Troponin I

Overview
NameTroponin I
Smed IDSMED30021982
Length (bp)1306
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Troponin I (SMED30021982) t-SNE clustered cells

Violin plots show distribution of expression levels for Troponin I (SMED30021982) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Troponin I (SMED30021982) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Troponin I (SMED30021982) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021982

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30021982SMESG000036684.1 SmedASXL_011699SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
muscle cellSMED30021982SMESG000036684.1 dd_Smed_v4_7974_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
anterior region of the whole animalSMED30021982SMESG000036684.1 dd_Smed_v4_7974_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30021982SMESG000036684.1 dd_Smed_v6_7974_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Category 2 cellSMED30021982SMESG000036684.1 dd_Smed_v4_7974_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Troponin I vs. Ensembl Human
Match: TNNI2 (troponin I2, fast skeletal type [Source:HGNC Symbol;Acc:HGNC:11946])

HSP 1 Score: 50.447 bits (119), Expect = 1.057e-6
Identity = 25/74 (33.78%), Postives = 44/74 (59.46%), Query Frame = 1
Query:  721 NYLKTVVPNLELDTSSAEEITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRV 942
            NYL    P L +   S  E+ ++ K+ + K+ A E +KYD E+++Q    E+ ++  K+ + +GKF +P L+RV
Sbjct:   43 NYLAEHCPPLHI-PGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKLFDLRGKFKRPPLRRV 115          
BLAST of Troponin I vs. Ensembl Human
Match: TNNI2 (troponin I2, fast skeletal type [Source:HGNC Symbol;Acc:HGNC:11946])

HSP 1 Score: 50.447 bits (119), Expect = 1.057e-6
Identity = 25/74 (33.78%), Postives = 44/74 (59.46%), Query Frame = 1
Query:  721 NYLKTVVPNLELDTSSAEEITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRV 942
            NYL    P L +   S  E+ ++ K+ + K+ A E +KYD E+++Q    E+ ++  K+ + +GKF +P L+RV
Sbjct:   43 NYLAEHCPPLHI-PGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKLFDLRGKFKRPPLRRV 115          
BLAST of Troponin I vs. Ensembl Human
Match: TNNI2 (troponin I2, fast skeletal type [Source:HGNC Symbol;Acc:HGNC:11946])

HSP 1 Score: 50.447 bits (119), Expect = 1.057e-6
Identity = 25/74 (33.78%), Postives = 44/74 (59.46%), Query Frame = 1
Query:  721 NYLKTVVPNLELDTSSAEEITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRV 942
            NYL    P L +   S  E+ ++ K+ + K+ A E +KYD E+++Q    E+ ++  K+ + +GKF +P L+RV
Sbjct:   43 NYLAEHCPPLHI-PGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKLFDLRGKFKRPPLRRV 115          
BLAST of Troponin I vs. Ensembl Human
Match: TNNI2 (troponin I2, fast skeletal type [Source:HGNC Symbol;Acc:HGNC:11946])

HSP 1 Score: 50.447 bits (119), Expect = 1.057e-6
Identity = 25/74 (33.78%), Postives = 44/74 (59.46%), Query Frame = 1
Query:  721 NYLKTVVPNLELDTSSAEEITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRV 942
            NYL    P L +   S  E+ ++ K+ + K+ A E +KYD E+++Q    E+ ++  K+ + +GKF +P L+RV
Sbjct:   43 NYLAEHCPPLHI-PGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKLFDLRGKFKRPPLRRV 115          
BLAST of Troponin I vs. Ensembl Human
Match: TNNI2 (troponin I2, fast skeletal type [Source:HGNC Symbol;Acc:HGNC:11946])

HSP 1 Score: 50.447 bits (119), Expect = 1.057e-6
Identity = 25/74 (33.78%), Postives = 44/74 (59.46%), Query Frame = 1
Query:  721 NYLKTVVPNLELDTSSAEEITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRV 942
            NYL    P L +   S  E+ ++ K+ + K+ A E +KYD E+++Q    E+ ++  K+ + +GKF +P L+RV
Sbjct:   43 NYLAEHCPPLHI-PGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKLFDLRGKFKRPPLRRV 115          
BLAST of Troponin I vs. Ensembl Celegans
Match: tni-4 (Troponin I 4 [Source:UniProtKB/Swiss-Prot;Acc:O44572])

HSP 1 Score: 93.2041 bits (230), Expect = 5.734e-22
Identity = 62/146 (42.47%), Postives = 102/146 (69.86%), Query Frame = 1
Query:  625 SPEKKRMLKQLIXXXXXXXXXXXXXXXXXXXXNYLK-TVVPNLELDTSSAEEITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRVSKTEGKWSKLEKQRGQNQISFRDQLKSTGQNKFALEEKD 1059
            +PE+K+ L++L+M KAAE++K +   +++E++  L+  ++P  +LD    +++  +  +  E+L  LES+ YD    ++  DFEINELT+ VN+ +GKFVKP LK+VSKTEGK+ KL+K+    ++ FR QLK   +N+FAL+E+D
Sbjct:   41 TPERKKKLRKLLMMKAAEDLKQQQMLKEQERQRILQERIIPLPDLDNE--DDLEAVYDEIRERLIDLESENYDVSYIVRQKDFEINELTIAVNDLRGKFVKPTLKKVSKTEGKFDKLKKKEA-TKVDFRAQLKVVDKNEFALDEED 183          
BLAST of Troponin I vs. Ensembl Celegans
Match: tni-4 (Troponin I 4 [Source:UniProtKB/Swiss-Prot;Acc:O44572])

HSP 1 Score: 93.2041 bits (230), Expect = 5.734e-22
Identity = 62/146 (42.47%), Postives = 102/146 (69.86%), Query Frame = 1
Query:  625 SPEKKRMLKQLIXXXXXXXXXXXXXXXXXXXXNYLK-TVVPNLELDTSSAEEITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRVSKTEGKWSKLEKQRGQNQISFRDQLKSTGQNKFALEEKD 1059
            +PE+K+ L++L+M KAAE++K +   +++E++  L+  ++P  +LD    +++  +  +  E+L  LES+ YD    ++  DFEINELT+ VN+ +GKFVKP LK+VSKTEGK+ KL+K+    ++ FR QLK   +N+FAL+E+D
Sbjct:   41 TPERKKKLRKLLMMKAAEDLKQQQMLKEQERQRILQERIIPLPDLDNE--DDLEAVYDEIRERLIDLESENYDVSYIVRQKDFEINELTIAVNDLRGKFVKPTLKKVSKTEGKFDKLKKKEA-TKVDFRAQLKVVDKNEFALDEED 183          
BLAST of Troponin I vs. Ensembl Celegans
Match: tni-3 (Troponin I 3 [Source:UniProtKB/Swiss-Prot;Acc:Q9XUN9])

HSP 1 Score: 64.3142 bits (155), Expect = 1.976e-11
Identity = 52/161 (32.30%), Postives = 100/161 (62.11%), Query Frame = 1
Query:  625 SPEKKRMLKQLIXXXXXXXXXXXXXXXXXXXXNYLKT-VVPNLELDTSSAE-EITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRVSKTEGKWSKLEKQRGQ--NQISFRDQL----KSTGQNKFALEEKDETHKNPDW 1083
            +PE+K+ L++L+M KAAE++K +   +++E++  L+   +P  ++D+ + + ++ KI +  + ++CALE +K+D    +   + EIN+LT++VN+ +GKFVKP LK+VSK + K+    K  G+   + +FR+ L    K T  ++   ++K      P+W
Sbjct:   54 TPERKKKLRKLLMMKAAEDLKQQQMLKEQERQKTLQQRTIPLPDVDSINDQGQLLKIYEDMFARVCALEEEKFDINFGVSQTEAEINQLTIQVNDLRGKFVKPTLKKVSKYDNKF----KSSGEVKEKSNFRNNLKVVKKETDLDEIMAKKKGTADGKPEW 210          
BLAST of Troponin I vs. Ensembl Celegans
Match: tni-3 (Troponin I 3 [Source:UniProtKB/Swiss-Prot;Acc:Q9XUN9])

