SMED30021963

Overview
NameSMED30021963
Smed IDSMED30021963
Length (bp)2528
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30021963 (SMED30021963) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30021963 (SMED30021963) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021963

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30021963h1SMcG0001326 dd_Smed_v4_99531_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30021963h1SMcG0001326 Contig27491newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30021963h1SMcG0001326 Contig27491uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
testis primordiumSMED30021963h1SMcG0001326 PL030002A10A02_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile stagecDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30021963 vs. Ensembl Human
Match: SETMAR (SET domain and mariner transposase fusion gene [Source:HGNC Symbol;Acc:HGNC:10762])

HSP 1 Score: 52.373 bits (124), Expect = 6.472e-15
Identity = 36/99 (36.36%), Postives = 53/99 (53.54%), Query Frame = -1
Query:  585 STYKILLKTPMKIM----SVYKVHLEHFMRSRKKNALIASENLCAIFGRGVVNVRTCQR*FRKLRSEDLSLEEDTKPGRPSKIDNEVLWFILEHNPQET 869
            S  ++ L+T MK+M     +  + L  F   RK  A   + N+   FG G  N RT Q  F+K    D SLE++ + GRPS++DN+ L  I+E +P  T
Sbjct:  333 SCKRLTLET-MKMMLDKKQIRAIFLFEFKMGRK--AAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAIIEADPLTT 428          

HSP 2 Score: 49.6766 bits (117), Expect = 6.472e-15
Identity = 24/77 (31.17%), Postives = 46/77 (59.74%), Query Frame = -3
Query:  274 WLKNNLSD-----RFRICSSYLVRNNMEPFLDKLITGDEKYNLYENIKKRKFYCKPGTSLATLEK*DIHQQKVLLKV 489
            W+ + L++     RF + SS ++RN+ EPFLD+++T DEK+ LY+N ++   +     +     K  +H +KV++ +
Sbjct:  459 WVPHELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTI 535          
BLAST of SMED30021963 vs. Ensembl Human
Match: SETMAR (SET domain and mariner transposase fusion gene [Source:HGNC Symbol;Acc:HGNC:10762])

HSP 1 Score: 52.373 bits (124), Expect = 6.616e-15
Identity = 36/99 (36.36%), Postives = 53/99 (53.54%), Query Frame = -1
Query:  585 STYKILLKTPMKIM----SVYKVHLEHFMRSRKKNALIASENLCAIFGRGVVNVRTCQR*FRKLRSEDLSLEEDTKPGRPSKIDNEVLWFILEHNPQET 869
            S  ++ L+T MK+M     +  + L  F   RK  A   + N+   FG G  N RT Q  F+K    D SLE++ + GRPS++DN+ L  I+E +P  T
Sbjct:  194 SCKRLTLET-MKMMLDKKQIRAIFLFEFKMGRK--AAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAIIEADPLTT 289          

HSP 2 Score: 49.2914 bits (116), Expect = 6.616e-15
Identity = 24/78 (30.77%), Postives = 46/78 (58.97%), Query Frame = -3
Query:  271 WLKNNLSD-----RFRICSSYLVRNNMEPFLDKLITGDEKYNLYENIKKRKFYCKPGTSLATLEK*DIHQQKVLLKVL 489
            W+ + L++     RF + SS ++RN+ EPFLD+++T DEK+ LY+N ++   +     +     K  +H +KV++ + 
Sbjct:  320 WVPHELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTIW 397          
BLAST of SMED30021963 vs. Ensembl Human
Match: SETMAR (SET domain and mariner transposase fusion gene [Source:HGNC Symbol;Acc:HGNC:10762])

HSP 1 Score: 52.373 bits (124), Expect = 6.964e-7
Identity = 36/99 (36.36%), Postives = 53/99 (53.54%), Query Frame = -1
Query:  585 STYKILLKTPMKIM----SVYKVHLEHFMRSRKKNALIASENLCAIFGRGVVNVRTCQR*FRKLRSEDLSLEEDTKPGRPSKIDNEVLWFILEHNPQET 869
            S  ++ L+T MK+M     +  + L  F   RK  A   + N+   FG G  N RT Q  F+K    D SLE++ + GRPS++DN+ L  I+E +P  T
Sbjct:   97 SCKRLTLET-MKMMLDKKQIRAIFLFEFKMGRK--AAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAIIEADPLTT 192          
BLAST of SMED30021963 vs. UniProt/SwissProt
Match: sp|Q53H47|SETMR_HUMAN (Histone-lysine N-methyltransferase SETMAR OS=Homo sapiens OX=9606 GN=SETMAR PE=1 SV=2)

