Protocadherin alpha-11

Overview
NameProtocadherin alpha-11
Smed IDSMED30021961
Length (bp)3685
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protocadherin alpha-11 (SMED30021961) t-SNE clustered cells

Violin plots show distribution of expression levels for Protocadherin alpha-11 (SMED30021961) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin alpha-11 (SMED30021961) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin alpha-11 (SMED30021961) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021961

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30021961h1SMcG0014883 dd_Smed_v4_15901_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30021961h1SMcG0014883 dd_Smed_v4_15901_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal-ventral muscle cellSMED30021961h1SMcG0014883 dd_Smed_v4_15901_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin alpha-11 vs. Ensembl Human
Match: PCDH11X (protocadherin 11 X-linked [Source:HGNC Symbol;Acc:HGNC:8656])

HSP 1 Score: 228.409 bits (581), Expect = 1.582e-60
Identity = 213/764 (27.88%), Postives = 363/764 (47.51%), Query Frame = 1
Query:  124 QIFENLPVGSVICKLSNVIIPRPSDTT--KFKLIKNR----FFQIE--NGDNLKVSGLIDRDDNLELCAYRNVNFSCIWR-GILFCGTNNLKILEIQIL--DENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIK-PFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDI--NANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILL-----PGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQ---IIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIF-PNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSP 2346
            ++ EN+ +G ++  L+  +IP  S TT  +FKL+         +IE   G+       IDR+   +LCA    +  C +   +        ++++I+ L  D NDN P +    I I + EN+ ++S Y  LP A D D   N +  Y++  +   F +   ++ +G K P L +++ +DRE    + + +   DGG P ++ +  L + + D NDN P+F+ +    SI  N  + +++  ++HATD DI  NA + + FS  V  I +  F LN    ++ +K+ L  E     ++  + A D G    ++   V +   N N+  PSI +     P N+ V+ + EN  +   I    V D D+  +G+  C      +++I   +    S       L T    D E      + +   D GKP  N SA + I + D NDN+P F + F   +I E N P   + +++A D D G NA++ Y       L  P+   +   +C+   +  ++ LDREK          + ++A D+G P  + + TV + ++D NDN PVF    YN    E+         V +    DPD+G N  VT SI+ E    F ++  +G +      DRE Q S YTF + A D        ++++  V+I + D NDN+P+FI  P+  +Y++ L    P G++V  V A+D D+G+N+++++ +       LF+I++ +G +       V   G   + +KA D G P
Sbjct:   33 EMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDRE---KLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYT-LPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSV-TQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDRE-ETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNV--PSIDIRYIVNPVNDTVV-LSENIPLNTKIALITVTDKDADHNGRVTCF----TDHEIPFRLRPVFSNQFL---LETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINY-------LLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYL-----FTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGT---VGLITVTDPDYGDNSAVTLSILDEN-DDFTIDSQTGVIRPNISFDREKQES-YTFYVKAEDGGR---VSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNP-GTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 759          
BLAST of Protocadherin alpha-11 vs. Ensembl Human
Match: PCDH11X (protocadherin 11 X-linked [Source:HGNC Symbol;Acc:HGNC:8656])

HSP 1 Score: 228.409 bits (581), Expect = 3.799e-60
Identity = 214/764 (28.01%), Postives = 365/764 (47.77%), Query Frame = 1
Query:  124 QIFENLPVGSVICKLSNVIIPRPSDTT--KFKLIKNR----FFQIE--NGDNLKVSGLIDRDDNLELCAYRNVNFSCIWR-GILFCGTNNLKILEIQIL--DENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIK-PFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDI--NANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILL-----PGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQ---IIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIF-PNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSP 2346
            ++ EN+ +G ++  L+  +IP  S TT  +FKL+         +IE   G+       IDR+   +LCA    +  C +   +        ++++I+ L  D NDN P +    I I + EN+ ++S Y  LP A D D   N +  Y++  +   F +   ++ +G K P L +++ +DRE    + + +   DGG P ++ +  L + + D NDN P+F+ +    SI  N  + +++  ++HATD DI  NA + + FS  V  I +  F LN    ++ +K+ L  E     ++  + A D G    ++   V +   N N+  PSI +     P N+ V+ + EN  +   I    V D D+  +G+  C      +++I   +    S       L T    D E      + +   D GKP  N SA + I + D NDN+P F + F   +I E N P   + +++A D D G NA++ Y       L  P+   +   +C+   +  ++ LDREK  + + F     ++A D+G P  + + TV + ++D NDN PVF    YN    E+         V +    DPD+G N  VT SI+ E    F ++  +G +      DRE Q S YTF + A D        ++++  V+I + D NDN+P+FI  P+  +Y++ L    P G++V  V A+D D+G+N+++++ +       LF+I++ +G +       V   G   + +KA D G P
Sbjct:   33 EMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDRE---KLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYT-LPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSV-TQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDRE-ETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNV--PSIDIRYIVNPVNDTVV-LSENIPLNTKIALITVTDKDADHNGRVTCFT----DHEIPFRLRPVFSNQFL---LETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINY-------LLGPDAPPEFSLDCRTGMLTVVKKLDREKE-DKYLFT----ILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGT---VGLITVTDPDYGDNSAVTLSILDEN-DDFTIDSQTGVIRPNISFDREKQES-YTFYVKAEDGGR---VSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNP-GTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 759          
BLAST of Protocadherin alpha-11 vs. Ensembl Human
Match: PCDH11X (protocadherin 11 X-linked [Source:HGNC Symbol;Acc:HGNC:8656])

HSP 1 Score: 228.024 bits (580), Expect = 4.744e-60
Identity = 214/764 (28.01%), Postives = 365/764 (47.77%), Query Frame = 1
Query:  124 QIFENLPVGSVICKLSNVIIPRPSDTT--KFKLIKNR----FFQIE--NGDNLKVSGLIDRDDNLELCAYRNVNFSCIWR-GILFCGTNNLKILEIQIL--DENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIK-PFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDI--NANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILL-----PGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQ---IIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIF-PNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSP 2346
            ++ EN+ +G ++  L+  +IP  S TT  +FKL+         +IE   G+       IDR+   +LCA    +  C +   +        ++++I+ L  D NDN P +    I I + EN+ ++S Y  LP A D D   N +  Y++  +   F +   ++ +G K P L +++ +DRE    + + +   DGG P ++ +  L + + D NDN P+F+ +    SI  N  + +++  ++HATD DI  NA + + FS  V  I +  F LN    ++ +K+ L  E     ++  + A D G    ++   V +   N N+  PSI +     P N+ V+ + EN  +   I    V D D+  +G+  C      +++I   +    S       L T    D E      + +   D GKP  N SA + I + D NDN+P F + F   +I E N P   + +++A D D G NA++ Y       L  P+   +   +C+   +  ++ LDREK  + + F     ++A D+G P  + + TV + ++D NDN PVF    YN    E+         V +    DPD+G N  VT SI+ E    F ++  +G +      DRE Q S YTF + A D        ++++  V+I + D NDN+P+FI  P+  +Y++ L    P G++V  V A+D D+G+N+++++ +       LF+I++ +G +       V   G   + +KA D G P
Sbjct:   33 EMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDRE---KLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYT-LPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSV-TQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDRE-ETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNV--PSIDIRYIVNPVNDTVV-LSENIPLNTKIALITVTDKDADHNGRVTCF----TDHEIPFRLRPVFSNQFL---LETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINY-------LLGPDAPPEFSLDCRTGMLTVVKKLDREKE-DKYLFT----ILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGT---VGLITVTDPDYGDNSAVTLSILDEN-DDFTIDSQTGVIRPNISFDREKQES-YTFYVKAEDGGR---VSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNP-GTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 759          
BLAST of Protocadherin alpha-11 vs. Ensembl Human
Match: PCDH11X (protocadherin 11 X-linked [Source:HGNC Symbol;Acc:HGNC:8656])

HSP 1 Score: 228.024 bits (580), Expect = 5.284e-60
Identity = 214/764 (28.01%), Postives = 365/764 (47.77%), Query Frame = 1
Query:  124 QIFENLPVGSVICKLSNVIIPRPSDTT--KFKLIKNR----FFQIE--NGDNLKVSGLIDRDDNLELCAYRNVNFSCIWR-GILFCGTNNLKILEIQIL--DENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIK-PFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDI--NANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILL-----PGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQ---IIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIF-PNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSP 2346
            ++ EN+ +G ++  L+  +IP  S TT  +FKL+         +IE   G+       IDR+   +LCA    +  C +   +        ++++I+ L  D NDN P +    I I + EN+ ++S Y  LP A D D   N +  Y++  +   F +   ++ +G K P L +++ +DRE    + + +   DGG P ++ +  L + + D NDN P+F+ +    SI  N  + +++  ++HATD DI  NA + + FS  V  I +  F LN    ++ +K+ L  E     ++  + A D G    ++   V +   N N+  PSI +     P N+ V+ + EN  +   I    V D D+  +G+  C      +++I   +    S       L T    D E      + +   D GKP  N SA + I + D NDN+P F + F   +I E N P   + +++A D D G NA++ Y       L  P+   +   +C+   +  ++ LDREK  + + F     ++A D+G P  + + TV + ++D NDN PVF    YN    E+         V +    DPD+G N  VT SI+ E    F ++  +G +      DRE Q S YTF + A D        ++++  V+I + D NDN+P+FI  P+  +Y++ L    P G++V  V A+D D+G+N+++++ +       LF+I++ +G +       V   G   + +KA D G P
Sbjct:   33 EMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDRE---KLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYT-LPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSV-TQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDRE-ETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNV--PSIDIRYIVNPVNDTVV-LSENIPLNTKIALITVTDKDADHNGRVTCF----TDHEIPFRLRPVFSNQFL---LETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINY-------LLGPDAPPEFSLDCRTGMLTVVKKLDREKE-DKYLFT----ILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGT---VGLITVTDPDYGDNSAVTLSILDEN-DDFTIDSQTGVIRPNISFDREKQES-YTFYVKAEDGGR---VSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNP-GTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 759          
BLAST of Protocadherin alpha-11 vs. Ensembl Human
Match: PCDH11X (protocadherin 11 X-linked [Source:HGNC Symbol;Acc:HGNC:8656])

HSP 1 Score: 228.024 bits (580), Expect = 5.675e-60
Identity = 214/764 (28.01%), Postives = 365/764 (47.77%), Query Frame = 1
Query:  124 QIFENLPVGSVICKLSNVIIPRPSDTT--KFKLIKNR----FFQIE--NGDNLKVSGLIDRDDNLELCAYRNVNFSCIWR-GILFCGTNNLKILEIQIL--DENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIK-PFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDI--NANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILL-----PGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQ---IIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIF-PNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSP 2346
            ++ EN+ +G ++  L+  +IP  S TT  +FKL+         +IE   G+       IDR+   +LCA    +  C +   +        ++++I+ L  D NDN P +    I I + EN+ ++S Y  LP A D D   N +  Y++  +   F +   ++ +G K P L +++ +DRE    + + +   DGG P ++ +  L + + D NDN P+F+ +    SI  N  + +++  ++HATD DI  NA + + FS  V  I +  F LN    ++ +K+ L  E     ++  + A D G    ++   V +   N N+  PSI +     P N+ V+ + EN  +   I    V D D+  +G+  C      +++I   +    S       L T    D E      + +   D GKP  N SA + I + D NDN+P F + F   +I E N P   + +++A D D G NA++ Y       L  P+   +   +C+   +  ++ LDREK  + + F     ++A D+G P  + + TV + ++D NDN PVF    YN    E+         V +    DPD+G N  VT SI+ E    F ++  +G +      DRE Q S YTF + A D        ++++  V+I + D NDN+P+FI  P+  +Y++ L    P G++V  V A+D D+G+N+++++ +       LF+I++ +G +       V   G   + +KA D G P
Sbjct:   33 EMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDRE---KLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYT-LPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSV-TQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDRE-ETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNV--PSIDIRYIVNPVNDTVV-LSENIPLNTKIALITVTDKDADHNGRVTCF----TDHEIPFRLRPVFSNQFL---LETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINY-------LLGPDAPPEFSLDCRTGMLTVVKKLDREKE-DKYLFT----ILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGT---VGLITVTDPDYGDNSAVTLSILDEN-DDFTIDSQTGVIRPNISFDREKQES-YTFYVKAEDGGR---VSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNP-GTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 759          
BLAST of Protocadherin alpha-11 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 181.03 bits (458), Expect = 1.713e-45
Identity = 184/676 (27.22%), Postives = 314/676 (46.45%), Query Frame = 1
Query:  382 IQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNN-ISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSL-NVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRI-QWDTSLYDPNKLIKVESNCQIIAIQS-LDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRN---ILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGE 2388
            + +LD  DN P + ++S   E+ E+  + +  L +  ARD D   N  I Y   E   K     + KS       ++    +DRE +S   + ++A D GTP +  +  + I ++DVNDN P+F S  Y  +I  N+ I + +   + ATD D   N    +S+ +   I     D +     LR +   K+    +  R    A D  +P   S   +T+++ + N + P+++      +I + EN  IG  +      D DSG +G    S+   +++ I         E+  +I   T K+ DRE   R  L +  +D G P+ NTS  I++++ D+NDN+P F+K+ Y+ TI EE      I  L A D D+  + ++ YRI + D  ++    ++ +     I+++   L R+ +          ++ ATD G  Q  G   V++ + D+N + P F    +++   E          V    A D D G N  + YSI       F+++P+SG++     +DRE + + ++  +TA D  +  L   T    + ++++D NDN P F     S+Y   +S  +PVG+    V AID D G N  + + L E   +    LF ++ TSG L  S+ L         L I A D G+P L+A  ++T+ + +
Sbjct:  258 VHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSV-FARDLDSGENGEIEYSLGEGNGKNLLAINAKSG-----VIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVI-ATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAKNSPITAVIR----AKDGAQPALSSTVPLTINVIDINDHAPTLI--AAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFII--------DEDSGLIK--TTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDE--DQKITYRIEEADREVF---SILDIGDQGAILSVSGELKRQDHK------VRVEISATDQGGLQ--GRCVVNVFIDDVN-SAPYFNDHPFSVKIPE---HSPIGYPVITLKAEDHDRGDNARIVYSIDSSQF--FRIDPSSGDISVSSDLDREDR-ATFSVIVTASDHASPPLNTST---QIEVILDDINDNSPQF---TSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSD 884          