HSP 1 Score: 64.3142 bits (155), Expect = 1.976e-11
Identity = 52/161 (32.30%), Postives = 100/161 (62.11%), Query Frame = 1
Query:  625 SPEKKRMLKQLIXXXXXXXXXXXXXXXXXXXXNYLKT-VVPNLELDTSSAE-EITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRVSKTEGKWSKLEKQRGQ--NQISFRDQL----KSTGQNKFALEEKDETHKNPDW 1083
            +PE+K+ L++L+M KAAE++K +   +++E++  L+   +P  ++D+ + + ++ KI +  + ++CALE +K+D    +   + EIN+LT++VN+ +GKFVKP LK+VSK + K+    K  G+   + +FR+ L    K T  ++   ++K      P+W
Sbjct:   54 TPERKKKLRKLLMMKAAEDLKQQQMLKEQERQKTLQQRTIPLPDVDSINDQGQLLKIYEDMFARVCALEEEKFDINFGVSQTEAEINQLTIQVNDLRGKFVKPTLKKVSKYDNKF----KSSGEVKEKSNFRNNLKVVKKETDLDEIMAKKKGTADGKPEW 210          
BLAST of Troponin I vs. Ensembl Celegans
Match: unc-27 (Troponin I 2 [Source:UniProtKB/Swiss-Prot;Acc:Q9GYF1])

HSP 1 Score: 59.6918 bits (143), Expect = 6.903e-10
Identity = 55/169 (32.54%), Postives = 97/169 (57.40%), Query Frame = 1
Query:  625 SPEKKRMLKQLIXXXXXXXXXXXXXXXXXXXXNYL--KTV-VPNLELDTSSAEEITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRVSKTEGKWSKLEKQRGQNQISFRDQLKSTGQNKF-ALEEKDETHKNPDWREHLKSKDMENS 1119
            +PE+K+ L++L+M KAAE++K +   +++E++  L  +T+ +PN++       ++ KI    + +L  LE +KYD    +   + EIN LT++VN+ +GKFVKP LK+VSK + K+ K  + +   +  FR  LK   ++   A+    +    PDW +  K    E+S
Sbjct:   42 TPERKKKLRKLLMVKAAEDLKRQQLLKEQERQKALADRTISLPNVD-SIDDKGQLEKIYNDLWARLTQLEEEKYDINYVVSQTEAEINSLTIEVNDLRGKFVKPSLKKVSKYDNKFKKSGESKAGTKEDFRANLKIVKKDVMEAIVNVKKKDDKPDWSKKNKDAKAEDS 209          
BLAST of Troponin I vs. Ensembl Fly
Match: wupA (gene:FBgn0283471 transcript:FBtr0074521)

HSP 1 Score: 80.4925 bits (197), Expect = 3.009e-17
Identity = 41/89 (46.07%), Postives = 62/89 (69.66%), Query Frame = 1
Query:  754 LDTSSAEEITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRVSKTEGKWSKLEKQRGQNQISFRDQLK 1020
            L  +S + I  + K Y+ K+  LES+KYD+E  +   D+EIN+L  +VN+ +GKFVKP LK+VSK E K++KL+K+    + +FR+QLK
Sbjct:   84 LSDASEDTIQSVCKDYHSKILKLESEKYDFEYDVARKDYEINDLNAQVNDLRGKFVKPALKKVSKYENKFAKLQKKAA--EFNFRNQLK 170          
BLAST of Troponin I vs. Ensembl Fly
Match: wupA (gene:FBgn0283471 transcript:FBtr0308237)

HSP 1 Score: 75.0998 bits (183), Expect = 2.140e-15
Identity = 38/89 (42.70%), Postives = 62/89 (69.66%), Query Frame = 1
Query:  754 LDTSSAEEITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRVSKTEGKWSKLEKQRGQNQISFRDQLK 1020
            L  +S + +  ++K++Y+++  LE  KYD E  ++  D EIN+L  +VN+ +GKFVKP LK+VSK E K++KL+K+    + +FR+QLK
Sbjct:   84 LSDASEDTLKSLIKQHYDRINKLEDQKYDLEYVVKRKDVEINDLNAQVNDLRGKFVKPALKKVSKYENKFAKLQKKAA--EFNFRNQLK 170          
BLAST of Troponin I vs. Ensembl Fly
Match: wupA (gene:FBgn0283471 transcript:FBtr0336897)

HSP 1 Score: 74.3294 bits (181), Expect = 2.956e-15
Identity = 38/89 (42.70%), Postives = 62/89 (69.66%), Query Frame = 1
Query:  754 LDTSSAEEITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRVSKTEGKWSKLEKQRGQNQISFRDQLK 1020
            L  +S + +  ++K++Y+++  LE  KYD E  ++  D EIN+L  +VN+ +GKFVKP LK+VSK E K++KL+K+    + +FR+QLK
Sbjct:   60 LSDASEDTLKSLIKQHYDRINKLEDQKYDLEYVVKRKDVEINDLNAQVNDLRGKFVKPALKKVSKYENKFAKLQKKAA--EFNFRNQLK 146          
BLAST of Troponin I vs. Ensembl Fly
Match: wupA (gene:FBgn0283471 transcript:FBtr0336896)

HSP 1 Score: 74.3294 bits (181), Expect = 2.956e-15
Identity = 38/89 (42.70%), Postives = 62/89 (69.66%), Query Frame = 1
Query:  754 LDTSSAEEITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRVSKTEGKWSKLEKQRGQNQISFRDQLK 1020
            L  +S + +  ++K++Y+++  LE  KYD E  ++  D EIN+L  +VN+ +GKFVKP LK+VSK E K++KL+K+    + +FR+QLK
Sbjct:   60 LSDASEDTLKSLIKQHYDRINKLEDQKYDLEYVVKRKDVEINDLNAQVNDLRGKFVKPALKKVSKYENKFAKLQKKAA--EFNFRNQLK 146          
BLAST of Troponin I vs. Ensembl Fly
Match: wupA (gene:FBgn0283471 transcript:FBtr0336895)

HSP 1 Score: 74.3294 bits (181), Expect = 2.956e-15
Identity = 38/89 (42.70%), Postives = 62/89 (69.66%), Query Frame = 1
Query:  754 LDTSSAEEITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRVSKTEGKWSKLEKQRGQNQISFRDQLK 1020
            L  +S + +  ++K++Y+++  LE  KYD E  ++  D EIN+L  +VN+ +GKFVKP LK+VSK E K++KL+K+    + +FR+QLK
Sbjct:   60 LSDASEDTLKSLIKQHYDRINKLEDQKYDLEYVVKRKDVEINDLNAQVNDLRGKFVKPALKKVSKYENKFAKLQKKAA--EFNFRNQLK 146          
BLAST of Troponin I vs. Ensembl Zebrafish
Match: tnni1d (troponin I, skeletal, slow d [Source:ZFIN;Acc:ZDB-GENE-040718-374])

HSP 1 Score: 61.6178 bits (148), Expect = 1.129e-10
Identity = 41/127 (32.28%), Postives = 72/127 (56.69%), Query Frame = 1
Query:  724 YLKTVVPNLELDTSSAEEITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRVSKTEGKWSK-LEKQRGQNQISFRDQLKSTGQNKFALEEKDETHKNPDWREHLKS 1101
            YLK   P L+L   S EE+  + K+ Y K+  ++ ++YD+E K++  + +INEL LKV +  GKF KP L++V  +  +  + L   + +  +  R  LKS  +     +EK  T +  DWR+++++
Sbjct:   55 YLKEKHPPLQLSGLSLEELQNLCKQLYSKIDTVDEERYDYEDKVKKHNKDINELKLKVQDLGGKFKKPALRKVRVSADEMMRALLGSKHKGSMDLRANLKSVKKEDIK-QEKVLTSEVGDWRKNVEA 180          
BLAST of Troponin I vs. Ensembl Zebrafish
Match: tnni1d (troponin I, skeletal, slow d [Source:ZFIN;Acc:ZDB-GENE-040718-374])