HSP 1 Score: 52.373 bits (124), Expect = 2.855e-14
Identity = 36/99 (36.36%), Postives = 53/99 (53.54%), Query Frame = -1
Query:  585 STYKILLKTPMKIM----SVYKVHLEHFMRSRKKNALIASENLCAIFGRGVVNVRTCQR*FRKLRSEDLSLEEDTKPGRPSKIDNEVLWFILEHNPQET 869
            S  ++ L+T MK+M     +  + L  F   RK  A   + N+   FG G  N RT Q  F+K    D SLE++ + GRPS++DN+ L  I+E +P  T
Sbjct:  333 SCKRLTLET-MKMMLDKKQIRAIFLFEFKMGRK--AAETTRNINNAFGPGTANERTVQWWFKKFCKGDESLEDEERSGRPSEVDNDQLRAIIEADPLTT 428          

HSP 2 Score: 49.6766 bits (117), Expect = 2.855e-14
Identity = 24/77 (31.17%), Postives = 46/77 (59.74%), Query Frame = -3
Query:  274 WLKNNLSD-----RFRICSSYLVRNNMEPFLDKLITGDEKYNLYENIKKRKFYCKPGTSLATLEK*DIHQQKVLLKV 489
            W+ + L++     RF + SS ++RN+ EPFLD+++T DEK+ LY+N ++   +     +     K  +H +KV++ +
Sbjct:  459 WVPHELTENQKNRRFEVSSSLILRNHNEPFLDRIVTCDEKWILYDNRRRSAQWLDQEEAPKHFPKPILHPKKVMVTI 535          
BLAST of SMED30021963 vs. TrEMBL
Match: A0A2P6JUP7 (Histone-lysine N-methyltransferase SETMAR OS=Nephila clavipes OX=2585209 GN=NCL1_63062 PE=4 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 1.020e-24
Identity = 51/82 (62.20%), Postives = 64/82 (78.05%), Query Frame = -3
Query:  232 NLSDRFRICSSYLVRNNMEPFLDKLITGDEKYNLYENIKKRKFYCKPGTSLATLEK*DIHQQKVLLKVLRFYETRKNYLSRQ 477
            NLSDR RICSS+L+R NMEPFLDKLITGD+K+ LYENIK++K YCKPGTS AT+ K  IH QKV L +   ++ ++  +S Q
Sbjct:   49 NLSDRVRICSSHLIRLNMEPFLDKLITGDKKWILYENIKRKKSYCKPGTSSATIRKPSIHHQKVQLCLWWEHKRKRATISVQ 130          

HSP 2 Score: 39.6614 bits (91), Expect = 1.020e-24
Identity = 15/30 (50.00%), Postives = 24/30 (80.00%), Query Frame = -2
Query:  479 ISLTVTGDYIKALMFVLKKAVWIPYDLAKK 568
            I  T  GD+IK+L FV+K++VW+P++L +K
Sbjct:   19 IHHTTVGDHIKSLAFVVKRSVWVPHELTEK 48          
BLAST of SMED30021963 vs. TrEMBL
Match: A0A087SYD3 (Mariner Mos1 transposase (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_01310 PE=4 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.301e-20
Identity = 42/66 (63.64%), Postives = 55/66 (83.33%), Query Frame = -3
Query:  280 NLSDRFRICSSYLVRNNMEPFLDKLITGDEKYNLYENIKKRKFYCKPGTSLATLEK*DIHQQKVLL 477
            NLSDR R+CSS+L+R+N+E FL++L+TGDEK+ LYENIK +K YCKPG S AT+ K  IH++KVL 
Sbjct:   49 NLSDRVRMCSSHLIRHNVESFLNRLVTGDEKWILYENIKSKKSYCKPGISSATVPKPSIHERKVLF 114          