HSP 2 Score: 140.969 bits (354), Expect = 3.018e-33
Identity = 169/632 (26.74%), Postives = 288/632 (45.57%), Query Frame = 1
Query:  373 ILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQS-LDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLP----FKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINE 2253
            ++EI ++D NDN P ++ +S  + ++EN  + +    + KA D D   N   +Y +  +S    ++ + S   +     LR  ID +  S     + A DG  P+ + ++ L I +ID+ND+ P   ++    +++ N+ I   +  +++A D D   N   ++S+       + F ++  + +++  K L  E  A  Y   + A D G P   + TT+ + LK+ N   P+      N  + I E    G  I+T    DND   D K    I E  + ++   ++    +  AI+S ++ ++  ++ K R++  I   D G         +++ I DVN ++P F    +   I E +   + +  L A D D G NA++ Y I       D ++  +++ +   I++ S LDRE      R      V A+D   P  + ST + + L DINDN P F  + Y  +  ED     +  +V+   A D D G NG V Y +   +  P    F+L+  SG L     +DRE Q +     I ARD  T  L   +A   +++ + D NDN P F    + +Y + ++   PVGS V  + A D D G N+ I F +       LF I E
Sbjct:  360 MVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATV-KATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEV----TLRERIDAK-NSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVG-RVYAIDEDSGPNGIIKYSME----GSEDFIIDEDSGLIKTTKLLDRETTA-RYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYN--VTISEEMPRGSQIITLKAVDNDE--DQKITYRI-EEADREVFSILD--IGDQGAILS-VSGELKRQDHKVRVE--ISATDQG--GLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI-------DSSQFFRIDPSSGDISVSSDLDRED-----RATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVS---AIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDRE-QFAVIVLPIFARDRGTPSL---SAASEITLTLSDVNDNAPTF---EQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEE 944          

HSP 3 Score: 134.806 bits (338), Expect = 2.348e-31
Identity = 120/418 (28.71%), Postives = 203/418 (48.56%), Query Frame = 1
Query: 1201 EPKNYDIILTMNKTKSENIAIISLITNKI-----FDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPN--KLIKVESNCQIIAIQS-LDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRET-LLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGEFRNPDSTPFNETE 2427
            +P  Y ++   + ++S+N+  +  ++ +I      DREV  +  L +   +   P  + S  + + ++DV DNSP FEK+ Y   I E+     T+  + A DLD G N ++ Y      SL + N   L+ + +   +I   + LDRE        +    VIA+D G P+R  +  V I ++D+NDN PVF    YN++ LE+         +A   A D DFG NG V YS+   + +    ++ ++GE+   + +D +  P   T  I A+D     L   ++TV ++I + D ND+ P  I    +   I L   V +G  V  V AID+DSG N  I++ +E  +    F I+E SG + T+ +L        +L + A D G+P L     + + + +  N ++  F++ E
Sbjct:  195 QPLYYSMVAPQD-SRSQNLFTLDTMSGEIRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEY------SLGEGNGKNLLAINAKSGVIQTAAPLDRETLS-----LIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPA---VIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAKNSP--ITAVIRAKDGAQPAL---SSTVPLTINVIDINDHAPTLI---AAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED---FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDI-NDNAPTFDKKE 585          

HSP 4 Score: 134.035 bits (336), Expect = 3.585e-31
Identity = 171/702 (24.36%), Postives = 301/702 (42.88%), Query Frame = 1
Query:  406 NVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPT---SKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIV---RETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGEFRNPDSTPFNETEESFLSDQATFIIVGIILGTFFI 2493
            N   + Q   V E+ E+T +++    + KA  +   P  + Y  + P    S+  F     S +     ++L + +DRE++  H + + A +   P+ + S  +++ ++DV DN PIFE   Y   I  +  I +T+ L + A DLD   N    +SL      ++   +N  + +++    L  E   S  R  + A D G P  +S   V + + + N   P  +   ++  + I+EN  I  VI T    D D G +GK + S+         LT++ +  E + +   I  K       + I  +I  KD  +PA +++  ++I +ID+ND++P         T+ E       + ++ A D D G N  ++Y      S+      I  E +  I   + LDRE      R+    +V A D G P  + STT+++ L DINDN P F +  YN++  E+       R   +      D   +  +TY I    RE      +      L     + R+    +   S T +               V++ I+D N + P F   N+  + +++    P+G  V  +KA D D G N++I + ++  +    F I+ +SG++  S+ L    +   ++ + A D  SP L    Q+ + + +  N +S  F        S  A  I   I +GT F+
Sbjct:  161 NAVHFQQEKYVKELPEDTPIETIIASV-KASHASSQP--LYYSMVAPQDSRSQNLFTLDTMSGE-----IRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTV-LSVFARDLDSGENGEIEYSLG-EGNGKNLLAINAKSGVIQTAAPLDRETL-SLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAP--VFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIG-GLTIDYSTGE-VTLRERIDAK------NSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKY------SMEGSEDFIIDEDSGLIKTTKLLDRETTA---RY--SLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEM-----PRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQGG-------LQGRCVVNVFIDDVN-SAPYF---NDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQ---FFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDI-NDNSPQFTS------SSYAATISEDIPVGTSFL 804          

HSP 5 Score: 90.5077 bits (223), Expect = 7.727e-18
Identity = 134/557 (24.06%), Postives = 226/557 (40.57%), Query Frame = 1
Query:  190 PSDTTKFKLIKNRFFQIENGDNL-KVSGLIDRDDNLELCAYRNVNFSCIWRGILFCGTNNLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEIN-STLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRI--QWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPD 1848
            P+   K+ +  +  F I+    L K + L+DR+           +     R +     N    + + + D NDN P + +    + + E     S  + L KA D+DE  +    Y+IE   +  F   +  ++G    L +   + R+      V + A D G     G   + + I DVN + P F    ++  I  +  I    + LK    D   NA + Y    +        F ++P +  + V   L  E  A+ +   + A DH  P   + T + + L + N   P        A I   E+  +G   L     D D G +G  +  + E  +   I      ++      +L  +   DRE    I L IF +D G P+ + ++EI++ + DVNDN+P FE+  Y   I E +    T+  + A D D+G NA + +RI    D  L+D  +  +     +I+     D E   N F F      +   SG  Q S +  V I + D+NDN P  +     +  +  F + + +R++    A DPD
Sbjct:  510 PNGIIKYSMEGSEDFIIDEDSGLIKTTKLLDRETTARY------SLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITL-KAVDNDE--DQKITYRIEEADREVFSILDIGDQG--AILSVSGELKRQDHKVR-VEISATDQG--GLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSS------QFFRIDPSSGDISVSSDLDREDRAT-FSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATIS--EDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSG----TLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFF-----ELQASSG--QLSSTVPVRIHVSDVNDNKPALKDF---VILMNRFDNVQMARQIGFIPAFDPD 1028          
BLAST of Protocadherin alpha-11 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 151.754 bits (382), Expect = 1.326e-36
Identity = 155/565 (27.43%), Postives = 264/565 (46.73%), Query Frame = 1
Query:  712 IKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSL-NVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRI-QWDTSLYDPNKLIKVESNCQIIAIQS-LDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRN---ILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGE 2388
            I ++DVNDN P+F S  Y  +I  N+ I + +   + ATD D   N    +S+ +   I     D +     LR +   K+    +  R    A D  +P   S   +T+++ + N + P+++      +I + EN  IG  +      D DSG +G    S+   +++ I         E+  +I   T K+ DRE   R  L +  +D G P+ NTS  I++++ D+NDN+P F+K+ Y+ TI EE      I  L A D D+  + ++ YRI + D  ++    ++ +     I+++   L R+ +          ++ ATD G  Q  G   V++ + D+N + P F    +++   E          V    A D D G N  + YSI       F+++P+SG++     +DRE + + ++  +TA D  +  L   T    + ++++D NDN P F     S+Y   +S  +PVG+    V AID D G N  + + L E   +    LF ++ TSG L  S+ L         L I A D G+P L+A  ++T+ + +
Sbjct:    4 ITVVDVNDNAPVFASDSYNVTILENITIPAVI-ATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAKNSPITAVIR----AKDGAQPALSSTVPLTINVIDINDHAPTLI--AAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFII--------DEDSGLIK--TTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDE--DQKITYRIEEADREVF---SILDIGDQGAILSVSGELKRQDHK------VRVEISATDQGGLQ--GRCVVNVFIDDVN-SAPYFNDHPFSVKIPE---HSPIGYPVITLKAEDHDRGDNARIVYSIDSSQF--FRIDPSSGDISVSSDLDREDRAT-FSVIVTASDHASPPLNTST---QIEVILDDINDNSPQF---TSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSD 525          

HSP 2 Score: 140.969 bits (354), Expect = 2.866e-33
Identity = 166/632 (26.27%), Postives = 287/632 (45.41%), Query Frame = 1
Query:  373 ILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQS-LDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLP----FKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINE 2253
            ++EI ++D NDN P ++ +S  + ++EN  + +    + KA D D   N   +Y +  +S    ++ + S   +     LR  ID +  S     + A DG  P+ + ++ L I +ID+ND+ P   ++    +++ N+ I   +  +++A D D   N   ++S+       + F ++  + +++  K L  E  A  Y   + A D G P   + TT+ + LK+ N   P+      N  + I E    G  I+T    DND      +    +E  + ++   ++    +  AI+S ++ ++  ++ K R++  I   D G         +++ I DVN ++P F    +   I E +   + +  L A D D G NA++ Y I       D ++  +++ +   I++ S LDRE      R      V A+D   P  + ST + + L DINDN P F  + Y  +  ED     +  +V+   A D D G NG V Y +   +  P    F+L+  SG L     +DRE Q +     I ARD  T  L   +A   +++ + D NDN P F    + +Y + ++   PVGS V  + A D D G N+ I F +       LF I E
Sbjct:    1 MVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATV-KATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVT----LRERIDAKN-SPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVG-RVYAIDEDSGPNGIIKYSME----GSEDFIIDEDSGLIKTTKLLDRETTA-RYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYN--VTISEEMPRGSQIITLKAVDNDEDQKITYR---IEEADREVFSILD--IGDQGAILS-VSGELKRQDHKVRVE--ISATDQG--GLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI-------DSSQFFRIDPSSGDISVSSDLDRED-----RATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVS---AIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDRE-QFAVIVLPIFARDRGTPSL---SAASEITLTLSDVNDNAPTF---EQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEE 585          

HSP 3 Score: 90.1225 bits (222), Expect = 9.758e-18
Identity = 134/557 (24.06%), Postives = 226/557 (40.57%), Query Frame = 1
Query:  190 PSDTTKFKLIKNRFFQIENGDNL-KVSGLIDRDDNLELCAYRNVNFSCIWRGILFCGTNNLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEIN-STLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRI--QWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPD 1848
            P+   K+ +  +  F I+    L K + L+DR+           +     R +     N    + + + D NDN P + +    + + E     S  + L KA D+DE  +    Y+IE   +  F   +  ++G    L +   + R+      V + A D G     G   + + I DVN + P F    ++  I  +  I    + LK    D   NA + Y    +        F ++P +  + V   L  E  A+ +   + A DH  P   + T + + L + N   P        A I   E+  +G   L     D D G +G  +  + E  +   I      ++      +L  +   DRE    I L IF +D G P+ + ++EI++ + DVNDN+P FE+  Y   I E +    T+  + A D D+G NA + +RI    D  L+D  +  +     +I+     D E   N F F      +   SG  Q S +  V I + D+NDN P  +     +  +  F + + +R++    A DPD
Sbjct:  151 PNGIIKYSMEGSEDFIIDEDSGLIKTTKLLDRETTARY------SLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITL-KAVDNDE--DQKITYRIEEADREVFSILDIGDQG--AILSVSGELKRQDHKVR-VEISATDQG--GLQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSS------QFFRIDPSSGDISVSSDLDREDRAT-FSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATIS--EDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSG----TLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFF-----ELQASSG--QLSSTVPVRIHVSDVNDNKPALKDF---VILMNRFDNVQMARQIGFIPAFDPD 669          