HSP 1 Score: 61.6178 bits (148), Expect = 1.129e-10
Identity = 41/127 (32.28%), Postives = 72/127 (56.69%), Query Frame = 1
Query:  724 YLKTVVPNLELDTSSAEEITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRVSKTEGKWSK-LEKQRGQNQISFRDQLKSTGQNKFALEEKDETHKNPDWREHLKS 1101
            YLK   P L+L   S EE+  + K+ Y K+  ++ ++YD+E K++  + +INEL LKV +  GKF KP L++V  +  +  + L   + +  +  R  LKS  +     +EK  T +  DWR+++++
Sbjct:   55 YLKEKHPPLQLSGLSLEELQNLCKQLYSKIDTVDEERYDYEDKVKKHNKDINELKLKVQDLGGKFKKPALRKVRVSADEMMRALLGSKHKGSMDLRANLKSVKKEDIK-QEKVLTSEVGDWRKNVEA 180          
BLAST of Troponin I vs. Ensembl Zebrafish
Match: tnni1d (troponin I, skeletal, slow d [Source:ZFIN;Acc:ZDB-GENE-040718-374])

HSP 1 Score: 61.6178 bits (148), Expect = 1.218e-10
Identity = 41/127 (32.28%), Postives = 72/127 (56.69%), Query Frame = 1
Query:  724 YLKTVVPNLELDTSSAEEITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRVSKTEGKWSK-LEKQRGQNQISFRDQLKSTGQNKFALEEKDETHKNPDWREHLKS 1101
            YLK   P L+L   S EE+  + K+ Y K+  ++ ++YD+E K++  + +INEL LKV +  GKF KP L++V  +  +  + L   + +  +  R  LKS  +     +EK  T +  DWR+++++
Sbjct:   55 YLKEKHPPLQLSGLSLEELQNLCKQLYSKIDTVDEERYDYEDKVKKHNKDINELKLKVQDLGGKFKKPALRKVRVSADEMMRALLGSKHKGSMDLRANLKSVKKEDIK-QEKVLTSEVGDWRKNVEA 180          
BLAST of Troponin I vs. Ensembl Zebrafish
Match: tnni1d (troponin I, skeletal, slow d [Source:ZFIN;Acc:ZDB-GENE-040718-374])

HSP 1 Score: 61.6178 bits (148), Expect = 1.218e-10
Identity = 41/127 (32.28%), Postives = 72/127 (56.69%), Query Frame = 1
Query:  724 YLKTVVPNLELDTSSAEEITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRVSKTEGKWSK-LEKQRGQNQISFRDQLKSTGQNKFALEEKDETHKNPDWREHLKS 1101
            YLK   P L+L   S EE+  + K+ Y K+  ++ ++YD+E K++  + +INEL LKV +  GKF KP L++V  +  +  + L   + +  +  R  LKS  +     +EK  T +  DWR+++++
Sbjct:   55 YLKEKHPPLQLSGLSLEELQNLCKQLYSKIDTVDEERYDYEDKVKKHNKDINELKLKVQDLGGKFKKPALRKVRVSADEMMRALLGSKHKGSMDLRANLKSVKKEDIK-QEKVLTSEVGDWRKNVEA 180          
BLAST of Troponin I vs. Ensembl Zebrafish
Match: tnni1d (troponin I, skeletal, slow d [Source:ZFIN;Acc:ZDB-GENE-040718-374])

HSP 1 Score: 61.6178 bits (148), Expect = 1.327e-10
Identity = 41/127 (32.28%), Postives = 72/127 (56.69%), Query Frame = 1
Query:  724 YLKTVVPNLELDTSSAEEITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRVSKTEGKWSK-LEKQRGQNQISFRDQLKSTGQNKFALEEKDETHKNPDWREHLKS 1101
            YLK   P L+L   S EE+  + K+ Y K+  ++ ++YD+E K++  + +INEL LKV +  GKF KP L++V  +  +  + L   + +  +  R  LKS  +     +EK  T +  DWR+++++
Sbjct:   55 YLKEKHPPLQLSGLSLEELQNLCKQLYSKIDTVDEERYDYEDKVKKHNKDINELKLKVQDLGGKFKKPALRKVRVSADEMMRALLGSKHKGSMDLRANLKSVKKEDIK-QEKVLTSEVGDWRKNVEA 180          
BLAST of Troponin I vs. Ensembl Xenopus
Match: thbs1 (thrombospondin 1 [Source:Xenbase;Acc:XB-GENE-486189])

HSP 1 Score: 56.6102 bits (135), Expect = 1.046e-8
Identity = 35/122 (28.69%), Postives = 71/122 (58.20%), Query Frame = 1
Query:  739 VPNLELDTSSAEEITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRVS-KTEGKWSKLEKQRGQNQISFRDQLKSTGQNKFALEEKDETHKNPDWREHLKS 1101
            VP+L++   S +++ ++  K ++++ +++ ++YD E+K++  D EI  LT K+ + KGKF +P LKRV    +     L     +  +  R  LKS  +     +EK++T +  DWR+++++
Sbjct:   65 VPSLQIAGLSLQQLQELCTKLHKQIDSVDEERYDIEVKVKKHDIEIEGLTQKIFDLKGKFKRPNLKRVRISADAMLKALLGNTHKVSVDLRANLKSVRKE----DEKEKTVEVTDWRKNIEA 182          
BLAST of Troponin I vs. Ensembl Xenopus
Match: thbs1 (thrombospondin 1 [Source:Xenbase;Acc:XB-GENE-486189])

HSP 1 Score: 55.8398 bits (133), Expect = 1.163e-8
Identity = 35/122 (28.69%), Postives = 71/122 (58.20%), Query Frame = 1
Query:  739 VPNLELDTSSAEEITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRVS-KTEGKWSKLEKQRGQNQISFRDQLKSTGQNKFALEEKDETHKNPDWREHLKS 1101
            VP+L++   S +++ ++  K ++++ +++ ++YD E+K++  D EI  LT K+ + KGKF +P LKRV    +     L     +  +  R  LKS  +     +EK++T +  DWR+++++
Sbjct:   51 VPSLQIAGLSLQQLQELCTKLHKQIDSVDEERYDIEVKVKKHDIEIEGLTQKIFDLKGKFKRPNLKRVRISADAMLKALLGNTHKVSVDLRANLKSVRKE----DEKEKTVEVTDWRKNIEA 168          
BLAST of Troponin I vs. Ensembl Mouse
Match: Tnni3 (troponin I, cardiac 3 [Source:MGI Symbol;Acc:MGI:98783])

HSP 1 Score: 49.2914 bits (116), Expect = 2.601e-6
Identity = 33/124 (26.61%), Postives = 61/124 (49.19%), Query Frame = 1
Query:  727 LKTVVPNLELDTSSAEEITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRVS-KTEGKWSKLEKQRGQNQISFRDQLKSTGQNKFALEEKDETHKNPDWREHL 1095
            L+T    LELD    EE+  + ++ + ++  ++ ++YD E K+     EI +LT K+ + +GKF +P L+RV    +     L   R +  +  R  LK   +       + E  +  DWR+++
Sbjct:   77 LRTRCQPLELDGLGFEELQDLCRQLHARVDKVDEERYDVEAKVTKNITEIADLTQKIYDLRGKFKRPTLRRVRISADAMMQALLGTRAKESLDLRAHLKQVKKEDI----EKENREVGDWRKNI 196          
BLAST of Troponin I vs. Ensembl Mouse
Match: Tnni2 (troponin I, skeletal, fast 2 [Source:MGI Symbol;Acc:MGI:105070])