HSP 2 Score: 35.8094 bits (81), Expect = 1.301e-20
Identity = 15/30 (50.00%), Postives = 23/30 (76.67%), Query Frame = -2
Query:  479 ISLTVTGDYIKALMFVLKKAVWIPYDLAKK 568
            I  T  GD+IK+L FVLK++V +P++L +K
Sbjct:   19 IHHTTVGDHIKSLGFVLKQSVCVPHELTEK 48          

HSP 3 Score: 22.3274 bits (46), Expect = 1.301e-20
Identity = 16/59 (27.12%), Postives = 24/59 (40.68%), Query Frame = -1
Query:  156 FYDFMKQGKTI----YLGNIVIL---------------GLVFSHDTYFAFVSLVLKHSL 275
            +Y+ +KQGKTI    Y   +  L               G+VF HD      ++V +  L
Sbjct:  125 YYELLKQGKTINVDLYCNQLDKLNAAIKEKRPALASRKGIVFHHDNARPPTAMVTQQKL 183          
BLAST of SMED30021963 vs. TrEMBL
Match: A0A1I7X3J6 (HTH_48 domain-containing protein OS=Heterorhabditis bacteriophora OX=37862 PE=4 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 6.864e-20
Identity = 28/48 (58.33%), Postives = 38/48 (79.17%), Query Frame = -3
Query:  334 NLSDRFRICSSYLVRNNMEPFLDKLITGDEKYNLYENIKKRKFYCKPG 477
            NL DR  IC+S L RN +EPFL+++ITGDEK+  YE+I ++K YC+PG
Sbjct:  111 NLDDRVVICTSLLARNKIEPFLNRMITGDEKWITYESIVRQKAYCEPG 158          

HSP 2 Score: 62.3882 bits (150), Expect = 6.864e-20
Identity = 32/82 (39.02%), Postives = 48/82 (58.54%), Query Frame = -1
Query:  594 MSVYKVHLEH---FMRSRKKNALIASENLCAIFGRGVVNVRTCQR*FRKLRSEDLSLEEDTKPGRPSKIDNEVLWFILEHNP 830
            M+  KVHL H   +   + +NA  A  NL  +FG G V+ RTC+R F +  + D  L +  + GRPS ID++V+  +LE +P
Sbjct:    1 MATAKVHLRHCILYEFQQGRNATEACRNLLKVFGEGSVSDRTCRRWFERFGTGDFDLYDKLRSGRPSLIDDDVVKTMLEQDP 82          
BLAST of SMED30021963 vs. TrEMBL
Match: A0A088APF9 (HTH_48 domain-containing protein OS=Apis mellifera OX=7460 PE=4 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 1.131e-19
Identity = 28/50 (56.00%), Postives = 38/50 (76.00%), Query Frame = -3
Query:  334 KNNLSDRFRICSSYLVRNNMEPFLDKLITGDEKYNLYENIKKRKFYCKPG 483
            + NL DR  IC+S L RN +EPFL+++ITGDEK+  Y NI K++ YC+PG
Sbjct:  122 QKNLDDRVVICTSLLARNKIEPFLNRMITGDEKWITYNNIVKKRAYCEPG 171          

HSP 2 Score: 57.3806 bits (137), Expect = 1.131e-19
Identity = 34/95 (35.79%), Postives = 53/95 (55.79%), Query Frame = -1
Query:  555 MSVYKVHLEH---FMRSRKKNALIASENLCAIFGRGVVNVRTCQR*FRKLRSEDLSLEEDTKPGRPSKIDNEVLWFILEHNPQETLVQYQNFSNS 830
            M+  K HL H   +   + +NA  A  NL  +FG G+V+  TC+R + K  + D +L  D + GRPS ID++V+  +LE +P  T+ +     NS
Sbjct:    1 MATDKNHLRHCILYEFQQGRNATEACRNLLKVFGEGIVSDMTCRRWYEKFETSDFNL-SDKRSGRPSLIDDDVVKAMLEQDPFLTISEIAQRLNS 94          