HSP 4 Score: 86.2705 bits (212), Expect = 1.338e-16
Identity = 72/240 (30.00%), Postives = 119/240 (49.58%), Query Frame = 1
Query: 1711 VSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRET-LLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGEFRNPDSTPFNETE 2427
            V I ++D+NDN PVF    YN++ LE+         +A   A D DFG NG V YS+   + +    ++ ++GE+   + +D +  P   T  I A+D     L   ++TV ++I + D ND+ P  I    +   I L   V +G  V  V AID+DSG N  I++ +E  +    F I+E SG + T+ +L        +L + A D G+P L     + + + +  N ++  F++ E
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILENITIPA---VIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAKNSP--ITAVIRAKDGAQPAL---SSTVPLTINVIDINDHAPTLI---AAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED---FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDI-NDNAPTFDKKE 226          
BLAST of Protocadherin alpha-11 vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 150.599 bits (379), Expect = 3.270e-36
Identity = 174/663 (26.24%), Postives = 286/663 (43.14%), Query Frame = 1
Query:  382 IQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKI--EPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDC-FDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSI----LLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKF---NCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCG 2340
            +++ DENDN P ++   + +E+ E  +L + +  LP   D D    ++  + I     +  F ++S K N+ ++  L +   +DRE    + + + A DGG P+K G L+  I+IID NDN P+F  S YT S+  N+ I S L + + ATD DI  N    + +       +  F ++    I      L     AS +   + A DHG P   S   VT+ +    L  P +    L+  N+A   ++EN  +G ++    V       D K      S L P+  D              +  L+   I DRE  +   L    +  G+          + I D+NDN+PQ+     H ++   N+       LTA D D G N  +RY +  DT L   +K        +I    ++D             ++V A D G P  S    V  +L+D     P F++A + +   ED        KV   +A++   G +  + YS+  +      ++  SG +      D E Q S Y  ++ A ++ +     +T+T  +SI ++D NDN PIF +PNE  Y + +         + +V A D DSG   ++ + +  E  +  FSIN  +GE+     L+   +G   L + A D G
Sbjct:  110 VEVDDENDNAPSFADQVVKLEISEFAQLGTSF-ALPTVTDGDGPKFDVHRFVILQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHL-ITVQATDADIGENSRISYDIKKTSAPSNSNFAISQSGVITTTASLLP----ASTHDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESNSA--HLMENSTLGSIV--ARVSIAQQYRDTKLRLIGSSALCPQQTD-----------QAHVYLLLLCGILDRETASEHHLKFLLEKDGQ--IIIEHPQLLTIGDINDNAPQWHSSQIHISL---NRTQGGSRTLTAKDPDLGQNGWIRYSV-LDTELVSIDK-----ETGRIFVPNTID-----CNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKV---VANNSQCGNSKRIRYSLQNQDEH-LTVDTMSGTVCIQKTFDFEKQKS-YQTTVIATNANS-----ETSTSLISIRLKDVNDNWPIF-YPNE--YHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSS--FSINPVTGEVFAQKPLA---RGRFHLVVSAKDGG 717          

HSP 2 Score: 98.2117 bits (243), Expect = 3.435e-20
Identity = 182/726 (25.07%), Postives = 307/726 (42.29%), Query Frame = 1
Query:  124 QIFENLPVGSVICKLSNVIIPRPSDTTKFKLIKNRFFQIENGDNLKV-----SGLIDRDDNLELCAYRNVNFSCIWRGILFCGTNNLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDRE--VKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIAT-DSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIV-RETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLT 2274
             + EN  +GS++ ++S   I +    TK +LI +     +  D   V      G++DR    E  +  ++ F     G +      L    + I D NDN PQW  + I I  +  T+  S  L    A+D D   N    Y +  T     +S +K    I  F+     ID  + S     + A DGG+P+ +  LQ++  ++D     P FE + +   I  +  I + L +K+ A +     +   R+SL       +   ++  +  + ++K+   E   S Y+ ++ A +     E S + +++ LK+ N   P I  P N   + + E       +L     D DSG  G+ +  IL             ++S + + I+ +T ++F ++   + R  L++  KD G  +   SA I I +ID +  +PQF +  Y     E+  P   I  +       G  ++++Y I   +   D N  I  E   +I   + LD + +           + AT  SGE   S  T V I + D NDN P F  +   IS  ED    K      V  A D D   NG+V YSI+        +++  +G+L +  L+D E     Y   + A D     +  +++ +++ I + D NDN P F    +S Y +++    P  ++V  V A DKDS  N QI + +        F I+E  G + T
Sbjct:  349 HLMENSTLGSIVARVS---IAQQYRDTKLRLIGSSALCPQQTDQAHVYLLLLCGILDR----ETASEHHLKFLLEKDGQIIIEHPQL----LTIGDINDNAPQWHSSQIHIS-LNRTQGGSRTL---TAKDPDLGQNGWIRYSVLDTE---LVSIDKETGRI--FVP--NTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCL-VKVVANNSQCGNSKRIRYSLQNQ---DEHLTVDTMSGTVCIQKTFDFEKQKS-YQTTVIATNANS--ETSTSLISIRLKDVNDNWP-IFYP-NEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHIL-------------SESSSFS-INPVTGEVFAQKPLARGRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSV-------GAMSKVKYSIY--SGDQDHNFSID-EDTGKIYVTRYLDADVHDTVL-----LNIQATLPSGE---SNQTQVVIFIEDHNDNPPQFSSSLVEISIREDL---KLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLSTGSLLDYEAT-RNYKLRVKATDLG---IPPRSSNMTLFIHVLDVNDNAPEF---EKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGSE--YFGIDEKLGNVYT 999          

HSP 3 Score: 97.4413 bits (241), Expect = 5.604e-20
Identity = 180/784 (22.96%), Postives = 318/784 (40.56%), Query Frame = 1
Query:  127 IFENLPVGSVICKLSNVIIPRPSDTTKFKLIKNRFFQIENGDNLKVSGLIDRDDNLELCAYRNVNFSCIWRGILFCGTNNLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPF--------LKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIR--IIENQDIGVVILTGVVKDNDSGMDGK-FNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQ-----SLDREKYPNGFRFVCPYQVI--ATDSGEPQRS--GSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQP--SQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGEFRNPDSTP 2412
            I E LP G  I KL     P  +  T + +++     I++  ++   G+I  +  L+       +   I  G    G      +++++ + NDNVP +   S    V EN ++ S Y+    A+D D    N++  +       +F+ S+ S +    F        + L   +D E++  H +T+ A DG   + T    L I + D+NDN P F    Y  ++            KI A DLD    +TY        I    F + P +  L +K           Y  ++ A D+G P   +   V++ +       P+       A  R  ++EN  IG+ I       N SG + + F+  I +P+   I  +++K          L      DRE +   +  +   +    +     +  +I++D NDN P F    Y+ ++ +       I Q+ A D D G N ++ YRI         N L  V  N    +IQ         +++PN       +Q++  A D G P R+  G   VS+++   + + P F    Y +  LED       +K    I      G+  D     ++E      ++  +GEL     +D E++P  S Y  S++  +        ++A V + IV+E  ++  P+F    +S+Y +Q+    P G  V  ++AID+D G++  +++ + + +  +   I E +G +     L V  +      I  +   SP   +   + +EIG F    S P
Sbjct: 1841 IDEGLPRGQFIAKLQ----PELAGLT-YSIVEG---NIDSAFSVDSEGVIRTNLELDREILERYSLKVIGTG---SGQQIGTRVDVRVNNLNDNVPSFPM-SKPRRVPENLRVGS-YVATVGAKDVD----NLAPLR-------YFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATDGSFDTFT---NLTIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLDARGALTYSLGQGSSSI----FRVAPESGALFMKV---LPPAGERYLVTVTATDNGVPSFSTSVPVSVIIGEAE---PTDKPGFEKAEFRFEVMENSKIGLQI------GNLSGEESREFHYRIQDPEASKI-FSIDK-------FGRLFVAGPIDREQRATHEFQVEIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRI------LSGNDLNIVTLNPDTGSIQLNEWNDAQLDEFPN-----ATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLEDTSVGTVLQK----IRASNRLGMRNDGLLYSLKEHQGKLGIDVKTGELTLKTHLDWESEPIISMY-LSVSDGNG-------RSAVVPLKIVVEPVDEFAPVF---TKSSYTLQIPISTPAGESVGQMQAIDEDGGVHGVVKYSISDRQSTV--KIEEHTGIIRLQKPL-VSRRNLTIEQITVVAYSSPTKQSKTTVYLEIGPFDVQPSLP 2544          

HSP 4 Score: 93.2041 bits (230), Expect = 1.014e-18
Identity = 126/525 (24.00%), Postives = 223/525 (42.48%), Query Frame = 1
Query:  373 ILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHP-NNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDC-FDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSE-NIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTY-SIVRETLLPFKLNPNSGELY 1935
            ++ I++ D NDN P +  N   + V E  K +   L +  A D D      +SY+ +  +S +            KP  + R           ++ + A DGG  S   S  + I +ID +   P F  S Y        EI +T D+        + A    ++S+      QD  F ++     + V + L  +   +        L  G   E ++T V + +++ N  PP      +++++ I   +D+ +     VV+ +D   D K N  +     Y II +   +  E +     L T  + D E     +L +   D G P  +++  + I ++DVNDN+P+FEK +Y   + E + P   + ++ A D D   N Q+ YRI   +  +  +     E    +   +S+DRE   +         ++A D G P RS + +  I ++D+NDN P    +  +I+ +        S  +   +A DPD G+NG V Y + ++ +L   K N   G++Y
Sbjct:  626 LISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVV-SASDMDSGTFGEVSYHILSESSSFSINPVTGEVFAQKPLARGR----------FHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKY--------EIRTTEDILPGIAIGSVGAMSKVKYSIYSGD--QDHNFSIDEDTGKIYVTRYLDADVHDTVLLNIQATLPSG---ESNQTQVVIFIEDHNDNPPQF----SSSLVEISIREDLKLHEPFYVVQASDK--DKKKNGEV----RYSIISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGSEYFGID-----EKLGNVYTKRSIDREVISH-----VDISIVAEDKGVPPRSSTASARISVLDVNDNPP----SCLSITPIVVPAGSPLSTAIGTIVAMDPDKGLNGSVLYRAQLQSSLFVVKSN---GDVY 1099          

HSP 5 Score: 92.8189 bits (229), Expect = 1.445e-18
Identity = 148/608 (24.34%), Postives = 253/608 (41.61%), Query Frame = 1
Query:  601 FLKLRRGI-DRELISWHNVTLLAVDGGTPSKTGSLQL----LIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHEC-FASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAV--IRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLED------FGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEI 2382
            +L L  GI DRE  S H++  L        K G + +    L+ I D+NDN P + SS     I  +L         + A D D+  N   R+S+    +  +   ++     + V  ++  +C   SE +F + A D G P   +   V   L +    PP        A+  + I E+  IG  ++  V  ++  G   +   S+   +N D  LT++ T S  + I      K FD E +   Q  +   +    +  +++ ISI + DVNDN P F    YH T+ E  +P   +  ++A D+D G   ++ Y I  ++S +  N +       ++ A + L R +    F  V    V A D G      S  + I ++D +   P F ++ Y I   ED       GS     KV   I        +GD  ++        F ++ ++G++Y    +D +   +    +I A      L   ++    V I IED NDN P F   + S  +I +   + +     +V+A DKD   N ++++ +          I++ +G+L T ++L         L +KA D G P  ++   L I +
Sbjct:  393 YLLLLCGILDRETASEHHLKFLL------EKDGQIIIEHPQLLTIGDINDNAPQWHSS----QIHISLNRTQGGSRTLTAKDPDLGQNGWIRYSV----LDTELVSIDKETGRIFVPNTI--DCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQF----EKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSL---QNQDEHLTVD-TMSGTVCI-----QKTFDFEKQKSYQTTVIATNAN--SETSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSSFSINPV-----TGEVFAQKPLARGR----FHLV----VSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGAMSKVKYSI-------YSGDQDHN--------FSIDEDTGKIYVTRYLDADVHDT-VLLNIQA-----TLPSGESNQTQVVIFIEDHNDNPPQF---SSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHV 932          

HSP 6 Score: 74.7146 bits (182), Expect = 5.266e-13
Identity = 83/287 (28.92%), Postives = 128/287 (44.60%), Query Frame = 1
Query:  337 RGILFCGTNNLKILEIQILDENDNVPQWSQNSIVIEVVENTKL-DSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFL-KLRRG--IDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDI--NANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDG 1179
            +  L  G +N   + I I D NDN PQ+S + + I + E+ KL + FY+   +A D D+  N    Y I         S   S+  I  F  +L  G  +D E    + + + A D G P ++ ++ L I ++DVNDN P FE S+YT  +  N     T+  K+ A D D   N  + YR +    +     F ++     +  K+S+  E   S    SI A D G P   S  +  + + + N  PPS L   +   I +     +   I T V  D D G++G
Sbjct:  810 QATLPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVV--QASDKDKKKNGEVRYSI-------ISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLEN-SPPKTIVGKVVARDKDSLENGQIVYRITNGSEY-----FGIDEKLGNVYTKRSIDREVI-SHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCL---SITPIVVPAGSPLSTAIGTIVAMDPDKGLNG 1077          

HSP 7 Score: 55.4546 bits (132), Expect = 3.423e-7
Identity = 81/285 (28.42%), Postives = 128/285 (44.91%), Query Frame = 1
Query: 1561 NKLIKV-ESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHD-PDFGVNGDVTYSIVRETLL-PFKLNPNS-GELYSYDLV-----DRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEK--RNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEI 2382
            +K +KV E + +I  I  LD EK  + F  V    V   +SGE     +  + +E+ D NDN P F      +   E F     S  +      D P F V+    + I++  +   FKL      E    DLV     DRE +  +Y   I A+D        K   +  SI I D NDN P+F   + S Y   +S  + +GS +  V+A D D G NS+I + +++     N  F+I+++    + +T  S++      + + A D GSP L++   +TI +
Sbjct:   66 SKFLKVDERSGEISTIAHLDYEKR-SKFDIVA---VKVEESGE-----TIDILVEVDDENDNAPSFADQVVKLEISE-FAQLGTSFALPTVTDGDGPKFDVH---RFVILQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFR-DKYELLIEAQDGGKPA---KIGQLRCSIEIIDANDNAPVF---SRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSNFAISQSG---VITTTASLLPASTHDVIVVASDHGSPSLSSSAVVTITV 327          