HSP 1 Score: 48.1358 bits (113), Expect = 3.855e-6
Identity = 25/74 (33.78%), Postives = 43/74 (58.11%), Query Frame = 1
Query:  721 NYLKTVVPNLELDTSSAEEITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRV 942
            NYL    P L +   S  E+ ++ K+ + K+   E +KYD E+K+Q    E+ ++  K+ + +GKF +P L+RV
Sbjct:   33 NYLSEHCPPLHI-PGSMSEVQELCKQLHAKIDVAEEEKYDMEVKVQKSSKELEDMNQKLFDLRGKFKRPPLRRV 105          
BLAST of Troponin I vs. Ensembl Mouse
Match: Tnni2 (troponin I, skeletal, fast 2 [Source:MGI Symbol;Acc:MGI:105070])

HSP 1 Score: 47.3654 bits (111), Expect = 3.876e-6
Identity = 25/74 (33.78%), Postives = 43/74 (58.11%), Query Frame = 1
Query:  721 NYLKTVVPNLELDTSSAEEITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRV 942
            NYL    P L +   S  E+ ++ K+ + K+   E +KYD E+K+Q    E+ ++  K+ + +GKF +P L+RV
Sbjct:   43 NYLSEHCPPLHI-PGSMSEVQELCKQLHAKIDVAEEEKYDMEVKVQKSSKELEDMNQKLFDLRGKFKRPPLRRV 115          
BLAST of Troponin I vs. Ensembl Mouse
Match: Tnni2 (troponin I, skeletal, fast 2 [Source:MGI Symbol;Acc:MGI:105070])

HSP 1 Score: 48.1358 bits (113), Expect = 3.930e-6
Identity = 25/74 (33.78%), Postives = 43/74 (58.11%), Query Frame = 1
Query:  721 NYLKTVVPNLELDTSSAEEITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRV 942
            NYL    P L +   S  E+ ++ K+ + K+   E +KYD E+K+Q    E+ ++  K+ + +GKF +P L+RV
Sbjct:   43 NYLSEHCPPLHI-PGSMSEVQELCKQLHAKIDVAEEEKYDMEVKVQKSSKELEDMNQKLFDLRGKFKRPPLRRV 115          
BLAST of Troponin I vs. Ensembl Mouse
Match: Tnni2 (troponin I, skeletal, fast 2 [Source:MGI Symbol;Acc:MGI:105070])

HSP 1 Score: 48.1358 bits (113), Expect = 3.930e-6
Identity = 25/74 (33.78%), Postives = 43/74 (58.11%), Query Frame = 1
Query:  721 NYLKTVVPNLELDTSSAEEITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRV 942
            NYL    P L +   S  E+ ++ K+ + K+   E +KYD E+K+Q    E+ ++  K+ + +GKF +P L+RV
Sbjct:   43 NYLSEHCPPLHI-PGSMSEVQELCKQLHAKIDVAEEEKYDMEVKVQKSSKELEDMNQKLFDLRGKFKRPPLRRV 115          
BLAST of Troponin I vs. UniProt/SwissProt
Match: sp|Q7M3Y3|TNNI_CHLNI (Troponin I OS=Chlamys nipponensis akazara OX=6571 PE=1 SV=2)

HSP 1 Score: 99.3673 bits (246), Expect = 3.308e-22
Identity = 47/101 (46.53%), Postives = 69/101 (68.32%), Query Frame = 1
Query:  724 YLKTVVPNLELDTSSAEEITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRVSKTEGKWSKLEKQRGQNQISFRDQLKST 1026
            Y+  +VP    D      +  + K ++++L +LE D YDWE K++  DFEINELTLKVN+ KGKFVKPVL++V+KTE K  K++++  + +  FRD LKS+
Sbjct:  178 YINDLVPKFSTDGKDVAALQALCKDFHKRLASLEEDVYDWEAKIRKQDFEINELTLKVNDTKGKFVKPVLRKVNKTESKLDKIQRKEAK-KSDFRDNLKSS 277          
BLAST of Troponin I vs. UniProt/SwissProt
Match: sp|O44572|TNNI4_CAEEL (Troponin I 4 OS=Caenorhabditis elegans OX=6239 GN=tni-4 PE=2 SV=2)

HSP 1 Score: 93.2041 bits (230), Expect = 7.294e-21
Identity = 62/146 (42.47%), Postives = 102/146 (69.86%), Query Frame = 1
Query:  625 SPEKKRMLKQLIXXXXXXXXXXXXXXXXXXXXNYLK-TVVPNLELDTSSAEEITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRVSKTEGKWSKLEKQRGQNQISFRDQLKSTGQNKFALEEKD 1059
            +PE+K+ L++L+M KAAE++K +   +++E++  L+  ++P  +LD    +++  +  +  E+L  LES+ YD    ++  DFEINELT+ VN+ +GKFVKP LK+VSKTEGK+ KL+K+    ++ FR QLK   +N+FAL+E+D
Sbjct:   41 TPERKKKLRKLLMMKAAEDLKQQQMLKEQERQRILQERIIPLPDLDNE--DDLEAVYDEIRERLIDLESENYDVSYIVRQKDFEINELTIAVNDLRGKFVKPTLKKVSKTEGKFDKLKKKEA-TKVDFRAQLKVVDKNEFALDEED 183          
BLAST of Troponin I vs. UniProt/SwissProt
Match: sp|P05547|TNNI_ASTLP (Troponin I OS=Astacus leptodactylus OX=6717 PE=1 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 4.056e-20
Identity = 44/100 (44.00%), Postives = 74/100 (74.00%), Query Frame = 1
Query:  754 LDTSSAEEITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRVSKTEGKWSKLEKQRGQNQISFRDQLKSTGQNKFALEE 1053
            LD ++ E++  I+K+Y++    +ESDKYD E+++   D+EINEL ++VN+ +GKF+KP LK+VSK E K++KL+K+    + +FR+QLK+  + +F LE+
Sbjct:   86 LDGANEEQLRAIIKEYFDHTAQIESDKYDVELEIIRKDYEINELNIQVNDLRGKFIKPTLKKVSKYENKFAKLQKKAA--EFNFRNQLKTVKKKEFELED 183          
BLAST of Troponin I vs. UniProt/SwissProt
Match: sp|P36188|TNNI_DROME (Troponin I OS=Drosophila melanogaster OX=7227 GN=wupA PE=2 SV=3)