HSP 3 Score: 23.483 bits (49), Expect = 1.131e-19
Identity = 8/24 (33.33%), Postives = 17/24 (70.83%), Query Frame = -2
Query:  479 GDYIKALMFVLKKAVWIPYDLAKK 550
             D+I+ +  V K + W+P++L++K
Sbjct:  100 SDHIRKIGLVWKYSRWVPHELSQK 123          
BLAST of SMED30021963 vs. TrEMBL
Match: A0A088A6P4 (HTH_48 domain-containing protein OS=Apis mellifera OX=7460 PE=4 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 1.764e-19
Identity = 28/50 (56.00%), Postives = 38/50 (76.00%), Query Frame = -3
Query:  334 KNNLSDRFRICSSYLVRNNMEPFLDKLITGDEKYNLYENIKKRKFYCKPG 483
            + NL DR  IC+S L RN +EPFL+++ITGDEK+  Y NI K++ YC+PG
Sbjct:  122 QKNLDDRVVICTSLLARNKIEPFLNRMITGDEKWITYNNIVKKRAYCEPG 171          

HSP 2 Score: 57.7658 bits (138), Expect = 1.764e-19
Identity = 34/95 (35.79%), Postives = 53/95 (55.79%), Query Frame = -1
Query:  555 MSVYKVHLEH---FMRSRKKNALIASENLCAIFGRGVVNVRTCQR*FRKLRSEDLSLEEDTKPGRPSKIDNEVLWFILEHNPQETLVQYQNFSNS 830
            M+  K HL H   +   + +NA  A  NL  +FG G+V+  TC+R + K  + D +L  D + GRPS ID++V+  +LE +P  T+ +     NS
Sbjct:    1 MATDKNHLRHCILYEFQQGRNATEACRNLLKVFGEGIVSDMTCRRWYEKFETSDFNL-SDKRSGRPSLIDDDVVKAMLEQDPFLTISEIAQRLNS 94          

HSP 3 Score: 23.483 bits (49), Expect = 1.764e-19
Identity = 8/24 (33.33%), Postives = 17/24 (70.83%), Query Frame = -2
Query:  479 GDYIKALMFVLKKAVWIPYDLAKK 550
             D+I+ +  V K + W+P++L++K
Sbjct:  100 SDHIRKIGLVWKYSRWVPHELSQK 123          
BLAST of SMED30021963 vs. Planmine SMEST
Match: SMESG000019255.1 (SMESG000019255.1)

HSP 1 Score: 694.886 bits (1792), Expect = 0.000e+0
Identity = 406/406 (100.00%), Postives = 406/406 (100.00%), Query Frame = 3
Query: 1209 MGNAETIYDEKCLVYSPDQLGSCPVYEEHLETMKFITQTGKVLEKTVYQNFNVDTLPDKLRISWFQLIGKSIKTAGQALPEKDPIRSNVITTGRAEKLIGQMENEFAAFCNALLLKPIQEARLYHQESIIGINXXXXXXXXXXXXXXXXASLGNLTSERIQGLENLRNDYQGAHYALHSQVIRIYEVLNQIKLRLPAVIEYQLDMNQYVSNYLEYVLESFRGNKEIKREIKPLKSYHAEIQSKVPDYRESIKNFPKESENRKALLNKSKVPADSAQPNSTSKIISEGPDGKVDDXXXXXXXXXXXXXXXXXXELSTSKKVNTDQDTEMKTSDSKTNSEEQKKGPGQKPPGLSKENTSPVEKSNIKQDIDQNQDAGXXXXXXXXXXXXXXXXXXXXXXXXTTASIYN 2426
            MGNAETIYDEKCLVYSPDQLGSCPVYEEHLETMKFITQTGKVLEKTVYQNFNVDTLPDKLRISWFQLIGKSIKTAGQALPEKDPIRSNVITTGRAEKLIGQMENEFAAFCNALLLKPIQEARLYHQESIIGINKEFIQIEKKLKIEEQEASLGNLTSERIQGLENLRNDYQGAHYALHSQVIRIYEVLNQIKLRLPAVIEYQLDMNQYVSNYLEYVLESFRGNKEIKREIKPLKSYHAEIQSKVPDYRESIKNFPKESENRKALLNKSKVPADSAQPNSTSKIISEGPDGKVDDSTLKSQSVKKSKKNSTVKELSTSKKVNTDQDTEMKTSDSKTNSEEQKKGPGQKPPGLSKENTSPVEKSNIKQDIDQNQDAGKNFNHRNRKNKKSLKEKKSKSESLTTASIYN
Sbjct:    1 MGNAETIYDEKCLVYSPDQLGSCPVYEEHLETMKFITQTGKVLEKTVYQNFNVDTLPDKLRISWFQLIGKSIKTAGQALPEKDPIRSNVITTGRAEKLIGQMENEFAAFCNALLLKPIQEARLYHQESIIGINKEFIQIEKKLKIEEQEASLGNLTSERIQGLENLRNDYQGAHYALHSQVIRIYEVLNQIKLRLPAVIEYQLDMNQYVSNYLEYVLESFRGNKEIKREIKPLKSYHAEIQSKVPDYRESIKNFPKESENRKALLNKSKVPADSAQPNSTSKIISEGPDGKVDDSTLKSQSVKKSKKNSTVKELSTSKKVNTDQDTEMKTSDSKTNSEEQKKGPGQKPPGLSKENTSPVEKSNIKQDIDQNQDAGKNFNHRNRKNKKSLKEKKSKSESLTTASIYN 406          
BLAST of SMED30021963 vs. Planmine SMEST
Match: SMESG000019255.1 (SMESG000019255.1)