HSP 8 Score: 55.4546 bits (132), Expect = 3.662e-7
Identity = 94/387 (24.29%), Postives = 159/387 (41.09%), Query Frame = 1
Query: 1270 LITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSI-----VRETLLPF----KLNP-NSGELYSY-----DLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQF-ILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEI 2382
            L+ N   DRE + + +L+I  +D GKPA       SI IID NDN+P F +  Y  ++         +  + A D D G N+++ Y I+  ++  + N    +  +  I    SL     P     V    V+A+D G P  S S  V+I ++    + P       +I +L +  S           AH  +    G +   +      R+T L       L P  + + + Y      ++DRET    +   +  +D    + + +  T+       D NDN P +      + +I +S     G   TL  A D D G N  I++ +L+ E    L SI++ +G +     +      E    ++A D GSP L+   Q+  ++
Sbjct:  185 LVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSN--FAISQSGVITTTASL----LPASTHDVI---VVASDHGSPSLSSSAVVTITVLGSTLSSPPL-----DIIWLVESNS-----------AHLMENSTLGSIVARVSIAQQYRDTKLRLIGSSALCPQQTDQAHVYLLLLCGILDRETASEHHLKFLLEKDGQIIIEHPQLLTIG------DINDNAPQW-----HSSQIHISLNRTQGGSRTLT-AKDPDLGQNGWIRYSVLDTE----LVSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADL 530          
BLAST of Protocadherin alpha-11 vs. Ensembl Celegans
Match: cdh-4 (Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI5])

HSP 1 Score: 105.145 bits (261), Expect = 2.377e-22
Identity = 163/681 (23.94%), Postives = 288/681 (42.29%), Query Frame = 1
Query:  361 NNLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLN---VPFIV---QDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAV--IRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKD-----FGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQ---LRYRIQWDTSLYDPNKLIKVESNCQII---AIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTN----LLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAID 2334
            +++K ++++I D N++ PQ+ + S  + + EN K      ++  A D D   N    + +    +   + S  +  GI   +KL + +DRE    H   ++A D G P +     L I + DVNDN P          I  +L   + +   + A D DI  N   +F LN   VPF +     C  ++     L   K+         +  SI+  DHG P+    T+  LH++  ++    + +  ++      + EN +IG  ++  +++  ++G + K     LE   Y II              ++ T  + DRE K+   + +  +D     +  P       + I I+D ND+ P  +K  Y  ++ E +  N  I ++ A D DD  N     L ++I+      DP    +++     I    I+ LDREK      +V        D GEPQ   +  V + ++D NDN P F QA ++ S    F       K+    A D D G N  +TY+I  E    F ++ N+G + + + +  +     Y  ++ A D  T        R   T + +      + N P  I   +S+Y I +S    VG  V  ++A D D     ++ + +     + +F + + +G+LL +  + ++ +GE  L I   D
Sbjct:  701 SSVKTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDIFKV-TANDFDGGNNGKIKFSLGNNQEKSSVISIDAKTGI---VKLLKSLDREDQDVHTFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCVVQHSRARIPEDLPHGAFVSC-MAAFDEDIGQNSKLKFLLNSEKVPFRIDHHSGCIFIHAPEYPLDYHKT-------PFFNLSIEVADHGDPI--LSTSCHLHVELVDIAHNHLAIEFDDVAKEASVYENSEIGTEVI--MIEAKETGDEQKVKAENLE---YRIIGGDGWPHFSIDQKGTVRTTHLLDRETKSAYWITVEARDSKTDLYKDPRRRDVLHVFIRILDRNDHRPVAKKPMYIASVAENSPANVVIVKVEATDADDVDNDAAAPLMFKIERG----DPQSFFRIDLTSGYITTSGIRRLDREKQSEHELWVS-----ICDGGEPQLCSNVIVIVNVLDENDNSPTFTQAIHHYSVRSKFAG-----KLCRIFAVDADEGENARLTYNIT-EGDARFSID-NNGNIIASEAIHGD---ESYALTVQATDHGTPGQQFAATRVVLTANSAGQKPRKSKNSPPEISGKKSDYVIPISDADQVGLTVGKLEASDAD---GDELWWSISSGDPDSVFDVRQDTGQLLLAKKVELLKRGELRLNISVTD 1340          

HSP 2 Score: 104.76 bits (260), Expect = 4.010e-22
Identity = 108/451 (23.95%), Postives = 214/451 (47.45%), Query Frame = 1
Query:  646 HNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDI--NANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYP----PSILLPGNNA----------VIRIIENQDIGVVILTGVVKDNDSGMDG--KFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIA-IQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIP--VFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELY 1935
            +N  ++A   G   K     + I+I+D ND+ P+F + +  Q+     +    L +K+ ATD D   N  + Y+F+  +P       ++N     + + +  K     + +  ++ A+D G P+ +      +  KN    P    P I+    N           ++ + E+  IG V+      D D+G +G  ++    +   ++++ LT+++   E I + S ++  + ++     +QL +   D G P  ++   + + I DVN++SPQF++  Y+  I E  +P   I ++TA+D D G N ++++ +  +    + + +I +++   I+  ++SLDRE      + V  + +IA+D G P R   T ++I + D+NDN P  V Q +   I   ED     +   V+   A D D G N  + + +  E  +PF+++ +SG ++
Sbjct:  458 YNFKVIASLHGINEKLAEKDVSIEILDSNDHAPVFSAKWMRQTPIVIGKPGDVL-VKVDATDQDEGENGKIVYKFTSELPL------EINANTGEITLVEVPKK---GNSWPATVWAIDLGLPLSRMSALNLMFYKNGTKIPAKPKPIIIQESENKHSPVFSSFPEIVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHEV-LTVDEQSGE-ITVASDLSKLMKEKLEVLDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLGNNQ---EKSSVISIDAKTGIVKLLKSLDRED-----QDVHTFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCVVQHSRARIP--EDL---PHGAFVSCMAAFDEDIGQNSKLKFLLNSEK-VPFRIDHHSGCIF 882          

HSP 3 Score: 92.4337 bits (228), Expect = 1.939e-18
Identity = 86/359 (23.96%), Postives = 165/359 (45.96%), Query Frame = 1
Query:  706 LLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISF 1782
            L + +ID+ND  P F   FY+ SI  + +   T+ + + ATD D N  + Y     +       F ++P    + V K L+H+   +    +I A D   P   + TTV +++ ++++  P      ++ +  ++E+ D+G VI  G V+  ++ +D      +   +  D  L  +  +S       +I     DRE K + ++ I     G    +    +++ I DVNDN+P F  ++  +TI E+     ++   +A D DD  + ++R+ +  +   +D N     E++  +     LDREK  +       Y++IA  + E   +     +I + D+ND+ P F++  +NI  
Sbjct: 2491 LTLSVIDINDKPPFFVLPFYSTSISESAKEGDTV-MMVSATDDDENDTIEYSL---LDGSESQFFSVHPRQGTITVAKKLEHKAGVT-LSLTIKATDSANPPHHATTTVEVNIASESVKVPR--FSNSHYLFSVMEDADVGNVI--GRVQQMETEIDEIRFTIVPGSEESDSFLPFSVERSTG----KIIVKSSLDRERKNQWKMTIRADAAG--GVHAITTVTVDIGDVNDNAPAFHGDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSLVEENPYFDLN-----ENSGWLTVASQLDREKIDH-------YKLIARATDEGGFNTDLPFTIVVSDVNDSPPQFEKEEFNIDL 2822          

HSP 4 Score: 84.3445 bits (207), Expect = 5.227e-16
Identity = 193/793 (24.34%), Postives = 321/793 (40.48%), Query Frame = 1
Query:  133 ENLPVGSVICKLSNVIIPRPSDTT--KFKLIKNRF--------FQIENGDN-LKVSGLIDRDDNLELCAYRNVNFSCIWRGILFCGTNNL---KILEIQILDENDNVPQWS-----QNSIVIEVVEN--TKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTP-SKTGSLQLLIK-------------IIDVNDNK--PIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSL-NVPFIVQDCFDLNPFNAILRV----KKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQS--LDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPV--FQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLY--RKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQ---IQFILEEEKRNILFSINETSGELLTSTV--LSVIHKGEETLFIKAIDCGSPRL 2352
            E  P+G ++ ++ NV +  P D +  ++ L  ++         F I + +  L+VS  I+R +       R  NF  I       G N     K + I+ILD ND+ P +S     Q  IVI    +   K+D        A D DE  N    YK   TS+        +N G    ++    + ++  SW   T+ A+D G P S+  +L L+               II  ++NK  P+F S      +  +  I + +  K+ A D D   N   R+ + ++     +   ++  +  + V     K +K +    + +  + A+D G PV+ S  T+ L +K+ N + P       +  +RI EN+  G  I      D D G +GK   S+   +    +++++        I+ L+  K  DRE +      I   D G P   +   ++I + DVNDN P+   +     I E+      ++ + A D D G N++L++ +  +   +     I   S C  I      LD  K P          +   D G+P  S S  + +EL+DI  N     F       S  E+         +      D       ++ Y I+     P       G + +  L+DRET+ S Y  ++ ARDS T+L    R+   + V I I D ND+ P+   P    Y   ++   P   ++  V+A D D   N     + F +E       F I+ TSG + TS +  L    + E  L++   D G P+L
Sbjct:  394 EMAPIGRILYRM-NVNVENPDDVSLIRYSLEYSKSDLPNATLPFAIGSKNGILRVSAKINRSE-------RVYNFKVIAS---LHGINEKLAEKDVSIEILDSNDHAPVFSAKWMRQTPIVIGKPGDVLVKVD--------ATDQDEGENGKIVYKF--TSELPL--EINANTGEITLVE----VPKKGNSW-PATVWAIDLGLPLSRMSALNLMFYKNGTKIPAKPKPIIIQESENKHSPVFSSFPEIVEVTEDAPIGTVV-AKLQANDEDTGYNGFIRYVIHDIAGSSHEVLTVDEQSGEITVASDLSKLMKEKLEVLDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQ--FDEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLGNNQEKSSVISIDA----KTGIVKLL--KSLDREDQDVHTFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCVVQHSRARIPEDLPHGAFVSCMAAFDEDIGQNSKLKFLLNSEKVPF----RIDHHSGCIFIHAPEYPLDYHKTP-----FFNLSIEVADHGDPILSTSCHLHVELVDIAHNHLAIEFDDVAKEASVYENSEIGTEVIMIEAKETGDEQKVKAENLEYRIIGGDGWPHFSIDQKGTVRTTHLLDRETK-SAYWITVEARDSKTDLYKDPRRRDVLHVFIRILDRNDHRPVAKKP---MYIASVAENSPANVVIVKVEATDADDVDNDAAAPLMFKIERGDPQSFFRIDLTSGYITTSGIRRLDREKQSEHELWVSICDGGEPQL 1136          

HSP 5 Score: 77.7962 bits (190), Expect = 5.247e-14
Identity = 73/284 (25.70%), Postives = 136/284 (47.89%), Query Frame = 1
Query: 1657 YQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFI-----------AHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSIT-----ARDSPTNLLYRKTATVSVS-----IVIEDCNDNEPIFI-FPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEE--EKRNILFSINETSGELLTSTVLSVIHKG-----EETLFIKAIDCGSPRLTAIQQLTIEIGEFRNPDSTPFNE 2421
            ++VIA+  G  ++     VSIE++D ND+ PVF              S K  R+  + I           A D D G NG + Y    E  LP ++N N+GE+   ++  +        ++I      +R S  NL++ K  T   +     I+ E  N + P+F  FP      ++++   P+G++V  ++A D+D+G N  I++++ +     + + +++E SGE+  ++ LS + K      +  L + AID G+P  ++++ + + I +  N  S  F+E
Sbjct:  460 FKVIASLHGINEKLAEKDVSIEILDSNDHAPVF--------------SAKWMRQTPIVIGKPGDVLVKVDATDQDEGENGKIVYKFTSE--LPLEINANTGEITLVEVPKKGNSWPATVWAIDLGLPLSRMSALNLMFYKNGTKIPAKPKPIIIQESENKHSPVFSSFPE----IVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHEVLTVDEQSGEITVASDLSKLMKEKLEVLDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNN-HSPQFDE 722          

HSP 6 Score: 77.7962 bits (190), Expect = 5.291e-14
Identity = 94/365 (25.75%), Postives = 162/365 (44.38%), Query Frame = 1
Query: 1279 NKIFDREVKTRIQLIIFCKDF-GKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYD--PNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGD-VTYSIV-----RETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNY-KIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGS 2343
            +++ +     R Q+ +  +D  G+ AF+T   +++ +ID+ND  P F   FY  +I E  +   T+  ++A D D+  N  + Y      SL D   ++   V      I +     +K  +         + ATDS  P    +TTV + +   +  +P F  + Y  S +ED         V   I          D + ++IV      ++ LPF +  ++G++     +DRE + +Q+  +I A D+   +     A  +V++ I D NDN P F      +Y +  +S    VG+ VT+  A+D+D   + +I+F L EE  N  F +NE SG L  ++ L         L  +A D G 
Sbjct: 2462 SRVLNYHRDKRYQIPLVVEDATGRRAFST---LTLSVIDINDKPPFFVLPFYSTSISESAKEGDTVMMVSATDDDE--NDTIEY------SLLDGSESQFFSVHPRQGTITVA----KKLEHKAGVTLSLTIKATDSANPPHHATTTVEVNIASESVKVPRFSNSHYLFSVMED-------ADVGNVIGRVQQMETEIDEIRFTIVPGSEESDSFLPFSVERSTGKIIVKSSLDRERK-NQWKMTIRA-DAAGGV----HAITTVTVDIGDVNDNAPAF----HGDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSLVEE--NPYFDLNENSGWLTVASQLDREKIDHYKLIARATDEGG 2792          