HSP 1 Score: 75.0998 bits (183), Expect = 7.655e-14
Identity = 39/89 (43.82%), Postives = 63/89 (70.79%), Query Frame = 1
Query:  754 LDTSSAEEITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRVSKTEGKWSKLEKQRGQNQISFRDQLK 1020
            L  +S  E+ +I ++YYE++   E  K+D E +++  D+EIN+L  +VN+ +GKFVKP LK+VSK E K++KL+K+    + +FR+QLK
Sbjct:  145 LSDASEGELQEICEEYYERMYICEGQKWDLEYEVRKKDWEINDLNAQVNDLRGKFVKPALKKVSKYENKFAKLQKKAA--EFNFRNQLK 231          
BLAST of Troponin I vs. UniProt/SwissProt
Match: sp|Q9XUN9|TNNI3_CAEEL (Troponin I 3 OS=Caenorhabditis elegans OX=6239 GN=tni-3 PE=2 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 2.513e-10
Identity = 52/161 (32.30%), Postives = 100/161 (62.11%), Query Frame = 1
Query:  625 SPEKKRMLKQLIXXXXXXXXXXXXXXXXXXXXNYLKT-VVPNLELDTSSAE-EITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRVSKTEGKWSKLEKQRGQ--NQISFRDQL----KSTGQNKFALEEKDETHKNPDW 1083
            +PE+K+ L++L+M KAAE++K +   +++E++  L+   +P  ++D+ + + ++ KI +  + ++CALE +K+D    +   + EIN+LT++VN+ +GKFVKP LK+VSK + K+    K  G+   + +FR+ L    K T  ++   ++K      P+W
Sbjct:   54 TPERKKKLRKLLMMKAAEDLKQQQMLKEQERQKTLQQRTIPLPDVDSINDQGQLLKIYEDMFARVCALEEEKFDINFGVSQTEAEINQLTIQVNDLRGKFVKPTLKKVSKYDNKF----KSSGEVKEKSNFRNNLKVVKKETDLDEIMAKKKGTADGKPEW 210          
BLAST of Troponin I vs. TrEMBL
Match: A0A0X3NY02 (Troponin I OS=Schistocephalus solidus OX=70667 GN=TNNI PE=4 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 6.633e-43
Identity = 99/158 (62.66%), Postives = 124/158 (78.48%), Query Frame = 1
Query:  625 SPEKKRMLKQLIXXXXXXXXXXXXXXXXXXXXNYLKTVVPNLELDTSSAEEITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRVSKTEGKWSKLEKQRGQNQISFRDQLKSTGQNKFALEEKDETHKNPDWREHLK 1098
            SPEKK++LKQLIMQKAA+EM+ E K+RQEEKENYL++ V  L LD      + K +K+ YE++ ALE +KYDWE+K++  DFEINELT+KVN+ KGKFVKPVLK+VSKTE   ++ EK+  Q+  SFR QLKSTGQNKFALEEKDE    P+WR+ LK
Sbjct:   74 SPEKKKLLKQLIMQKAADEMRNEMKRRQEEKENYLRSKVQPLSLDGLDDAAVIKKIKELYERMKALEGEKYDWEVKIRRQDFEINELTIKVNDVKGKFVKPVLKKVSKTEN-MARFEKKESQSLASFRSQLKSTGQNKFALEEKDEGAHKPEWRDQLK 230          
BLAST of Troponin I vs. TrEMBL
Match: A0A0X3PN01 (Troponin I OS=Schistocephalus solidus OX=70667 GN=TNNI PE=4 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 6.873e-43
Identity = 99/158 (62.66%), Postives = 124/158 (78.48%), Query Frame = 1
Query:  625 SPEKKRMLKQLIXXXXXXXXXXXXXXXXXXXXNYLKTVVPNLELDTSSAEEITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRVSKTEGKWSKLEKQRGQNQISFRDQLKSTGQNKFALEEKDETHKNPDWREHLK 1098
            SPEKK++LKQLIMQKAA+EM+ E K+RQEEKENYL++ V  L LD      + K +K+ YE++ ALE +KYDWE+K++  DFEINELT+KVN+ KGKFVKPVLK+VSKTE   ++ EK+  Q+  SFR QLKSTGQNKFALEEKDE    P+WR+ LK
Sbjct:   79 SPEKKKLLKQLIMQKAADEMRNEMKRRQEEKENYLRSKVQPLSLDGLDDAAVIKKIKELYERMKALEGEKYDWEVKIRRQDFEINELTIKVNDVKGKFVKPVLKKVSKTEN-MARFEKKESQSLASFRSQLKSTGQNKFALEEKDEGAHKPEWRDQLK 235          
BLAST of Troponin I vs. TrEMBL
Match: A0A0X3NPV5 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR146010 PE=4 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 8.592e-43
Identity = 99/158 (62.66%), Postives = 124/158 (78.48%), Query Frame = 1
Query:  625 SPEKKRMLKQLIXXXXXXXXXXXXXXXXXXXXNYLKTVVPNLELDTSSAEEITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRVSKTEGKWSKLEKQRGQNQISFRDQLKSTGQNKFALEEKDETHKNPDWREHLK 1098
            SPEKK++LKQLIMQKAA+EM+ E K+RQEEKENYL++ V  L LD      + K +K+ YE++ ALE +KYDWE+K++  DFEINELT+KVN+ KGKFVKPVLK+VSKTE   ++ EK+  Q+  SFR QLKSTGQNKFALEEKDE    P+WR+ LK
Sbjct:   87 SPEKKKLLKQLIMQKAADEMRNEMKRRQEEKENYLRSKVQPLSLDGLDDAAVIKKIKELYERMKALEGEKYDWEVKIRRQDFEINELTIKVNDVKGKFVKPVLKKVSKTEN-MARFEKKESQSLASFRSQLKSTGQNKFALEEKDEGAHKPEWRDQLK 243          
BLAST of Troponin I vs. TrEMBL
Match: A0A158R9I4 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS7318 PE=4 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 3.082e-40
Identity = 102/172 (59.30%), Postives = 131/172 (76.16%), Query Frame = 1
Query:  625 SPEKKRMLKQLIXXXXXXXXXXXXXXXXXXXXNYLKTVVPNLELDTSSAEEITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRVSKTEGKWSKLEKQRGQNQISFRDQLKSTGQNKFALEEKDETHKNPDWREHLK-SKDMENSDEAMED 1137
            SPEKKR+LKQLIMQKAA+EMKAE KKRQEEKENYL++ V  L+LD      + K V++ + ++  LE +KYDWE+KL+  D EINELT+KVN+ KGKFVKPVLK+VSKTE + +++EK+  +   SFR QLKSTGQNKFALEEKDE     D+R+ LK + + E   EA+E+
Sbjct:   35 SPEKKRLLKQLIMQKAADEMKAEMKKRQEEKENYLRSRVQPLQLDGLDDAALAKKVRELHARVAQLEGEKYDWEVKLRRQDIEINELTMKVNDVKGKFVKPVLKKVSKTESQLARIEKKE-KTLASFRTQLKSTGQNKFALEEKDEAQHKVDFRDQLKPAGEGEAPKEAVEE 205          
BLAST of Troponin I vs. TrEMBL
Match: A0A068X0C0 (Troponin i OS=Echinococcus granulosus OX=6210 GN=EgrG_000734700 PE=4 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 3.413e-39
Identity = 97/158 (61.39%), Postives = 123/158 (77.85%), Query Frame = 1
Query:  625 SPEKKRMLKQLIXXXXXXXXXXXXXXXXXXXXNYLKTVVPNLELDTSSAEEITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRVSKTEGKWSKLEKQRGQNQISFRDQLKSTGQNKFALEEKDETHKNPDWREHLK 1098
            SPEKKR+LKQLIMQKAA+EMKAE KKRQEEK+NYL++ V  L+LD      + K V++ + ++  LE +KYDWE+KL+  D EINELT+KVN+ KGKFVKPVLK+VSKTE + +++EK+  +   SFR QLKSTGQNKFALEEKDE     D+R+ LK
Sbjct:   81 SPEKKRLLKQLIMQKAADEMKAEMKKRQEEKDNYLRSRVQPLQLDGLDDSALAKKVRELHARVAQLEGEKYDWEVKLRRQDIEINELTMKVNDVKGKFVKPVLKKVSKTESQLARIEKKE-KTLASFRTQLKSTGQNKFALEEKDEASHKVDFRDQLK 237          
BLAST of Troponin I vs. Ensembl Cavefish
Match: tnni1c (troponin I, skeletal, slow c [Source:ZFIN;Acc:ZDB-GENE-060825-192])

HSP 1 Score: 58.9214 bits (141), Expect = 9.991e-10
Identity = 39/127 (30.71%), Postives = 73/127 (57.48%), Query Frame = 1
Query:  724 YLKTVVPNLELDTSSAEEITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRVSKTEGKWSK-LEKQRGQNQISFRDQLKSTGQNKFALEEKDETHKNPDWREHLKS 1101
            YL   +P L+L   + +E+ K+ K+ + K+ A++ ++YD+E K+   + EI+EL LKV +  GKF KP L++V  +  +  + L   + +  +  R  LKS  +     +EK  T +  DWR+++++
Sbjct:   73 YLGEKLPPLQLSGLAMDELQKLCKQLHAKVDAVDEERYDFEAKVVKNNKEIHELKLKVQDLGGKFKKPALRKVRVSADEMMRALLGSKHKGSMDLRANLKSVKKEDIK-QEKVLTTEVGDWRKNVEA 198          
BLAST of Troponin I vs. Ensembl Cavefish
Match: tnni2a.4 (troponin I, fast skeletal muscle-like [Source:NCBI gene;Acc:103034366])