HSP 1 Score: 302.368 bits (773), Expect = 5.204e-92
Identity = 148/251 (58.96%), Postives = 188/251 (74.90%), Query Frame = 3
Query: 1209 MGNAETIYDEKCLVYSPDQLGSCPVYEEHLETMKFITQTGKVLEKTVYQNFNVDTLPDKLRISWFQLIGKSIKTAGQALPEKDPIRSNVITTGRAEKLIGQMENEFAAFCNALLLKPIQEARLYHQESIIGINXXXXXXXXXXXXXXXXASLGNLTSERIQGLENLRNDYQGAHYALHSQVIRIYEVLNQIKLRLPAVIEYQLDMNQYVSNYLEYVLESFRGNKEIKREIKPLKSYHAEIQSKVPDYRESI 1961
            MGNAETIYDEKCLVYSPDQLGSCPVYEEHLETMKFITQTGKVLEKTVYQNFNVDTLPDKLRISWFQL G+ +K  G ALP  DP R N++  G+AEKLIGQMENE++   N L+LK IQE RLYHQ  ++ +   F +    L+ +E++A+    +S+    L+N R++++  H  LH +VI ++E LN++K  LPA+IE Q+  N Y +NYLEY+LE+FR NK+I+  I PL S  +E+   VPDYR ++
Sbjct:    1 MGNAETIYDEKCLVYSPDQLGSCPVYEEHLETMKFITQTGKVLEKTVYQNFNVDTLPDKLRISWFQLYGQCLKNGGLALPASDPYRENILAAGKAEKLIGQMENEYSTIINCLILKNIQELRLYHQYIVVTLYDIFQKYRMALRFDEEKATRFESSSDY---LKNRRSEFKNIHSDLHDKVINVFEALNRLKDYLPAIIEAQMRANTYTNNYLEYILENFRDNKKIQNYIIPLASVGSELTYDVPDYRRAL 248          
BLAST of SMED30021963 vs. Planmine SMEST
Match: SMESG000016679.1 (SMESG000016679.1)