HSP 7 Score: 77.0258 bits (188), Expect = 1.038e-13
Identity = 95/392 (24.23%), Postives = 172/392 (43.88%), Query Frame = 1
Query:  382 IQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPF----NAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKN---YDIILTMNKTKSENI-AIISLITNKIFDREVKTRIQLIIFCKDF-GKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLD-DGLNAQLRY 1527
            + ++D+NDN P + +++  ++V+E+   +S   EL   R S    N    Y ++P+    F++   +  GI   L L + +D E +S   +T++A D G P      Q+ I ++D NDN P FE   Y   +  N +    + L + A D+D        + L +         + PF    N  + + +S+ +E    +Y   + A D GRP  +S+  + +H++++N + P+      N    + E + IG  +L   V D    +DG        PKN   + + +  +  KS  +   + L+T K  +   K +  L +  KD  GK    T   ++I I   + ++P  +         +   P   I +L A D D +  N  LR+
Sbjct: 3101 VTVIDQNDNAPTFEKSTYSMKVMES---ESIGYELAHFRASGGDQNETIEYYLKPSDVTSFVNL-NAQTGI---LTLAKPLDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKFEKEKYVGKVKENSKSGEKV-LTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINSNGDVLISQSIDYEKI-KKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPT--FDDCNMTALVQEGEAIGHRLLKFSVSD----LDG--------PKNGAPFTVEIQGDGAKSFKVNEKLELLTAKKLEYRKKDKYLLTVIAKDVKGK---TTDCPLTIFIRQTSRHAPTMKPMKIQINTLQNELPEGIIGRLKASDEDEEDQNGLLRF 3466          

HSP 8 Score: 76.6406 bits (187), Expect = 1.208e-13
Identity = 128/548 (23.36%), Postives = 230/548 (41.97%), Query Frame = 1
Query:  706 LLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLD---LKIHATDLDINANVTYRFSLNVPFIVQD---CFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQ--WDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGD-VTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYL---VPVGSLVTLVKAIDKD-SGINSQIQFIL------------EEEKRNILFSINETSGELLT 2274
            + + I ++NDN+P         SID NL  +        +I A D D +  + +R       +V D    F ++  N ++ V K L  E     +  ++ A D      + K T+ + + +QN   P+     +   ++++E++ IG  +        D     ++    L+P +    + +N        I++L   K  D E  + ++L +  KD G P   T A++ I ++D NDN+P+FEKE Y   + E ++    +  + A D+D      + Y ++   +T+   P     + SN  ++  QS+D EK           +VIA D G P       + I + D ND+ P F     N++ L   G     R +  F   D D   NG   T  I  +    FK+N     L +  L  R  +  +Y  ++ A+D     +  KT    ++I I   + + P          KIQ++ L   +P G ++  +KA D+D    N  ++F L            +E +   LF ++  +G++ +
Sbjct: 2997 ITVVIENLNDNRPKIIEKLLKVSIDENLPTSEDARQYITRIVAEDADFD-EIKFR-------MVDDFGGLFQIDDINGVVTVVKPLDSEILGF-FNLTVVASDGEF---EDKATILVTVIDQNDNAPT--FEKSTYSMKVMESESIGYELAHFRASGGDQNETIEY---YLKPSDVTSFVNLNA----QTGILTLA--KPLDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKFEKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINSNGDVLISQSIDYEKIKK-----YNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTFDDC--NMTALVQEGEAIGHRLLK-FSVSDLDGPKNGAPFTVEIQGDGAKSFKVNEKLELLTAKKLEYR--KKDKYLLTVIAKD-----VKGKTTDCPLTIFIRQTSRHAPTM-----KPMKIQINTLQNELPEG-IIGRLKASDEDEEDQNGLLRFGLVEGSIQSPRAQVQESRSTHLFRVDPNTGDIWS 3500          

HSP 9 Score: 60.4622 bits (145), Expect = 1.020e-8
Identity = 54/180 (30.00%), Postives = 82/180 (45.56%), Query Frame = 1
Query:  376 LEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSD-EHPNNISYYKIEPTSKYFFISSEKSNKGIKPF-------LKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQ 891
            +EI ++DENDN P++ +   V +V EN+K     L + KA D D EH   +SY       +   +S   ++  + PF       + + + ID E I  +N+ ++A DGG P       L I + D ND+ P F+    T  +     I   L LK   +DLD   N         PF V+
Sbjct: 3202 VEISVMDENDNAPKFEKEKYVGKVKENSKSGEKVLTV-KALDVDSEHFGAVSY-------ELEIVSETTTDTPVLPFAINSNGDVLISQSIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTFDDCNMTALVQEGEAIGHRL-LKFSVSDLDGPKN-------GAPFTVE 3365          

HSP 10 Score: 51.6026 bits (122), Expect = 5.484e-6
Identity = 55/227 (24.23%), Postives = 96/227 (42.29%), Query Frame = 1
Query:  511 HPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINST------LDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKS--KTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDS 1167
            H   +SY K+EP   +F + +      +  +L        +L    +V   A+   T  +    +++ KII  N + PIF    Y  +I  N+   S+      L L + A D D  +N    + +  P   Q  F ++ ++  +R + S   E    EY F + A D G+P  +S   + + + + ++N  PP    P N+  I +I     GV +     +D DS
Sbjct: 1599 HHGTVSY-KLEPNCTFFEVHTLSGAVHLATWLT-------KLKHRKSVECTAIVESTEGQQDIAKVIAKIIRTNQHSPIFRRQVYRGTIRENMPTGSSVLSKSLLPLVVSAIDEDPGSNGLVGYRMLSPKDEQ-MFSVDQYSGAIRTQMSFDFEKM-KEYSFYVQAFDMGQPPRRSLMPSLIVVTVIDENDEPPR--FPSNSLDISMILPTANGVSVGGQTAQDMDS 1813          
BLAST of Protocadherin alpha-11 vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 98.9821 bits (245), Expect = 2.018e-20
Identity = 176/683 (25.77%), Postives = 274/683 (40.12%), Query Frame = 1
Query:  376 LEIQILDENDNVPQW---SQNSIVIEVVENT-KLDSFYLELPKARDSDEHPNN----ISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDI--NANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKH----ECFASEYRFSIDALDHGRP-VEKSKTTVTLH-LKNQNLYPPSILLPGNNAVIRIIENQDIGVVILT-GVVKDNDSGMDGKFNCSILEPKNYDIILTM-------NKTKSE---------NIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPN--------FTIAQLTAHDLD-DGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATD---SGEPQRSG----STTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRE--TLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSG-INSQIQFILEEEKRNILFSINETSGEL 2268
            L I I D N+N P++   ++ S + +++E T K D   +   +A D D   N       YY    + K F I  +       P +      DRE     +VT+ A D G     G  Q  ++++D+NDN P FE   Y  S+    E   T  + + A D D   NA +TY   ++     +   DL+ F  + R    +           ++ F++ A D+G P   +S   VTL+ L  Q   P     P     I + EN ++  VIL    V   DS             +N D+I  +       NK +S+             + ++  +  D E      L +   D      +T     + + DVND  PQF  + +  TI EE  PN          I  + A D D DG   ++ YRI  + +  +       E   +I   +  DREK       +    V A+D   S  P  +G    +  V I + D+NDN P F++  Y     E   S+     V    AHD D   N  + Y ++      +PF +  +SG ++  + +D E    QY   + A D       R  AT +V I IED NDN P F     +   I+    +P   ++  V A D D    +S+I + LE +  + +F I + SG +
Sbjct:  851 LLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVF----DRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSV-SRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDS-------------RNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKT-FVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKID-----MYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKE---SEGEGHDVITIKAHDLDKHSN--LRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEAS-DQYHLVLIASDG------RHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIP--KVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTI 1495          

HSP 2 Score: 97.0561 bits (240), Expect = 6.470e-20
Identity = 178/695 (25.61%), Postives = 290/695 (41.73%), Query Frame = 1
Query:  370 KILEIQILDENDNVPQWS----QNSIVIEVVENTKLDSFY---LELPKARDSD-EHPNNISYYKI-----EPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGS-------LQLLIKIIDVNDNKPIFESSFYTQSI-DCNLEINSTLDLKIHATDLDINANVTYRF----SLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRI---QLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQP----NFTIAQLTAHDLDDGL--NAQLRYRIQWDTSLYDPNKLIKVESNC-QIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDV-TYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLY----RKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAID 2334
            K   +++ D ND VPQ++      +I  E+  N  L+      +   KA D+D + P N  +Y+I        +K+F I  ++    I P  K     DRE I  + +T+ A D    +  G+       +++ I I DVNDN P FE   Y   + +   E +  + +K H  DLD ++N+ Y         +PF V+        +  + VK+ L  E  + +Y   + A D GR    + T V +H+++ N   P        A   I E+ DI  V+      D D           LE +  D +  + K        I L+  K  DR+    +     ++   D         A++ + + D+NDNSP F +  + Y I E  +P          + A D DD    NA + Y I  +  L +   + +++ N  +I A++SLDRE   +   F+   +V A D G P R G   V+I++ D+NDN P F++  Y  S  E   +      V  F A D D     +V TY +  E+   F +  +     S   V R  QP  Y   +T RD     +     R  A  +V + + D ND+ P      E   +      VP G+ +    A D+D+G  ++ +   + + +   F+I++  G L  +  L         L I+A D
Sbjct: 1195 KTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRI--DELTGEIFPNEKF----DREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAH--DLDKHSNLRYHLIGAGGGRIPFGVRTD------SGTIFVKEPLDFEA-SDQYHLVLIASD-GR--HNATTNVYIHIEDVNDNAPQ-FEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYS----GTIELV--KALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGY-IEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRN-KLINGESVFRIDQNTGKIFAMRSLDRE-ISSEREFII--EVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEE---TAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDY-FYVTTDKDSKQSSVGVLRVKQPLDYE-DVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHIHGATEHRVRED----VPRGTSIGRYTATDRDAGDTARFRINRQSDPKR-QFTIDQ-DGTLRVAHTLDREDIAVYNLIIEAYD 1848          

HSP 3 Score: 86.2705 bits (212), Expect = 1.308e-16
Identity = 140/591 (23.69%), Postives = 246/591 (41.62%), Query Frame = 1
Query:  541 EPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASE---YRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPS-ILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNK-TKSENIAIISLI--TNKIFDREVKTRIQLIIFCKDFG------KPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNF-----TIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQS---LDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFY--NISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLP---------FKL-NPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFIL 2214
            E  +K+F I     + GI    +L    D  L   H + + A +    ++   + L I+I DVNDN P F    YT  +  ++ +N T+ LK+ A D D   N    +S++        F +N  N  +  K  L  +        YRF++ A DHG PV  S + + +H++ +N    S + LP +     + E+   G  ++    +D D     +   S ++ KN      MN  +  E+  ++ L    +     E +  I L +  +D G           + A + I I DVN+N P+F     +  I +  +  +     TI ++ A D D   N  + Y + +  S  +  K   ++    ++        DRE  P          V ATD G+    G    S+E++DINDN P F++  Y  ++S  E  G+      V    A D D   N ++TYS+  +T            F+L N  SGE+     +  +TQ  ++ F++ A D+      + +A V+++++  D     P +    +    I +   V +  ++   +A+      NS + + L
Sbjct:  579 EDETKWFRIDP---STGIIHLTRLLDFDDPALPKLHKLKVTARED---NRESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTI-LKVTAVDKDTGDNSRITYSVD-----NHNFSINS-NGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAM-IHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADR---DEVTYSFMD-KNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQS--ESRKAFVIDRQTGVLTPSPHVVFDRETRPRE-----DVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGT-----SVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQ--KFIFNVIADDNGIPEALQSSAQVTLNVL--DKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKL 1135          

HSP 4 Score: 73.1738 bits (178), Expect = 1.200e-12
Identity = 102/390 (26.15%), Postives = 168/390 (43.08%), Query Frame = 1
Query: 1390 DVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEP-QRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIV------RETLLPFKLNPNSGEL---YSYDLVDRETQPSQYTFSITARDSPTNLLY---RKTATVSVSIVIEDCNDNEPIFIFPNESNYK-----IQLSYLVPVGSLVTLVKAIDKDSGINSQIQFIL---EEEKRNILFSINETSGELLTS--TVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGEFRNPDSTPFNETEESFLSDQATFIIVGIILGTFF 2490
            DVNDN P F +  Y   + E+   N TI ++TA D D G N+++ Y +         N    + SN +I A   LD ++  N   FV  + V A D GEP   S S  + I   + ND   VF       +F+ +    +    V    A D D     +VTYS +       + +  F ++ ++G +   +     D     +    ++  +D  +  +Y     T+  ++ I IED N+N+P   FP+ + Y      ++ +Y     ++V  V+A D DS  N  I + L   + E R   F I+  +G L  S   V     +  E + +KA D G   L    Q ++E+ +    D++P  E   S+ +  + F  VG  + T F
Sbjct:  634 DVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVD--------NHNFSINSNGEISAKVRLDADQL-NERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAE--DAQGGTPVIQIQARDAD---RDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKP--EFPDCAKYSDIAKIMEGTYKTDPPTIVK-VEATDDDSSANGDIVYSLYYTQSESRK-AFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDIN--DNSPQFE-RPSYETSVSRFEAVGTSVITVF 1002          