HSP 1 Score: 56.225 bits (134), Expect = 5.773e-9
Identity = 42/130 (32.31%), Postives = 72/130 (55.38%), Query Frame = 1
Query:  721 NYLKTVVPNLELDTSSAEEITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRVSKTEGKW-SKLEKQRGQNQISFRDQLKSTGQNKFALEEKDETHKN-PDWREHLKSK 1104
            NY+    P L+L  SS +E+ + +KK  + +  ++ D+YD E K+   D EI++L +KV + KGKF KPVL++V  +  +    L   + +  +  R  LK   +     E K+ET +   DWR++++ K
Sbjct:   39 NYMAEHCPPLDL-PSSTQELQEFLKKLNQNIEKIDEDRYDLEAKVIKTDKEIDDLKIKVQDLKGKFKKPVLRKVRMSADQMLQALLGSKHKVDLDLRANLKQVKK-----EVKEETAEQVGDWRKNIEDK 162          
BLAST of Troponin I vs. Ensembl Cavefish
Match: tnni1d (troponin I, skeletal, slow d [Source:ZFIN;Acc:ZDB-GENE-040718-374])

HSP 1 Score: 52.7582 bits (125), Expect = 1.061e-7
Identity = 36/127 (28.35%), Postives = 68/127 (53.54%), Query Frame = 1
Query:  724 YLKTVVPNLELDTSSAEEITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRVSKTEGKWSK-LEKQRGQNQISFRDQLKSTGQNKFALEEKDETHKNPDWREHLKS 1101
            YL   +P L+L   S  ++  + ++ YEK+  ++ ++YD E K+   + +I+EL LKV +  GKF KP L++V  +  +  + L   + +  +  R  LKS  +     E+  E     DWR+++++
Sbjct:   45 YLDEKMPPLQLAGLSLADLQNLCRELYEKIDVVDEERYDCENKVIKHNKDIHELKLKVQDLGGKFKKPALRKVRVSADEMMRALLGSKHKGSMDLRANLKSVKKEDIKQEKVGEV---GDWRKNVEA 168          
BLAST of Troponin I vs. Ensembl Cavefish
Match: tnni2a.3 (troponin I type 2a (skeletal, fast), tandem duplicate 3 [Source:ZFIN;Acc:ZDB-GENE-040718-80])

HSP 1 Score: 50.0618 bits (118), Expect = 6.257e-7
Identity = 36/128 (28.12%), Postives = 66/128 (51.56%), Query Frame = 1
Query:  724 YLKTVVPNLELDTSSAEEITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRVSKTEGKW-SKLEKQRGQNQISFRDQLKSTGQNKFALEEKDETHKNPDWREHLKSK 1104
            Y+    P+L +   S +E+ ++ KK +  +  ++ ++YD E K+   D EI +L +KV + KGKF KP L++V  +  +    L   + +  +  R  LK   +     E K+E     DWR++++ K
Sbjct:   35 YMAENCPDLSM-PGSTQELQELCKKLHSNIDKVDEERYDLEAKVAKSDKEIEDLKIKVIDLKGKFKKPALRKVRMSADQMLQALLGSKHKVSLDLRANLKQVKK-----EVKEEAADVGDWRKNIEDK 156          
BLAST of Troponin I vs. Ensembl Cavefish
Match: tnni1b (troponin I type 1b (skeletal, slow) [Source:ZFIN;Acc:ZDB-GENE-041212-37])

HSP 1 Score: 49.6766 bits (117), Expect = 7.215e-7
Identity = 34/127 (26.77%), Postives = 69/127 (54.33%), Query Frame = 1
Query:  724 YLKTVVPNLELDTSSAEEITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRVS-KTEGKWSKLEKQRGQNQISFRDQLKSTGQNKFALEEKDETHKNPDWREHLKS 1101
            YL    P L+  + S  E+ ++ ++ + K+  ++ ++YD E K+Q+   EI +L +KV + +GKF +P L+RV    +     L   + +  +  R  LKS  +      EK+++ +  DWR+++++
Sbjct:   28 YLSEKAPPLQTSSMSFAELQELCRELHAKIDEVDEERYDIEAKVQHNTREIKDLNIKVLDLRGKFKRPNLRRVRVSADAILRSLLGSKHKVSLDLRANLKSVKKED---TEKEKSVEVSDWRKNVEA 151          
BLAST of Troponin I vs. Ensembl Sea Lamprey
Match: tnni1a (troponin I type 1a (skeletal, slow) [Source:ZFIN;Acc:ZDB-GENE-030616-266])

HSP 1 Score: 50.8322 bits (120), Expect = 7.140e-8
Identity = 33/129 (25.58%), Postives = 72/129 (55.81%), Query Frame = 1
Query:  724 YLKTVVPNLELDTSSAEEITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRVSKT-EGKWSKLEKQRGQNQISFRDQLKSTGQNKFALEEKDETHKN--PDWREHLKS 1101
            Y+   V  LEL   S++E+  + ++ ++ +  ++ ++YD +++++  D EI EL +K+ + +GKF +P L+RV  + +     L   R +  +  R  LKS  ++     +K+E  +    DWR+++++
Sbjct:   24 YMADNVIRLELSHLSSQELQDLCRELHKTIDKVDEERYDMQVRVEKNDKEIKELQMKIYDLRGKFKRPPLRRVRMSADAMLRALLGSRHKVSMDLRANLKSVKKD-----DKEEKVRKEVGDWRKNVEA 147          
BLAST of Troponin I vs. Ensembl Medaka
Match: ENSORLT00000027969.1 (troponin I, slow skeletal muscle [Source:NCBI gene;Acc:101167333])

HSP 1 Score: 57.7658 bits (138), Expect = 1.326e-9
Identity = 39/126 (30.95%), Postives = 71/126 (56.35%), Query Frame = 1
Query:  724 YLKTVVPNLELDTSSAEEITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRVSKTEGKWSK-LEKQRGQNQISFRDQLKSTGQNKFALEEKDETHKNPDWREHLK 1098
            YL   +P L+L   S +E+ K+ K+ +EK+  ++ ++YD E K+   + +I+EL LKV +  GKF KP L++V  +  +  + L   + +  +  R  LKS  +     ++K  T +  DWRE+++
Sbjct:   46 YLGEKLPPLQLSGLSLDELQKLCKQLHEKIDVVDEERYDCEHKVVKHNKDIHELKLKVQDLGGKFKKPALRKVRVSADEMMRALLGSKHKGSMDLRANLKSVKKEDVK-QDKVLTSEVGDWRENVR 170          
BLAST of Troponin I vs. Ensembl Medaka
Match: tnni1b (troponin I, slow skeletal muscle [Source:NCBI gene;Acc:101156569])

HSP 1 Score: 49.6766 bits (117), Expect = 1.133e-6
Identity = 46/161 (28.57%), Postives = 90/161 (55.90%), Query Frame = 1
Query:  625 SPEKKRMLKQLIXXXXXXXXXXXXXXXXXXXXNYLKTVVPNLELDTSSAEEITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRVS-KTEGKWSKLEKQRGQNQISFRDQLKSTGQNKFALEEKDETHKNPDWREHLKSK 1104
            S  +K MLK L++ KA E+++ E  +++E+K  YL+   P ++    S  E+  + ++ + K+  ++ ++YD E K+ +   EI +L +KV + +GKF +P L+RV    +     L   + +  +  R  LKS  +      EK++T +  DWR+++++K
Sbjct:   10 SASRKLMLKSLMVAKAKEDLEQELVEKEEQKAKYLEEKSPPVQTSGLSLSELQALCEELHAKIDVVDEERYDIEAKVLHNTREIKDLNIKVQDLRGKFKRPNLRRVRVSADAILRSLLGSKHKVSMDLRANLKSVKKEDA---EKEKTVEVSDWRKNVEAK 167          
BLAST of Troponin I vs. Ensembl Medaka
Match: tnni1b (troponin I, slow skeletal muscle [Source:NCBI gene;Acc:101156569])