HSP 1 Score: 90.5077 bits (223), Expect = 8.149e-20
Identity = 77/273 (28.21%), Postives = 132/273 (48.35%), Query Frame = 3
Query: 1209 MGNAETIYDEKCLVYSPDQLGSCPVYEEHLETMKFITQTGKVLEKTVYQNFNV----DTLPDKL-RISWFQLIGKSIKTAGQALPEKDPIRSNVITTGRAEKLIGQMENEFAAFCNALLLKPIQEARLYHQESIIGINXXXXXXXXXXXXXXXXASLGNLTS--ERIQG-----------LENLRNDYQGA----HYALHSQVIRIYEVLNQIKLRLPAVIEYQLDMNQYVSNYLEYVLESFRGNKEIKREIKPLKSYHAEIQSKVPDYRESI 1961
            MGN+E IY  KC V  P+    C + + H   M FI   G+VLEK +Y + NV    + + D+  R S +Q+ G  +K AG  + +    +S +I  GR EK++GQ+EN      N+L L PIQ+ R++++E I+ I+                  +G +T+  ER++            LE  + D++         + +++   + ++ ++ LRL A+++ Q +  +    Y E + E    NKE+  +    KS+    Q+ V DYR  I
Sbjct:    1 MGNSE-IYYGKCEVAEPNIYSLCEMLKMHKFKMHFIEYLGEVLEKLIYTSPNVINGINIIDDESGRTSLYQIFGDCLKKAGLMMEDDYSYKSILILVGRTEKMMGQIENNCLYHLNSLFLVPIQKIRMFNREEILPIS----------------LKIGEITNTLERMKSQEGKEPNDKLKLEKEQQDFETKLNFNRKIIENRIADCHAMMMELCLRLIALVDIQTESLKKCMKYFENLSEFLHSNKELFEKSTDFKSFLKLNQTPV-DYRNWI 255          
BLAST of SMED30021963 vs. Planmine SMEST
Match: SMESG000016678.1 (SMESG000016678.1)

HSP 1 Score: 72.7886 bits (177), Expect = 9.668e-14
Identity = 69/235 (29.36%), Postives = 113/235 (48.09%), Query Frame = 3
Query: 1287 EEHLETMKFITQTGKVLEKTVYQ--NFNVDT---LPDKLRISWFQLIGKSIKTAGQALPEKDPIRSNVITTGRAEKLIGQMENEFAAFCNALLLKPIQEARLYHQESIIGINXXXXXXXXXXXXXXXXASLGNLTSERIQGLENLRNDYQGAHYALHSQVIRIYEVLNQIKLRL-----PAVIEYQLDMNQYVSNYLEYVLESFRGNKEIKREIKPLKSYHAEIQSKVPDYRESI 1961
            ++H   +  + + G++LE  +Y   + N  T   + +K RIS FQ++G+ +K     LP+ DP R  +   G+ EKLIGQ ENE     N L+L PIQ  R   +E I   N E   +   +  +E   S     SE    L+ LR ++      L  ++ R  +  N + + L     P +IE+       + N LEY++ +F+ N+ +K  +    S    ++S V D+RE I
Sbjct:   22 QQHQIGLFHLNKIGRLLESIIYHSGDGNATTFINITNKTRISNFQILGQCMKKISSTLPKGDPFREVLNLCGKIEKLIGQFENELIHTLNYLILAPIQRIRCNQREKIYVYNLELTHLWDHIHRDEIRDS-----SEEDPELK-LRAEF------LQGEIKRALKESNNMMIELRNNVYPFIIEHAKCSENIIKN-LEYLIMTFKDNRSMKHIVDI--SDTISVESTVEDFRERI 241          
BLAST of SMED30021963 vs. Planmine SMEST
Match: SMESG000007048.1 (SMESG000007048.1)

