQIRQELANPDVYFD 297          
The following BLAST results are available for this feature:
BLAST of Si:dkey-23f9.4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
HYLS15.066e-1432.67HYLS1 centriolar and ciliogenesis associated [Sour... [more]
HYLS15.066e-1432.67HYLS1 centriolar and ciliogenesis associated [Sour... [more]
HYLS15.066e-1432.67HYLS1 centriolar and ciliogenesis associated [Sour... [more]
back to top
BLAST of Si:dkey-23f9.4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
hyls-12.137e-744.44Hydrolethalus syndrome protein 1 homolog [Source:... [more]
hyls-12.137e-744.44Hydrolethalus syndrome protein 1 homolog [Source:... [more]
back to top
BLAST of Si:dkey-23f9.4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:dkey-23f9.4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:dkey-23f9.42.854e-1341.28si:dkey-23f9.4 [Source:ZFIN;Acc:ZDB-GENE-141222-88... [more]
si:dkey-23f9.44.661e-1341.28si:dkey-23f9.4 [Source:ZFIN;Acc:ZDB-GENE-141222-88... [more]
back to top
BLAST of Si:dkey-23f9.4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000035138.11.934e-1141.24centriolar and ciliogenesis associated [Source:NCB... [more]
back to top
BLAST of Si:dkey-23f9.4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Hyls11.137e-1231.86HYLS1, centriolar and ciliogenesis associated [Sou... [more]
back to top
BLAST of Si:dkey-23f9.4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96M11|HYLS1_HUMAN2.433e-1332.67Hydrolethalus syndrome protein 1 OS=Homo sapiens O... [more]
sp|Q4R2Y2|HYLS1_MACFA4.374e-1332.18Hydrolethalus syndrome protein 1 homolog OS=Macaca... [more]
sp|A0A1L8ER70|HYLS1_XENLA2.355e-1140.63Hydrolethalus syndrome protein 1 homolog OS=Xenopu... [more]
sp|Q2KI52|HYLS1_BOVIN3.334e-1138.00Hydrolethalus syndrome protein 1 homolog OS=Bos ta... [more]
sp|Q9CXX0|HYLS1_MOUSE6.013e-930.77Hydrolethalus syndrome protein 1 homolog OS=Mus mu... [more]
back to top
BLAST of Si:dkey-23f9.4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H2Z5A35.452e-1631.06HYLS1_C domain-containing protein OS=Ciona savigny... [more]
M4AIS95.239e-1430.60Si:dkey-23f9.4 OS=Xiphophorus maculatus OX=8083 PE... [more]
A0A2T7NXH61.406e-1348.15HYLS1_C domain-containing protein OS=Pomacea canal... [more]
H2XVG66.408e-1344.90hydrolethalus syndrome protein 1 homolog OS=Ciona ... [more]
A0A3Q2YHZ99.452e-1326.40HYLS1_C domain-containing protein OS=Hippocampus c... [more]
back to top
BLAST of Si:dkey-23f9.4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
si:dkey-23f9.43.151e-1338.18HYLS1 centriolar and ciliogenesis associated [Sour... [more]
si:dkey-23f9.45.329e-1341.24HYLS1 centriolar and ciliogenesis associated [Sour... [more]
si:dkey-23f9.45.349e-1341.24HYLS1 centriolar and ciliogenesis associated [Sour... [more]
back to top