HSP 1 Score: 47.3654 bits (111), Expect = 4.602e-6
Identity = 44/155 (28.39%), Postives = 87/155 (56.13%), Query Frame = 1
Query:  643 MLKQLIXXXXXXXXXXXXXXXXXXXXNYLKTVVPNLELDTSSAEEITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRVS-KTEGKWSKLEKQRGQNQISFRDQLKSTGQNKFALEEKDETHKNPDWREHLKSK 1104
            MLK L++ KA E+++ E  +++E+K  YL+   P ++    S  E+  + ++ + K+  ++ ++YD E K+ +   EI +L +KV + +GKF +P L+RV    +     L   + +  +  R  LKS  +      EK++T +  DWR+++++K
Sbjct:    1 MLKSLMVAKAKEDLEQELVEKEEQKAKYLEEKSPPVQTSGLSLSELQALCEELHAKIDVVDEERYDIEAKVLHNTREIKDLNIKVQDLRGKFKRPNLRRVRVSADAILRSLLGSKHKVSMDLRANLKSVKKEDA---EKEKTVEVSDWRKNVEAK 152          
BLAST of Troponin I vs. Planmine SMEST
Match: SMESG000036684.1 (SMESG000036684.1)

HSP 1 Score: 347.436 bits (890), Expect = 4.467e-118
Identity = 309/313 (98.72%), Postives = 313/313 (100.00%), Query Frame = 1
Query:  214 MDPXXXXXXXXXXXXXXXXXXXVPEENNHDVFNGPKTLDNQEYEGQVAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAERIXXXXXXXXXXXXXXXQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSPEKKRMLKQLIXXXXXXXXXXXXXXXXXXXXNYLKTVVPNLELDTSSAEEITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRVSKTEGKWSKLEKQRGQNQISFRDQLKSTGQNKFALEEKDETHKNPDWREHLKSKDMENSDEAMEDNQIES 1152
            MDPEERQKQREARRRARTEKTEVPEENNHDVFNGPK+LDNQEYEG+VAEEQESRERQENEEKERERRIREEKEENIRKERERQEAERIKEMKAEEENAKELENQRLKEE+RLKKEAQEKEAL+KKKPEKKRKGLGGLSPEKKRMLKQLIMQKAAEEMKAEAKKRQEEKENYLKTVVPNLELDTSSAEEITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRVSKTEGKWSKLEKQRGQNQISFRDQLKSTGQNKFALEEKDETHKNPDWREHLKSKDMENSDEAMEDNQIES
Sbjct:    1 MDPEERQKQREARRRARTEKTEVPEENNHDVFNGPKSLDNQEYEGRVAEEQESRERQENEEKERERRIREEKEENIRKERERQEAERIKEMKAEEENAKELENQRLKEESRLKKEAQEKEALKKKKPEKKRKGLGGLSPEKKRMLKQLIMQKAAEEMKAEAKKRQEEKENYLKTVVPNLELDTSSAEEITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRVSKTEGKWSKLEKQRGQNQISFRDQLKSTGQNKFALEEKDETHKNPDWREHLKSKDMENSDEAMEDNQIES 313          
BLAST of Troponin I vs. Planmine SMEST
Match: SMESG000002071.1 (SMESG000002071.1)

HSP 1 Score: 151.369 bits (381), Expect = 2.364e-42
Identity = 99/161 (61.49%), Postives = 128/161 (79.50%), Query Frame = 1
Query:  625 SPEKKRMLKQLIXXXXXXXXXXXXXXXXXXXXNYLKTVVPNLELDTSSAEEITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRVSKTEGKWSKLEK-QRGQNQISFRDQLKSTGQNKFALEEKDETH-KNPDWREHLKS 1101
            SPEKK++LKQLIMQKAAEEMKAEA++RQEEKEN LKTVV  L +D+        + K+ +E++  LE +KYDWE+K++N +F+INELT+KVN+ KGKFVKPVLK+V+KTE K +++ K +  Q+  +FR QLKSTGQNKFALEEK+E H    DWREHLK+
Sbjct:  111 SPEKKKLLKQLIMQKAAEEMKAEARRRQEEKENKLKTVVGPLNIDSVDENSCKALCKQLHERINRLEEEKYDWEVKIRNQEFDINELTVKVNDIKGKFVKPVLKKVNKTESKLARIGKNEEKQSLQAFRGQLKSTGQNKFALEEKEEGHGAKTDWREHLKT 271          
BLAST of Troponin I vs. Planmine SMEST
Match: SMESG000002071.1 (SMESG000002071.1)