HSP 1 Score: 48.9062 bits (115), Expect = 5.556e-6
Identity = 27/75 (36.00%), Postives = 41/75 (54.67%), Query Frame = 3
Query: 1389 RISWFQLIGKSIKTAGQALPEKDPIRSNVITTGRAEKLIGQMENEFAAFCNALLLKPI-----QEARLYHQESII 1598
            R+S +Q  G+++K  G+A+ + +P  S +I  G  EKLIGQ ENE     + L   P+     Q+ +  HQE  I
Sbjct:   75 RVSSYQDFGQALKDLGEAMGKDNPYFSTLIKLGINEKLIGQAENELCEVTSKLFYFPVKDIIDQDCKKLHQEHEI 149          
The following BLAST results are available for this feature:
BLAST of SMED30021963 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
SETMAR6.472e-1536.36SET domain and mariner transposase fusion gene [So... [more]
SETMAR6.616e-1536.36SET domain and mariner transposase fusion gene [So... [more]
SETMAR6.964e-736.36SET domain and mariner transposase fusion gene [So... [more]
back to top
BLAST of SMED30021963 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30021963 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30021963 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30021963 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30021963 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30021963 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q53H47|SETMR_HUMAN2.855e-1436.36Histone-lysine N-methyltransferase SETMAR OS=Homo ... [more]
back to top
BLAST of SMED30021963 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2P6JUP71.020e-2462.20Histone-lysine N-methyltransferase SETMAR OS=Nephi... [more]
A0A087SYD31.301e-2063.64Mariner Mos1 transposase (Fragment) OS=Stegodyphus... [more]
A0A1I7X3J66.864e-2058.33HTH_48 domain-containing protein OS=Heterorhabditi... [more]
A0A088APF91.131e-1956.00HTH_48 domain-containing protein OS=Apis mellifera... [more]
A0A088A6P41.764e-1956.00HTH_48 domain-containing protein OS=Apis mellifera... [more]
back to top
BLAST of SMED30021963 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30021963 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30021963 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30021963 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30021963 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30021963 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000019255.10.000e+0100.00SMESG000019255.1[more]
SMESG000019255.15.204e-9258.96SMESG000019255.1[more]
SMESG000016679.18.149e-2028.21SMESG000016679.1[more]
SMESG000016678.19.668e-1429.36SMESG000016678.1[more]
SMESG000007048.15.556e-636.00SMESG000007048.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021963 ID=SMED30021963|Name=SMED30021963|organism=Schmidtea mediterranea sexual|type=transcript|length=2528bp
AAAATACCACAAATTTTGATTTTGTTTATTATTGTTTTATTGAGTAAAAA
TAAATTTAATTGAAGATCATTCATTAAATTTTTTTAATTTAATTTTTGTA
CATGTATATTATGTTTTTCCTTTTTTTCTTGGAATCCAATAATTAAGTAG
AGCTACAAACTATGCTTTAAAACCAAACTAACAAACGCAAAGTATGTGTC
ATGACTGAAAACTAGGCCCAGAATTACAATGTTGCCTAGATAGATAGTTT
TTCCTTGTTTCATAAAATCGTAAAACTTTTAGCAAAACTTTCTGCTGATG
AATATCTTACTTTTCAAGAGTTGCTAGTGATGTTCCAGGTTTGCAGTAAA
ATTTTCTCTTCTTTATGTTCTCGTAAAGATTATACTTTTCATCTCCAGTG