BLAST of Si:dkey-23f9.4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000009660.12.008e-1545.45pep scaffold:Pmarinus_7.0:GL478031:10292:15688:1 g... [more]
back to top
BLAST of Si:dkey-23f9.4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:dkey-23f9.4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO486405.557e-1432.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Si:dkey-23f9.4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:dkey-23f9.47.562e-1342.16HYLS1 centriolar and ciliogenesis associated [Sour... [more]
si:dkey-23f9.41.856e-942.86HYLS1 centriolar and ciliogenesis associated [Sour... [more]
back to top
BLAST of Si:dkey-23f9.4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000064423.10.000e+099.66SMESG000064423.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021990 ID=SMED30021990|Name=Si:dkey-23f9.4|organism=Schmidtea mediterranea sexual|type=transcript|length=1062bp
TGGAATTTGAAATCGTAATATTTTTAAAAAAATTTGCTTTCAGTAAATAC
GATAGAAACAAAGGTATCTTTTGAATGAACTACGAAGATAATTGTTCAGA
GTATCATAGTTCAATTACTGGAAATGATTATGATATATATTCAAGTGCAA
CTTTACCAGAAAATTTAAACTTTTCTTTAGATGAAATCCGTCAGCAATTA
AATCTATTTGGCTATTCAGATATTCCAGTCGATAAATTATTAATTATCAA
AAAAGATCTTGATGATATTATTGCTAAAGACACAAACCTAAAAAGCTCCA
CGGTAACACCTAGAAACCGGGAGACAAATGAATGGTTTATTGAAGGTAGC
AATTCAGAGTTTGACAATGATGATGGATCATCAGTTGCTACTGTAACGAG
TCTTTCTCCTAGCTCATATAAAATGAAACGTAAAACTTGTCGTAAAAGAA
ATTCATCTAACACCGAAGATTTCATTTCAGAACCCTGTACATCTCGAACT
TACGACTCACAGAATTGTGCCAATAATAATGAAAATTATTTTCGAAAAGT
AAAATTTCCCCAAGATCCCGTTGATGATATATTTAATTACACCGGTATAT
CCATTGATCCAAATGATTTGAGTGCGCATAATAATCTTCCAAAGCGGCCG
TCCAGTAAAACCAGTTTCATTAAACCCAACTTACACAGATGTGACAATAT
CTGGCAAAGACATGATCCAGTGTCCCGATATCATAGTTACAAGGCAGCTT
GGAATCAAAAGAAAGCTCCAGGCGAAAGTCCACACAAAGAGTTGAGATGG
GCCGTTAAAGCTGCAATGATGGTTAAAGAAGTGCCAAAACCACGCGTTGC
TAAAGTCAACAGTAGTAGAAATCAGAATCTTTATGTGCCACCAGGAGAAA
ATAAACGGAGTAATCTACGTTGGCAAATTAGACAGGAACTAGCTAATCCT
GATGTATATTTCGATTAAAAGATTTTCACAAAAATCTGAAATTAATTTAA
TTAGCAAATTGTTTATATTGTTGAAATTGATTATTATTTTATTAATAATT
GATTATTATTAT
back to top

protein sequence of SMED30021990-orf-1

>SMED30021990-orf-1 ID=SMED30021990-orf-1|Name=SMED30021990-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=298bp
MNYEDNCSEYHSSITGNDYDIYSSATLPENLNFSLDEIRQQLNLFGYSDI
PVDKLLIIKKDLDDIIAKDTNLKSSTVTPRNRETNEWFIEGSNSEFDNDD
GSSVATVTSLSPSSYKMKRKTCRKRNSSNTEDFISEPCTSRTYDSQNCAN
NNENYFRKVKFPQDPVDDIFNYTGISIDPNDLSAHNNLPKRPSSKTSFIK
PNLHRCDNIWQRHDPVSRYHSYKAAWNQKKAPGESPHKELRWAVKAAMMV
KEVPKPRVAKVNSSRNQNLYVPPGENKRSNLRWQIRQELANPDVYFD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR027918HYLS1_C_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005813centrosome
GO:0005829cytosol
GO:0005886plasma membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR027918Hydrolethalus syndrome protein 1, C-terminal domainPFAMPF15311HYLS1_Ccoord: 208..290
e-value: 3.7E-20
score: 72.5
NoneNo IPR availablePANTHERPTHR34174FAMILY NOT NAMEDcoord: 32..291