HSP 1 Score: 151.754 bits (382), Expect = 3.207e-42
Identity = 99/161 (61.49%), Postives = 128/161 (79.50%), Query Frame = 1
Query:  625 SPEKKRMLKQLIXXXXXXXXXXXXXXXXXXXXNYLKTVVPNLELDTSSAEEITKIVKKYYEKLCALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRVSKTEGKWSKLEK-QRGQNQISFRDQLKSTGQNKFALEEKDETH-KNPDWREHLKS 1101
            SPEKK++LKQLIMQKAAEEMKAEA++RQEEKEN LKTVV  L +D+        + K+ +E++  LE +KYDWE+K++N +F+INELT+KVN+ KGKFVKPVLK+V+KTE K +++ K +  Q+  +FR QLKSTGQNKFALEEK+E H    DWREHLK+
Sbjct:  135 SPEKKKLLKQLIMQKAAEEMKAEARRRQEEKENKLKTVVGPLNIDSVDENSCKALCKQLHERINRLEEEKYDWEVKIRNQEFDINELTVKVNDIKGKFVKPVLKKVNKTESKLARIGKNEEKQSLQAFRGQLKSTGQNKFALEEKEEGHGAKTDWREHLKT 295          
The following BLAST results are available for this feature:
BLAST of Troponin I vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TNNI21.057e-633.78troponin I2, fast skeletal type [Source:HGNC Symbo... [more]
TNNI21.057e-633.78troponin I2, fast skeletal type [Source:HGNC Symbo... [more]
TNNI21.057e-633.78troponin I2, fast skeletal type [Source:HGNC Symbo... [more]
TNNI21.057e-633.78troponin I2, fast skeletal type [Source:HGNC Symbo... [more]
TNNI21.057e-633.78troponin I2, fast skeletal type [Source:HGNC Symbo... [more]
back to top
BLAST of Troponin I vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tni-45.734e-2242.47Troponin I 4 [Source:UniProtKB/Swiss-Prot;Acc:O44... [more]
tni-45.734e-2242.47Troponin I 4 [Source:UniProtKB/Swiss-Prot;Acc:O44... [more]
tni-31.976e-1132.30Troponin I 3 [Source:UniProtKB/Swiss-Prot;Acc:Q9X... [more]
tni-31.976e-1132.30Troponin I 3 [Source:UniProtKB/Swiss-Prot;Acc:Q9X... [more]
unc-276.903e-1032.54Troponin I 2 [Source:UniProtKB/Swiss-Prot;Acc:Q9G... [more]
back to top
BLAST of Troponin I vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wupA3.009e-1746.07gene:FBgn0283471 transcript:FBtr0074521[more]
wupA2.140e-1542.70gene:FBgn0283471 transcript:FBtr0308237[more]
wupA2.956e-1542.70gene:FBgn0283471 transcript:FBtr0336897[more]
wupA2.956e-1542.70gene:FBgn0283471 transcript:FBtr0336896[more]
wupA2.956e-1542.70gene:FBgn0283471 transcript:FBtr0336895[more]
back to top
BLAST of Troponin I vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tnni1d1.129e-1032.28troponin I, skeletal, slow d [Source:ZFIN;Acc:ZDB-... [more]
tnni1d1.129e-1032.28troponin I, skeletal, slow d [Source:ZFIN;Acc:ZDB-... [more]
tnni1d1.218e-1032.28troponin I, skeletal, slow d [Source:ZFIN;Acc:ZDB-... [more]
tnni1d1.218e-1032.28troponin I, skeletal, slow d [Source:ZFIN;Acc:ZDB-... [more]
tnni1d1.327e-1032.28troponin I, skeletal, slow d [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Troponin I vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
thbs11.046e-828.69thrombospondin 1 [Source:Xenbase;Acc:XB-GENE-48618... [more]
thbs11.163e-828.69thrombospondin 1 [Source:Xenbase;Acc:XB-GENE-48618... [more]
back to top
BLAST of Troponin I vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tnni32.601e-626.61troponin I, cardiac 3 [Source:MGI Symbol;Acc:MGI:9... [more]
Tnni23.855e-633.78troponin I, skeletal, fast 2 [Source:MGI Symbol;Ac... [more]
Tnni23.876e-633.78troponin I, skeletal, fast 2 [Source:MGI Symbol;Ac... [more]
Tnni23.930e-633.78troponin I, skeletal, fast 2 [Source:MGI Symbol;Ac... [more]
Tnni23.930e-633.78troponin I, skeletal, fast 2 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Troponin I vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7M3Y3|TNNI_CHLNI3.308e-2246.53Troponin I OS=Chlamys nipponensis akazara OX=6571 ... [more]
sp|O44572|TNNI4_CAEEL7.294e-2142.47Troponin I 4 OS=Caenorhabditis elegans OX=6239 GN=... [more]
sp|P05547|TNNI_ASTLP4.056e-2044.00Troponin I OS=Astacus leptodactylus OX=6717 PE=1 S... [more]
sp|P36188|TNNI_DROME7.655e-1443.82Troponin I OS=Drosophila melanogaster OX=7227 GN=w... [more]
sp|Q9XUN9|TNNI3_CAEEL2.513e-1032.30Troponin I 3 OS=Caenorhabditis elegans OX=6239 GN=... [more]
back to top
BLAST of Troponin I vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3NY026.633e-4362.66Troponin I OS=Schistocephalus solidus OX=70667 GN=... [more]
A0A0X3PN016.873e-4362.66Troponin I OS=Schistocephalus solidus OX=70667 GN=... [more]
A0A0X3NPV58.592e-4362.66Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A158R9I43.082e-4059.30Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A068X0C03.413e-3961.39Troponin i OS=Echinococcus granulosus OX=6210 GN=E... [more]
back to top
BLAST of Troponin I vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tnni1c9.991e-1030.71troponin I, skeletal, slow c [Source:ZFIN;Acc:ZDB-... [more]
tnni2a.45.773e-932.31troponin I, fast skeletal muscle-like [Source:NCBI... [more]
tnni1d1.061e-728.35troponin I, skeletal, slow d [Source:ZFIN;Acc:ZDB-... [more]
tnni2a.36.257e-728.13troponin I type 2a (skeletal, fast), tandem duplic... [more]
tnni1b7.215e-726.77troponin I type 1b (skeletal, slow) [Source:ZFIN;A... [more]
back to top
BLAST of Troponin I vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tnni1a7.140e-825.58troponin I type 1a (skeletal, slow) [Source:ZFIN;A... [more]
back to top
BLAST of Troponin I vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Troponin I vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Troponin I vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSORLT00000027969.11.326e-930.95troponin I, slow skeletal muscle [Source:NCBI gene... [more]
tnni1b1.133e-628.57troponin I, slow skeletal muscle [Source:NCBI gene... [more]
tnni1b4.602e-628.39troponin I, slow skeletal muscle [Source:NCBI gene... [more]
back to top
BLAST of Troponin I vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000036684.14.467e-11898.72SMESG000036684.1[more]
SMESG000002071.12.364e-4261.49SMESG000002071.1[more]
SMESG000002071.13.207e-4261.49SMESG000002071.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021982 ID=SMED30021982|Name=Troponin I|organism=Schmidtea mediterranea sexual|type=transcript|length=1306bp
TAATATTTTTCATTTTTATTTTTGGGATAGTTTTAGCGATTTCTAGTGAG
TTTAAGAGATTCGCAGAAATTAAATATAGGAATTAATTATATTTTTTTGT
AAGGATAATTACAAAAATAAAAATTGGTTTGTTCCATAAAAACGTTATTG
ATTTTTCTATAAATTTTTCAAAAATCTTTAGGAACCAAAAAAGTATTTTG
AAAAAATTATTAAATGGATCCAGAAGAGAGACAGAAGCAAAGAGAAGCTC
GTAGACGAGCAAGAACCGAGAAAACGGAAGTTCCAGAAGAAAATAATCAT
GATGTTTTCAATGGACCAAAAACTCTAGATAATCAGGAATATGAAGGCCA
AGTAGCAGAAGAACAAGAATCTCGGGAAAGGCAAGAAAATGAAGAAAAAG
AAAGAGAAAGACGAATTCGTGAAGAGAAAGAAGAAAATATTAGAAAAGAA
AGAGAAAGACAAGAAGCAGAACGAATAAAAGAAATGAAAGCAGAAGAAGA
AAATGCAAAAGAATTGGAAAATCAACGGTTGAAAGAAGAAGCCAGACTCA
AGAAAGAAGCTCAAGAAAAAGAAGCTTTAGAAAAGAAAAAACCAGAAAAG
AAACGGAAGGGTTTAGGTGGATTGTCCCCTGAAAAGAAACGTATGCTGAA
GCAATTAATAATGCAAAAAGCTGCGGAAGAAATGAAAGCAGAAGCTAAAA
AAAGACAAGAAGAGAAAGAAAATTACCTGAAAACCGTTGTTCCGAATTTG
GAATTGGATACATCCTCTGCTGAAGAAATAACGAAAATTGTAAAAAAATA
TTATGAGAAACTATGCGCCCTTGAGTCAGACAAATACGACTGGGAAATCA
AACTTCAAAATTTGGACTTTGAGATAAACGAACTGACTTTGAAGGTGAAC
AATGCCAAGGGAAAATTTGTGAAGCCCGTGCTGAAACGAGTTTCAAAGAC
AGAAGGGAAATGGTCGAAATTAGAAAAACAACGAGGTCAAAACCAAATTT
CATTCCGGGACCAACTGAAATCAACAGGTCAAAATAAATTTGCATTGGAA
GAAAAGGACGAGACACATAAGAATCCAGATTGGAGAGAGCACTTAAAATC
GAAAGACATGGAAAATTCAGACGAAGCAATGGAAGATAATCAAATTGAAT
CTTAAATCATTACTGATTTAGAATAGATGCATGTTGAAATTCACCCTGTG
ATATTTCGGCAGATTTAGACAATATTGACAATAAGTAGACTAGTATTTAT
TATAATGACTTTAGATTGGAATATTTTTAAATAACAACTTTAATCAGAAA
AAAAAA
back to top

protein sequence of SMED30021982-orf-1

>SMED30021982-orf-1 ID=SMED30021982-orf-1|Name=SMED30021982-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=314bp
MDPEERQKQREARRRARTEKTEVPEENNHDVFNGPKTLDNQEYEGQVAEE
QESRERQENEEKERERRIREEKEENIRKERERQEAERIKEMKAEEENAKE
LENQRLKEEARLKKEAQEKEALEKKKPEKKRKGLGGLSPEKKRMLKQLIM
QKAAEEMKAEAKKRQEEKENYLKTVVPNLELDTSSAEEITKIVKKYYEKL
CALESDKYDWEIKLQNLDFEINELTLKVNNAKGKFVKPVLKRVSKTEGKW
SKLEKQRGQNQISFRDQLKSTGQNKFALEEKDETHKNPDWREHLKSKDME
NSDEAMEDNQIES*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000028Category 2 cell
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR038077Troponin_sf
IPR001978Troponin
Vocabulary: cellular component
TermDefinition
GO:0005861troponin complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 214..234
NoneNo IPR availableCOILSCoilCoilcoord: 145..174
NoneNo IPR availableCOILSCoilCoilcoord: 40..132
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 255..274
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 275..304
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..143
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 42..124
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 248..313
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..29
NoneNo IPR availablePANTHERPTHR13738TROPONIN Icoord: 49..299
IPR038077Troponin domain superfamilyGENE3DG3DSA:1.20.5.350coord: 125..290
e-value: 8.6E-42
score: 144.6
IPR038077Troponin domain superfamilySUPERFAMILYSSF90250Troponin coil-coiled subunitscoord: 137..281
IPR001978TroponinPFAMPF00992Troponincoord: 142..270
e-value: 2.0E-35
score: 122.0