ATCAGTTTATCCAGAAACGGCTCCATATTATTTCTAACTAGATATGATGA
ACATATTCTAAAACGGTCAGACAAGTTATTTTTTAGCCAAATCATATGGG
ATCCAAACAGCTTTCTTTAAGACAAACATAAGTGCTTTAATGTAATCTCC
AGTAACTGTTAGAGAAATTCTGATATTGCACCAATGTTTCTTGTGGATTA
TGTTCCAATATAAACCACAAAACTTCATTATCGATCTTGGATGGTCGTCC
AGGTTTAGTATCCTCTTCTAGGCTCAGATCTTCGGAACGTAATTTTCTAA
ATCATCTTTGACAAGTACGAACATTTACAACACCTCTTCCAAATATTGCA
CAAAGGTTTTCACTTGCAATCAACGCGTTTTTTTTTCTTGATCTCATAAA
ATGTTCCAAATGCACTTTATACACTGACATTATTTTCATTGGCGTTTTTA
ACAGAATCTTGTAAGTTGAAGCGTTGTTGAGCAAAATATTGTTGTGGGTT
TTGAAAAAGTGATAGTTAGTTGGCAAGATATGATGTGATATTATTTCTGA
TGTATCTTGTTGATTTATCGAGAGCATTTTTCTGCAGTACCGGTTTCGCC
TAGATTTAGGAGATCATAGTGAATCAGCCCAGCCGTACAACACCAAAACT
TTATCATTACCTTTGGGCTCTGTGAAAAAACAGTCTTTATTTGAAAAAAA
GATTTATAGAACTTCAATAAAAAATCAAATGACCATTATTTTAGTAACAA
TCTAATAAATATAAAATATAAAATCAATTATAAATAATATATTGTCGATC
AAATAATTATGGGAAATGCTGAGACTATATATGACGAGAAATGCTTGGTA
TATTCGCCCGATCAACTCGGAAGCTGTCCCGTCTATGAAGAACATTTGGA
AACGATGAAATTTATCACTCAAACTGGAAAAGTATTAGAGAAAACGGTTT
ACCAGAATTTCAACGTGGACACTTTGCCGGATAAATTACGAATCAGCTGG
TTTCAGTTAATCGGAAAAAGTATTAAAACTGCAGGACAAGCATTACCGGA
AAAGGATCCAATTCGTTCCAACGTTATAACAACCGGAAGAGCTGAGAAAT
TGATTGGTCAAATGGAAAATGAATTCGCAGCTTTTTGTAATGCTCTATTA
TTGAAACCGATTCAAGAGGCTCGGTTGTACCATCAAGAGTCAATTATCGG
CATAAATAAAGAATTCATTCAGATTGAAAAAAAATTGAAGATAGAAGAGC
AAGAAGCCTCACTTGGAAACCTCACAAGTGAGAGAATACAGGGTTTAGAA
AATCTGAGAAACGACTATCAAGGTGCGCATTACGCTTTGCATTCTCAGGT
GATACGTATATACGAAGTTCTCAATCAGATCAAACTACGGCTTCCTGCTG
TTATCGAATATCAGCTCGACATGAACCAATATGTTAGTAATTATTTGGAA
TACGTTTTAGAAAGCTTTCGAGGTAATAAGGAAATAAAAAGGGAAATAAA
ACCACTAAAATCATACCATGCAGAAATTCAATCAAAAGTTCCGGACTATC
GAGAATCGATTAAAAATTTCCCAAAAGAAAGTGAAAATAGAAAAGCGTTA
CTGAATAAATCAAAAGTCCCAGCTGATTCAGCTCAGCCGAATTCAACTTC
TAAAATAATATCTGAAGGTCCCGATGGAAAGGTTGATGATTCTACTTTGA
AATCACAAAGTGTTAAAAAATCAAAAAAGAATTCAACTGTAAAAGAATTA
AGCACCTCGAAAAAAGTGAACACTGACCAGGATACCGAAATGAAAACTTC
TGACTCGAAAACAAACTCAGAAGAACAAAAGAAGGGCCCTGGACAAAAAC
CGCCAGGGCTCAGTAAAGAAAATACGAGTCCAGTGGAAAAATCTAACATA
AAACAAGACATTGATCAAAATCAAGACGCTGGAAAAAATTTCAATCATCG
AAATAGAAAAAACAAAAAAAGTTTAAAAGAAAAAAAATCCAAGTCAGAAA
GTTTGACTACTGCTAGTATTTATAACTGACTCAACTATTGATAATTTAAA
GTAGACGAAACTGTTTTTTAAAAAAAATTAAATATATAATTTATTATTTT
TTCTTGCTCGACATTAAAAAGAACTTCA
back to top

protein sequence of SMED30021963-orf-1

>SMED30021963-orf-1 ID=SMED30021963-orf-1|Name=SMED30021963-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=407bp
MGNAETIYDEKCLVYSPDQLGSCPVYEEHLETMKFITQTGKVLEKTVYQN
FNVDTLPDKLRISWFQLIGKSIKTAGQALPEKDPIRSNVITTGRAEKLIG
QMENEFAAFCNALLLKPIQEARLYHQESIIGINKEFIQIEKKLKIEEQEA
SLGNLTSERIQGLENLRNDYQGAHYALHSQVIRIYEVLNQIKLRLPAVIE
YQLDMNQYVSNYLEYVLESFRGNKEIKREIKPLKSYHAEIQSKVPDYRES
IKNFPKESENRKALLNKSKVPADSAQPNSTSKIISEGPDGKVDDSTLKSQ
SVKKSKKNSTVKELSTSKKVNTDQDTEMKTSDSKTNSEEQKKGPGQKPPG
LSKENTSPVEKSNIKQDIDQNQDAGKNFNHRNRKNKKSLKEKKSKSESLT
TASIYN*
back to top
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 265..406
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 271..285
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 287..341
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 350..373