HSP 5 Score: 59.6918 bits (143), Expect = 1.522e-8
Identity = 118/495 (23.84%), Postives = 196/495 (39.60%), Query Frame = 1
Query:  376 LEIQILDENDNVPQWSQN--SIVIEVVENTKLDSFYLELPKARDSDEHPN---NISYYKIEP---TSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHN--VTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINA--NV-TYRFSLNVP--FIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSID-ALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSIL-EPK-----NYDIILTMNKT-KSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYT-----IFEENQP--NFTIAQLTAHDLDDG---------LNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDN 1743
            +++ + D NDN P + +     + E  E    D  Y    +ARD D+      NI Y  +       +  F   + + K     +   R +DRE+ S     + + A D G PS+ G   + IK+ D+NDN P FE + Y  S++    I + + +   A D D  A  NV TY+ S      ++  D         +LRVK+ L +E       F +   +  GR    ++  V + L ++N + P I     +   R+ E+   G  I      D D+G   +F  +   +PK     + D  L +  T   E+IA+ +LI     +     R  + ++ +                  DVNDN P+       YT     IF EN P       ++ A D D           ++   +Y  Q+   +++ N       +  I  +Q  DRE    G     P  ++A  +G   R    +V + + D+NDN
Sbjct: 1532 VQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGK-----IFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAV-MSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGR--HDAEAAVHVALVDRNDHAPHIHGATEH---RVREDVPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQFTIDQDGTLRVAHTLDREDIAVYNLIIEAYDNSNNIGRQMVAVYLQ------------------DVNDNGPE------PYTVPRPCIFRENTPVNQLGTCEIRATDRDTAEFGPPFTMEVSPSFKYS-QYLNVIFNANG-DGGNGSMTITPLQEFDREAPVPGKILEIPL-ILADRAG---RRNEASVHVIIGDLNDN 1985          
BLAST of Protocadherin alpha-11 vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0078045)

HSP 1 Score: 225.713 bits (574), Expect = 3.379e-59
Identity = 201/681 (29.52%), Postives = 328/681 (48.16%), Query Frame = 1
Query:  364 NLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEP--TSKYFFISSEKSNKGIKPF-LKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNV-PFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSI--LLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQS-LDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVR--ETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSL-----VTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGEL--LTSTVLSVIHKGEETLFIKAIDCGSPRLTA 2358
            N+++L + + DENDN P + Q S+ IE  ENT  +     LP ARD D  P N   Y I     +  F +SS +   G+    L++   +DRE    +++ + A+DGGTP   G + + I I DVNDN+PIF  S Y  ++  N  + +++ L+++A+D D + N    +++N      +  F ++P    + + K+L  E     +   + A DHG    ++   V++ + + N   P+I  +   ++A  +I E+   G  +    V D DS  +       L   +    LT   T+  +I ++  I +   DRE+ +   L +   D G P  + S  I + I DVNDN P+FE++ YH  + E   P  ++ Q+ AHD D+GLN+ L Y +      +   +  +++    +I  +S +D E  P     V    V+A D G P  S + TV + + D+NDN P+F Q+FYN+S  E+    +   KV+   A DPD GVN  V Y+I    + L  F++   SGE+     +D E + S Y F + A D         + T  + + + D NDN P+F +P E  YK+ L       S      +  V A D D G   Q+ + +       +F I+ ++GE+  +   +LSV  +    L I A D G+ R  A
Sbjct:  157 NIRVL-VTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLP-ARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSV-LQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFET-KELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALT---TRDNSIYLV--IVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETH--AQWFQIDPQTGLITTRSHIDCETEP-----VPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVS---ASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERR-SSYEFPVLATDRGG-----LSTTAMIKMQLTDVNDNRPVF-YPRE--YKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNA 809          

HSP 2 Score: 183.726 bits (465), Expect = 3.343e-46
Identity = 186/697 (26.69%), Postives = 302/697 (43.33%), Query Frame = 1
Query:  355 GTNNLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELP----KARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHAT-DLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRI--------QWDTSLYDPNKLIKVESNCQIIAIQS-LDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLP----FKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFIL---EEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEI 2382
            G +   ++++Q+ D NDN P +      + + E+ K  S     P     A D D        Y+I   ++      ++S   I  F+     +       H + + A DGG         + + IID     PIFE + Y   +  ++   + +   I A+ D+   + V Y      P      F +   +  +R+ K L HE   S+   +I A   G P     T V + +++ N   P      +   I + E+ ++G  +      D DSG  G+   S+++     +     ++         LI ++  D E   R  LI+   D G P+ +T+  I + + DVNDN P FEK+ Y   + E    N  I Q+ A DLD G NA++ YRI            S  D ++   +  N   I +++ LDRE      R      V+ATD+G P     T V + ++D NDN P FQ++ Y     E+    +    V V  A D D G N  + YS     LLP    F+++P +GE+ + + +DRE +   Y   + ARD  T +   ++A V V I + D NDN P    P E    ++     P G+ V  V+A+D+D G N+ I + +    +   + LFSI+ TSG + T  VL    +    L + A D G+P    ++ L +E+
Sbjct:  694 GLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEI--FVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDP---DGYFSIETNSGNIRIAKPLDHEA-KSQVLLNIQAT-LGEPPVYGHTQVNIEVEDVNDNAPE--FEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGH-------LILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRET-----RDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENL---RRGSVVGVVTASDLDLGENAAIRYS-----LLPINSSFQVHPVTGEISTREPLDRELR-ELYDLVVEARDQGTPV---RSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQ--PPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEV 1355          

HSP 3 Score: 174.096 bits (440), Expect = 2.759e-43
Identity = 228/809 (28.18%), Postives = 358/809 (44.25%), Query Frame = 1
Query:  214 LIKNRFFQIENGDNLKVSGLIDRDDNLELCAYRNVNFSCIWRGILFCGTNNLK----ILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPF--------LKLRRGIDRELISWHNVTLLAVDGG---TPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDL-----KIHATDLDI--NANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSL--KHECFASEYRFS--IDALDHGRPVEKSKTTVTLHLKNQNLY--PPSILLPGNNAVIR--IIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTM-NKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTS-----------------------AEXXXXXXDVNDNSPQFE-KEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQ-RSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIF-IFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNI--LFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGEFRNPDSTPF----NETEESFLSDQA 2451
            LI+  F    +  NL V+ L+DR+   E        F    R +    +NN +     ++I++ D NDN P+W Q+ I ++V E T + +       A D+D   N    Y++    +YF   +E   + +  F        L L+  +D E +  + + + A+D     T     S+ + ++I+D ND+ P F S   +     +L I+    +      I A D D   N  +TY  +       +  F +N    I+ + KSL    E      RF+  I A DHG+P E  K+++ LHL  Q  +  PP  L     AV R  I+EN   G  +L    K     + G  N ++    +Y+I   + N     +     + T   FDRE +    L ++ +D  + +  +S                       A I I + DVNDNSP+F     Y  ++ E ++P   I  + A DLD+G NA L Y I   T     NK   ++S+   ++ + LDRE++    R+    Q+ A+D G+P+ R G   ++I + D NDN P F+ + Y  S  ED         V    A D D GVN  + YS+  ET   F ++  SG + +   +DRE Q S Y F + A D        ++ATV V I + D NDN PIF  +P    Y  Q+  L+  G  +  V+A+D D G N++I + L  E   +   F IN ++G L  S  L+        L + A D G+P  +++  + + IGE   P  TP     NET    L + +
Sbjct: 1421 LIEAAFDIDRHSGNLVVARLLDREVQSE--------FRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNF-TATDADTGTNGDLQYRL---IRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNG---EGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQP-EPKKSSLNLHLIVQGSHNNPPRFL----QAVYRATILENVPSGSFVLQVTAK----SLHGAENANL----SYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGV-IHTVVASDLDEGPNADLIYSI---TGGNLGNKF-SIDSSSGELSARPLDREQHS---RYTL--QIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQED---APLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQAS-YNFMVLATDG--GRYEVRSATVPVQINVLDINDNRPIFERYP----YIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEA--PQGTPVLRFQNETYRVMLKENS 2179          

HSP 4 Score: 152.14 bits (383), Expect = 1.702e-36
Identity = 191/717 (26.64%), Postives = 310/717 (43.24%), Query Frame = 1
Query:  367 LKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLEL-PKARDSDEHPNNIS--------YYKIEPTSK-----YFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVD--GGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIH---ATDLD--INANVTYRFSLNVPFI------VQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPV-EKSKTTVTLHLK--NQNLYPPSILLP----GNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSA-EXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQS-LDREKYPNGFRFVCPYQV--------IATDSGEPQRSGST-------------TVSIELMDINDNIPVFQQAF-YNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLL-PFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCG 2340
            +++L +++LD NDN P ++ +S+V  V E+  L      + P  R +D   N++          Y + P +K      F I     N      L + R +DRE+ S   + + A+D       ++ ++ + I++ DVNDN P     +    ID  +   + +   IH   ATD D   N ++ YR     P +          F ++     L ++  L  E    EY   + ALD    V E+ +T+VT+ L+  + N + P  + P    G  A + I +   IG V+   V  D DSG +G+    I    N +    +N +++  I ++  +     D E   R  LII  KD G+P    S+  + +I+   ++N P+F +  Y  TI E       + Q+TA  L    NA L Y I    +    N L  V+    II  +   DRE   +   +V P  V        +++ +   QRS  +             T+ I + D+NDN P F+    Y +S  E+         +   +A D D G N D+ YSI    L   F ++ +SGEL +  L DRE Q S+YT  I A D        +    +++I +ED NDN P F     S Y   +    P+G+ V  + A+D D G+N+++ + L  E +   F+I+  SG + T   L    +      + A D G
Sbjct: 1348 VRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGN------LVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAP----EWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAV-QEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITG-GNGEGRFRIN-SQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVA----NDLFHVDWQRGIITTRGQFDRESQAS---YVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPEN----SEPGVIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSARPL-DRE-QHSRYTLQIQASDR--GQPKSRQGHCNITIFVEDQNDNAPRFKL---SKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQ-WQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGG 2032          

HSP 5 Score: 148.288 bits (373), Expect = 2.218e-35
Identity = 162/620 (26.13%), Postives = 282/620 (45.48%), Query Frame = 1
Query:  604 LKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIF-ESSFYTQ-SIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAI-------LRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAII-------SLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQ----FEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLN-AQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQ-SLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLE--DFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVR--ETLLP-FKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNIL-FSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAI--QQLT 2373
            ++ +  +DRE  + +++  + + G       ++++L+ + D NDN P F ++S + +   +   E+  TL   + A DLD+    T R+++ V   V D F L+            L++   L  E     Y   I+ALD G P  +   TV + +++ N   P  +   +     + EN  +G  +L     D D+  +G    +I            N+ +S+   +        ++  NK  D E K   +L++  KD G+    T+A +SI + DVNDN P     F  +     I E  QP   +A+++ HD D     A +   +      +    L   +++  ++ +   LDRE   N         V+ATD G P    S ++ + + D+NDN P F+Q  Y+ + +E  D G+      V   +AHD D G+N  +TYS+    ET    F+++P +G + +   +D ET+P     ++ ARD     L   ++T +V + I D NDNEPIF   ++S Y + ++   PVG  +  V A D D G+N+ + + + E  +++  F +   SGE+  +  L    +      + A D G    TA+   QLT
Sbjct:  132 IRTKVKLDRETRASYSLVAIPLSGR------NIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTL---LPARDLDLEPYNTQRYNI-VSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPG-YSLLIEALDGGTPPLRGFMTVNITIQDVNDNQP--IFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAI------------NRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHF---ALTTRDNSIYLVIVHLPLDREIVSN-----YTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGT-----SVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVP-QLTVVARDGGVPPL---SSTATVLVTIHDVNDNEPIF---DQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIKMQLT 706          

HSP 6 Score: 143.665 bits (361), Expect = 5.780e-34
Identity = 181/733 (24.69%), Postives = 308/733 (42.02%), Query Frame = 1
Query:  376 LEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGT-PSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVP-FIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSE---------------NIAIISLITNKIFDREV------------KTRIQLIIFCKDFG-------------------KPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVF-QQAFYNISFLEDFGSKKNSRKVAVFIAHDPD------FGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTL------VKAIDKDS-GINSQIQFILEEEKRNILFSINETSGEL---LTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIE 2379
            + I + D+NDN P++  +     V E+  L +  +++  A D+D   N    Y +   +++ F    +S       +     +DREL + +N  +LA DGG    ++ ++ + I ++D+NDN+PIFE   Y   +   ++   TL LK+ A D D+ AN    +SLN     V   F +NP    L   +SL  E         + A D G P + S   + L +       P +        + + EN   G  +L  V   +D G   K   S     N D IL+++    E                 ++ +L   +    E              TR Q  +    F                     P   + AE+ I + D NDNSP+F ++ +  T+ E N     +AQ+ A D D G NA+LRY I      +D   +I+   +  +     LDRE      R +   ++IATD G PQ +G+ T+ ++++D+NDN P F       +S   + G+      +    A+D D      + +  + T  I  E +  F L+  SG+L     +D E Q  +Y   + A D+         A   +++ + D NDN P+F+      Y   L  +  +   +++      V A D DS G NS++ +I+E  +    FS++ ++G +   ++    +V   G+  + I A D G P L +   L ++
Sbjct: 1938 ITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQI-SAVDADLGVNARLVYSLANETQWQFAIDGQSG-----LITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTL-LKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASES-GKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSD-GRRQKVQFS-FGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGN--HDNAFVIEPAFSGIVRTNIVLDRE-----IRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSEATELGA-----VITSISANDVDTYPALTYRLGAESTVDI--ENMSIFALDRYSGKLVLKRRLDYELQ-QEYELDVIASDAA------HEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEG--FSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQ 2637          

HSP 7 Score: 116.701 bits (291), Expect = 1.007e-25
Identity = 174/729 (23.87%), Postives = 309/729 (42.39%), Query Frame = 1
Query:  376 LEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPN-NISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDC--FDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQN--------LYPPS--ILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDI-ILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREK---YPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVR---ETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVS---IVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFIL----EEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGEFRNPDSTPFNETEESFLSDQATFIIVGIILG 2481
            L I++ DENDN P++SQ   V  V E     +F  ++  A DSD   N  + Y+ ++      F+  E +  GI   ++    +DRE+   + + ++A D G P  TG+  + ++I+DVNDN+P F  +    ++    E+ + +   I A D+D    +TYR        +++   F L+ ++  L +K+ L +E    EY   + A D      +++T +T+ + ++N          PP+   +LP   A+  I E+  +   +LT    D DS  +      I+EP      +   N   S N++ +    +   D  V+      I  KD GKPA  +S  + +   D      QF +  Y   I E       + QL      D L+  L      + S ++   L++ ++   I+ ++ LDRE+   Y    R V  +            S   +V I ++D NDN P+F ++    + + +    + S      I  D +   N +V Y I     E +  F ++  +G L+  + +D ++    Y   I A DS     + +    S+    + + D NDNEP F     + Y   L+   PVGS V    A D D G   Q+ + +     +E    +F ++  SG + ++ V     +    + + A D G  + +   ++ IE  +   P    F E    F+   A  +  G ++G
Sbjct: 2308 LVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQV-HAFDSDAGSNARLRYHIVDGNHDNAFVI-EPAFSGI---VRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLV-TVSEATELGAVI-TSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYE-LQQEYELDVIASD---AAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILP---AISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVR------IIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLG----QDALDQSLAIIAGNEESAFE---LLQSKA---IVLVKPLDRERNDLYK--LRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHM--FTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDS-----HHQRPLCSLQPFRLELHDENDNEPKFPL---TEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKKASVAVRVEIESRDEFTPQ---FTERTYRFVLPAAVALPQGYVVG 2991          

HSP 8 Score: 113.235 bits (282), Expect = 1.001e-24
Identity = 152/664 (22.89%), Postives = 286/664 (43.07%), Query Frame = 1
Query:  382 IQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKP-IFESSFYTQSIDCNLEINSTLDLKIHATDLDI--NANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAII--------SLITNKIFDREVKTRIQLIIFCKDFGKP--AFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRI-----QWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPY----QVIATDSGEPQR-SGSTTVSIELMDINDNIPVFQQAFYNIS-----FLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLP-FKLNPNSGELYSYDLVDRETQ----PSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLT 2274
            +++LD NDN P++ ++     + EN +  S  + +  A D D   N    Y + P +  F +        +   +  R  +DREL   +++ + A D GTP ++  + + I + DVNDN P I +      S+       + + +++ A D D   NA++TY             F ++P + ++R +  L HE   S YR  + A D G P  ++   + + + + N   P+     ++ V R+ E+  +G V+  G +   +   D   N      ++  +  T+N    + I           +L+  ++ DREV++  +L I   D        +++  + I + DVNDN+P++ ++     + E       I   TA D D G N  L+YR+     Q + S      L +++S    +++Q+      P  F  V  Y    Q +   S   +R   S TV + ++D ND+ P F     +       F+ D  + +    VA  +A D D G NG +TY I        F++N  +G +     +   T+      ++   I A+D        K +++++ ++++  ++N P F+   ++ Y+  +   VP GS V  V A       N+ + + +     N LF ++   G + T
Sbjct: 1141 VRVLDANDNDPKFQKSKYEFRIEENLRRGSV-VGVVTASDLDLGENAAIRYSLLPINSSFQVHP------VTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEV-VRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEE-RSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFT--SSSLVFRVREDAALGHVV--GSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQA------PLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISD--ATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDH--GQPEPKKSSLNLHLIVQGSHNNPPRFL---QAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITT 1778          

HSP 9 Score: 58.151 bits (139), Expect = 5.767e-8
Identity = 75/263 (28.52%), Postives = 115/263 (43.73%), Query Frame = 1
Query: 1711 VSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETL-LPFKLNPN---SGELYSYDL-----VDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFIL--EEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGEFRNPDSTPFNETEES----FLSDQAT 2454
            V + + D NDN P F Q   +I F E+        K  +  A D D        Y+IV   +   F+L+ +    G LY  DL     +DRET P  Y+  I A D  T  L      ++V+I I+D NDN+PIF   N+S Y   +     VG+ V  V A D D+  N  +++ +   +  +  +F I+  +G +  +  L    K    L + A D G   L     ++I +        T  N+ + +    FLSD A+
Sbjct:  160 VLVTVKDENDNAPTFPQTSMHIEFPEN---TPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLY-LDLQISGFLDRETTPG-YSLLIEALDGGTPPL---RGFMTVNITIQDVNDNQPIF---NQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRV--------TDVNDNQPTINVIFLSDDAS 403          
BLAST of Protocadherin alpha-11 vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0343249)

HSP 1 Score: 225.713 bits (574), Expect = 3.379e-59
Identity = 201/681 (29.52%), Postives = 328/681 (48.16%), Query Frame = 1
Query:  364 NLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEP--TSKYFFISSEKSNKGIKPF-LKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNV-PFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSI--LLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQS-LDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVR--ETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSL-----VTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGEL--LTSTVLSVIHKGEETLFIKAIDCGSPRLTA 2358
            N+++L + + DENDN P + Q S+ IE  ENT  +     LP ARD D  P N   Y I     +  F +SS +   G+    L++   +DRE    +++ + A+DGGTP   G + + I I DVNDN+PIF  S Y  ++  N  + +++ L+++A+D D + N    +++N      +  F ++P    + + K+L  E     +   + A DHG    ++   V++ + + N   P+I  +   ++A  +I E+   G  +    V D DS  +       L   +    LT   T+  +I ++  I +   DRE+ +   L +   D G P  + S  I + I DVNDN P+FE++ YH  + E   P  ++ Q+ AHD D+GLN+ L Y +      +   +  +++    +I  +S +D E  P     V    V+A D G P  S + TV + + D+NDN P+F Q+FYN+S  E+    +   KV+   A DPD GVN  V Y+I    + L  F++   SGE+     +D E + S Y F + A D         + T  + + + D NDN P+F +P E  YK+ L       S      +  V A D D G   Q+ + +       +F I+ ++GE+  +   +LSV  +    L I A D G+ R  A
Sbjct:  157 NIRVL-VTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLP-ARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSV-LQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFET-KELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALT---TRDNSIYLV--IVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETH--AQWFQIDPQTGLITTRSHIDCETEP-----VPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVS---ASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERR-SSYEFPVLATDRGG-----LSTTAMIKMQLTDVNDNRPVF-YPRE--YKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNA 809          

HSP 2 Score: 183.726 bits (465), Expect = 3.343e-46
Identity = 186/697 (26.69%), Postives = 302/697 (43.33%), Query Frame = 1
Query:  355 GTNNLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELP----KARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHAT-DLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRI--------QWDTSLYDPNKLIKVESNCQIIAIQS-LDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLP----FKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFIL---EEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEI 2382
            G +   ++++Q+ D NDN P +      + + E+ K  S     P     A D D        Y+I   ++      ++S   I  F+     +       H + + A DGG         + + IID     PIFE + Y   +  ++   + +   I A+ D+   + V Y      P      F +   +  +R+ K L HE   S+   +I A   G P     T V + +++ N   P      +   I + E+ ++G  +      D DSG  G+   S+++     +     ++         LI ++  D E   R  LI+   D G P+ +T+  I + + DVNDN P FEK+ Y   + E    N  I Q+ A DLD G NA++ YRI            S  D ++   +  N   I +++ LDRE      R      V+ATD+G P     T V + ++D NDN P FQ++ Y     E+    +    V V  A D D G N  + YS     LLP    F+++P +GE+ + + +DRE +   Y   + ARD  T +   ++A V V I + D NDN P    P E    ++     P G+ V  V+A+D+D G N+ I + +    +   + LFSI+ TSG + T  VL    +    L + A D G+P    ++ L +E+
Sbjct:  694 GLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEI--FVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDP---DGYFSIETNSGNIRIAKPLDHEA-KSQVLLNIQAT-LGEPPVYGHTQVNIEVEDVNDNAPE--FEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGH-------LILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRET-----RDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENL---RRGSVVGVVTASDLDLGENAAIRYS-----LLPINSSFQVHPVTGEISTREPLDRELR-ELYDLVVEARDQGTPV---RSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQ--PPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEV 1355          

HSP 3 Score: 174.096 bits (440), Expect = 2.759e-43
Identity = 228/809 (28.18%), Postives = 358/809 (44.25%), Query Frame = 1
Query:  214 LIKNRFFQIENGDNLKVSGLIDRDDNLELCAYRNVNFSCIWRGILFCGTNNLK----ILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPF--------LKLRRGIDRELISWHNVTLLAVDGG---TPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDL-----KIHATDLDI--NANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSL--KHECFASEYRFS--IDALDHGRPVEKSKTTVTLHLKNQNLY--PPSILLPGNNAVIR--IIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTM-NKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTS-----------------------AEXXXXXXDVNDNSPQFE-KEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQ-RSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIF-IFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNI--LFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGEFRNPDSTPF----NETEESFLSDQA 2451
            LI+  F    +  NL V+ L+DR+   E        F    R +    +NN +     ++I++ D NDN P+W Q+ I ++V E T + +       A D+D   N    Y++    +YF   +E   + +  F        L L+  +D E +  + + + A+D     T     S+ + ++I+D ND+ P F S   +     +L I+    +      I A D D   N  +TY  +       +  F +N    I+ + KSL    E      RF+  I A DHG+P E  K+++ LHL  Q  +  PP  L     AV R  I+EN   G  +L    K     + G  N ++    +Y+I   + N     +     + T   FDRE +    L ++ +D  + +  +S                       A I I + DVNDNSP+F     Y  ++ E ++P   I  + A DLD+G NA L Y I   T     NK   ++S+   ++ + LDRE++    R+    Q+ A+D G+P+ R G   ++I + D NDN P F+ + Y  S  ED         V    A D D GVN  + YS+  ET   F ++  SG + +   +DRE Q S Y F + A D        ++ATV V I + D NDN PIF  +P    Y  Q+  L+  G  +  V+A+D D G N++I + L  E   +   F IN ++G L  S  L+        L + A D G+P  +++  + + IGE   P  TP     NET    L + +
Sbjct: 1421 LIEAAFDIDRHSGNLVVARLLDREVQSE--------FRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNF-TATDADTGTNGDLQYRL---IRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNG---EGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQP-EPKKSSLNLHLIVQGSHNNPPRFL----QAVYRATILENVPSGSFVLQVTAK----SLHGAENANL----SYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGV-IHTVVASDLDEGPNADLIYSI---TGGNLGNKF-SIDSSSGELSARPLDREQHS---RYTL--QIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQED---APLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQAS-YNFMVLATDG--GRYEVRSATVPVQINVLDINDNRPIFERYP----YIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEA--PQGTPVLRFQNETYRVMLKENS 2179          

HSP 4 Score: 152.14 bits (383), Expect = 1.702e-36
Identity = 191/717 (26.64%), Postives = 310/717 (43.24%), Query Frame = 1
Query:  367 LKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLEL-PKARDSDEHPNNIS--------YYKIEPTSK-----YFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVD--GGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIH---ATDLD--INANVTYRFSLNVPFI------VQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPV-EKSKTTVTLHLK--NQNLYPPSILLP----GNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSA-EXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQS-LDREKYPNGFRFVCPYQV--------IATDSGEPQRSGST-------------TVSIELMDINDNIPVFQQAF-YNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLL-PFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCG 2340
            +++L +++LD NDN P ++ +S+V  V E+  L      + P  R +D   N++          Y + P +K      F I     N      L + R +DRE+ S   + + A+D       ++ ++ + I++ DVNDN P     +    ID  +   + +   IH   ATD D   N ++ YR     P +          F ++     L ++  L  E    EY   + ALD    V E+ +T+VT+ L+  + N + P  + P    G  A + I +   IG V+   V  D DSG +G+    I    N +    +N +++  I ++  +     D E   R  LII  KD G+P    S+  + +I+   ++N P+F +  Y  TI E       + Q+TA  L    NA L Y I    +    N L  V+    II  +   DRE   +   +V P  V        +++ +   QRS  +             T+ I + D+NDN P F+    Y +S  E+         +   +A D D G N D+ YSI    L   F ++ +SGEL +  L DRE Q S+YT  I A D        +    +++I +ED NDN P F     S Y   +    P+G+ V  + A+D D G+N+++ + L  E +   F+I+  SG + T   L    +      + A D G
Sbjct: 1348 VRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGN------LVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAP----EWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAV-QEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITG-GNGEGRFRIN-SQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVA----NDLFHVDWQRGIITTRGQFDRESQAS---YVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPEN----SEPGVIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSARPL-DRE-QHSRYTLQIQASDR--GQPKSRQGHCNITIFVEDQNDNAPRFKL---SKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQ-WQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGG 2032          

HSP 5 Score: 148.288 bits (373), Expect = 2.218e-35
Identity = 162/620 (26.13%), Postives = 282/620 (45.48%), Query Frame = 1
Query:  604 LKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIF-ESSFYTQ-SIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAI-------LRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAII-------SLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQ----FEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLN-AQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQ-SLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLE--DFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVR--ETLLP-FKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNIL-FSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAI--QQLT 2373
            ++ +  +DRE  + +++  + + G       ++++L+ + D NDN P F ++S + +   +   E+  TL   + A DLD+    T R+++ V   V D F L+            L++   L  E     Y   I+ALD G P  +   TV + +++ N   P  +   +     + EN  +G  +L     D D+  +G    +I            N+ +S+   +        ++  NK  D E K   +L++  KD G+    T+A +SI + DVNDN P     F  +     I E  QP   +A+++ HD D     A +   +      +    L   +++  ++ +   LDRE   N         V+ATD G P    S ++ + + D+NDN P F+Q  Y+ + +E  D G+      V   +AHD D G+N  +TYS+    ET    F+++P +G + +   +D ET+P     ++ ARD     L   ++T +V + I D NDNEPIF   ++S Y + ++   PVG  +  V A D D G+N+ + + + E  +++  F +   SGE+  +  L    +      + A D G    TA+   QLT
Sbjct:  132 IRTKVKLDRETRASYSLVAIPLSGR------NIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTL---LPARDLDLEPYNTQRYNI-VSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPG-YSLLIEALDGGTPPLRGFMTVNITIQDVNDNQP--IFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAI------------NRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHF---ALTTRDNSIYLVIVHLPLDREIVSN-----YTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGT-----SVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVP-QLTVVARDGGVPPL---SSTATVLVTIHDVNDNEPIF---DQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIKMQLT 706          

HSP 6 Score: 143.665 bits (361), Expect = 5.780e-34
Identity = 181/733 (24.69%), Postives = 308/733 (42.02%), Query Frame = 1
Query:  376 LEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGT-PSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVP-FIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSE---------------NIAIISLITNKIFDREV------------KTRIQLIIFCKDFG-------------------KPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVF-QQAFYNISFLEDFGSKKNSRKVAVFIAHDPD------FGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTL------VKAIDKDS-GINSQIQFILEEEKRNILFSINETSGEL---LTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIE 2379
            + I + D+NDN P++  +     V E+  L +  +++  A D+D   N    Y +   +++ F    +S       +     +DREL + +N  +LA DGG    ++ ++ + I ++D+NDN+PIFE   Y   +   ++   TL LK+ A D D+ AN    +SLN     V   F +NP    L   +SL  E         + A D G P + S   + L +       P +        + + EN   G  +L  V   +D G   K   S     N D IL+++    E                 ++ +L   +    E              TR Q  +    F                     P   + AE+ I + D NDNSP+F ++ +  T+ E N     +AQ+ A D D G NA+LRY I      +D   +I+   +  +     LDRE      R +   ++IATD G PQ +G+ T+ ++++D+NDN P F       +S   + G+      +    A+D D      + +  + T  I  E +  F L+  SG+L     +D E Q  +Y   + A D+         A   +++ + D NDN P+F+      Y   L  +  +   +++      V A D DS G NS++ +I+E  +    FS++ ++G +   ++    +V   G+  + I A D G P L +   L ++
Sbjct: 1938 ITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQI-SAVDADLGVNARLVYSLANETQWQFAIDGQSG-----LITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTL-LKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASES-GKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSD-GRRQKVQFS-FGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGN--HDNAFVIEPAFSGIVRTNIVLDRE-----IRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSEATELGA-----VITSISANDVDTYPALTYRLGAESTVDI--ENMSIFALDRYSGKLVLKRRLDYELQ-QEYELDVIASDAA------HEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEG--FSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQ 2637          

HSP 7 Score: 116.701 bits (291), Expect = 1.007e-25
Identity = 174/729 (23.87%), Postives = 309/729 (42.39%), Query Frame = 1
Query:  376 LEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPN-NISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDC--FDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQN--------LYPPS--ILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDI-ILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREK---YPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVR---ETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVS---IVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFIL----EEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGEFRNPDSTPFNETEESFLSDQATFIIVGIILG 2481
            L I++ DENDN P++SQ   V  V E     +F  ++  A DSD   N  + Y+ ++      F+  E +  GI   ++    +DRE+   + + ++A D G P  TG+  + ++I+DVNDN+P F  +    ++    E+ + +   I A D+D    +TYR        +++   F L+ ++  L +K+ L +E    EY   + A D      +++T +T+ + ++N          PP+   +LP   A+  I E+  +   +LT    D DS  +      I+EP      +   N   S N++ +    +   D  V+      I  KD GKPA  +S  + +   D      QF +  Y   I E       + QL      D L+  L      + S ++   L++ ++   I+ ++ LDRE+   Y    R V  +            S   +V I ++D NDN P+F ++    + + +    + S      I  D +   N +V Y I     E +  F ++  +G L+  + +D ++    Y   I A DS     + +    S+    + + D NDNEP F     + Y   L+   PVGS V    A D D G   Q+ + +     +E    +F ++  SG + ++ V     +    + + A D G  + +   ++ IE  +   P    F E    F+   A  +  G ++G
Sbjct: 2308 LVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQV-HAFDSDAGSNARLRYHIVDGNHDNAFVI-EPAFSGI---VRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLV-TVSEATELGAVI-TSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYE-LQQEYELDVIASD---AAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILP---AISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVR------IIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLG----QDALDQSLAIIAGNEESAFE---LLQSKA---IVLVKPLDRERNDLYK--LRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHM--FTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDS-----HHQRPLCSLQPFRLELHDENDNEPKFPL---TEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKKASVAVRVEIESRDEFTPQ---FTERTYRFVLPAAVALPQGYVVG 2991          

HSP 8 Score: 113.235 bits (282), Expect = 1.001e-24
Identity = 152/664 (22.89%), Postives = 286/664 (43.07%), Query Frame = 1
Query:  382 IQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKP-IFESSFYTQSIDCNLEINSTLDLKIHATDLDI--NANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAII--------SLITNKIFDREVKTRIQLIIFCKDFGKP--AFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRI-----QWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPY----QVIATDSGEPQR-SGSTTVSIELMDINDNIPVFQQAFYNIS-----FLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLP-FKLNPNSGELYSYDLVDRETQ----PSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLT 2274
            +++LD NDN P++ ++     + EN +  S  + +  A D D   N    Y + P +  F +        +   +  R  +DREL   +++ + A D GTP ++  + + I + DVNDN P I +      S+       + + +++ A D D   NA++TY             F ++P + ++R +  L HE   S YR  + A D G P  ++   + + + + N   P+     ++ V R+ E+  +G V+  G +   +   D   N      ++  +  T+N    + I           +L+  ++ DREV++  +L I   D        +++  + I + DVNDN+P++ ++     + E       I   TA D D G N  L+YR+     Q + S      L +++S    +++Q+      P  F  V  Y    Q +   S   +R   S TV + ++D ND+ P F     +       F+ D  + +    VA  +A D D G NG +TY I        F++N  +G +     +   T+      ++   I A+D        K +++++ ++++  ++N P F+   ++ Y+  +   VP GS V  V A       N+ + + +     N LF ++   G + T
Sbjct: 1141 VRVLDANDNDPKFQKSKYEFRIEENLRRGSV-VGVVTASDLDLGENAAIRYSLLPINSSFQVHP------VTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEV-VRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEE-RSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFT--SSSLVFRVREDAALGHVV--GSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQA------PLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISD--ATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDH--GQPEPKKSSLNLHLIVQGSHNNPPRFL---QAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITT 1778          

HSP 9 Score: 58.151 bits (139), Expect = 5.767e-8
Identity = 75/263 (28.52%), Postives = 115/263 (43.73%), Query Frame = 1
Query: 1711 VSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETL-LPFKLNPN---SGELYSYDL-----VDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFIL--EEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGEFRNPDSTPFNETEES----FLSDQAT 2454
            V + + D NDN P F Q   +I F E+        K  +  A D D        Y+IV   +   F+L+ +    G LY  DL     +DRET P  Y+  I A D  T  L      ++V+I I+D NDN+PIF   N+S Y   +     VG+ V  V A D D+  N  +++ +   +  +  +F I+  +G +  +  L    K    L + A D G   L     ++I +        T  N+ + +    FLSD A+
Sbjct:  160 VLVTVKDENDNAPTFPQTSMHIEFPEN---TPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLY-LDLQISGFLDRETTPG-YSLLIEALDGGTPPL---RGFMTVNITIQDVNDNQPIF---NQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRV--------TDVNDNQPTINVIFLSDDAS 403          
BLAST of Protocadherin alpha-11 vs. Ensembl Fly
Match: ft (gene:FBgn0001075 transcript:FBtr0077478)

HSP 1 Score: 218.394 bits (555), Expect = 6.520e-57
Identity = 211/712 (29.63%), Postives = 330/712 (46.35%), Query Frame = 1
Query:  376 LEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNK----------GIKPFLKLRR--GIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDI--NANVTYRFSLNVPFIVQDCFDLNPFNAIL----RV----KKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSI---LLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLI-TNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSL--YDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVR--ETLLP--FKLNPNSGELYSYDLVDRETQPSQYTFSITARD--SPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYK-------IQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGEL-LTSTVLSVIH-KGEETLFIKAIDCGSPRLTAIQQLTIEI 2382
            + I++LD NDN P++ + SI I   E+    +  L L  A D+D   N +       T +Y  ++    NK          G   +L L     +DRE    + + + A DGG+P + G LQ+ + I+DVNDN PIF+ S Y  S++    +  T  + + A+D D+  N+ +TY  +       +  F +NP   ++    RV    + ++K         F++ A DHG P +  +T VT++L + N + P I     P    V  + EN   G V+    VKD+DSG++G+ +  I+          +   + E  A + ++  N + DRE   +  L +   D G PA  T+A + I + DVND+ P FEK  Y   + E       +A +TA D D G+NAQ+ Y I     L  +  + L  +     I+    LDRE      R      + A D G   +   T + + ++D ND  P F Q   N++  ED   +     VA+  A D D G NG VT+++    E L P  F L+  +G+L +   +DRE   SQY  S+ ARD  +PT     ++AT +V + + D NDN+P F +P    Y        I+L   V    ++  V A DKD G N+ I++ LE      LF ++  SG + L     + +H K    L + A D G  R  + Q   +EI
Sbjct:  142 VRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLL-LDAATDADVGENGV-------TDQYEIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLN-ETALPGTPVVTVMASDNDLGDNSKITYYLAE-----TEHQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNE------LGHFRLEEAADLHIVRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNELKWFSMDPLTGL-----IVTTGPLDRE-----IRDTVELSISARDGGPNPKFAYTQLKVIILDENDEAPQFSQREQNVTLGEDAPPQT---IVALMTATDHDQGTNGSVTFALAPSVERLYPLQFALDALTGQLTTRRPLDREKM-SQYEISVIARDQGAPT----PQSATATVWLNVADVNDNDPQF-YPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLESGGEG-LFQLDARSGAISLRGDAPASMHWKPHYKLLVSARDAGQRR--SQQDAIVEI 811          

HSP 2 Score: 168.318 bits (425), Expect = 1.840e-41
Identity = 191/724 (26.38%), Postives = 332/724 (45.86%), Query Frame = 1
Query:  382 IQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPN-NISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEI----------------NSTLDLKIHATDLD----INANVT----------YRFSLNVPFIVQDCFD-LNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTT-VTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAI-QSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTT-VSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDF-GVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVL-----SVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGEFRNP----DSTPFN 2418
            IQ+ D NDN P +       ++ EN +   + +    ARD+D   N  +SY  +   +   F  + ++       L L   +D E +  + + + A D G PS + ++ +   ++D+NDN PIF+   Y+  +  N+ I                N  ++  I A D+D    I++N T          +R +  +    +DC D    F+ +   +  LK+       +   + L H +    S T  VT+ +K+ N   P  +     A   I+EN  I  V++     DND G +G  +  + E ++ D+  +     S N     L      DRE+++   L I  +D G+P  +T +++ I I+D NDNSP F+ + Y  ++ E       + Q++A D+D+G N ++RY I     L D N    +  +  ++ + ++L+ E+     R+     V A D      +G T  ++I ++DINDN P F  + Y    +E+     N   V    A+D D   +N  V Y +       F++N +SG++     +DRE Q S+YT ++ A D+ +  L   T T  V + ++D NDN+P+F      +Y   +   +P G+ V   +A DKD G+N++++F L  E  +  F I+  +GE+ T+T L     SV H    TL  +      PR +++  LTI + +  +     DST +N
Sbjct: 1910 IQVSDTNDNPPLFEDTVYSFDIPENAQR-GYQVGQIVARDADLGQNAQLSYGVVSDWANDVFSLNPQTG-----MLTLTARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEYSITAGDVDSEFGIDSNGTIRTRRNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVFISANETA---IMENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSI----VLGDQNHDFSISEDTGVVRVAKNLNYERLS---RYSL--TVRAEDCALENPAGDTAELTINILDINDNRPTFLDSPYLARVMENT-VPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDSDLFRINASSGDIALLKPLDREQQ-SEYTLTLVAMDTGSPPL---TGTGIVRVEVQDINDNDPVFEL---QSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNLLGEHMH-RFHIDSETGEISTATTLDREETSVYHL---TLMAQDSSITEPRASSV-NLTISVSDVNDNIPKFDSTTYN 2602          

HSP 3 Score: 167.548 bits (423), Expect = 3.391e-41
Identity = 181/674 (26.85%), Postives = 297/674 (44.07%), Query Frame = 1
Query:  373 ILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPN-NISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGG-TPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASE---YRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAF-YNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKD-SGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIH----KGEETLF---IKAIDCGSPRL 2352
            I+ +++ D NDN P +   S    V EN    +  L  P+A D DE  N  + +  +      F I SE         +     +DRE  S +++TL+A D   T  +  S+ L I + DVNDN P F+S+ Y  ++   +     +     A DLD   N    ++++     Q  FD+N    ++  K  LK +  + +   Y   I A+D G     SK  +T+ L+   L+P    +   N+   + E+   G +I          G+ GK   +I        I+  +     N  ++S+  + + D E+    ++ I   D   P+  +   I++ + D NDN+P  E+  Y+  + EE  P   IA + A D D G N  + YR+Q D      +   ++  + +I     LDRE+  + + FV    V A D G P  +G+ +V + L+D NDN P F + F  N++   + GS      V    + D D G N + +YS        F++ P SG +     +DRE Q  +Y   + A D      +R  A   ++I I+D NDN P F     S Y      L    +LV  + A D+D  G NS I + L++   + +FSI+  +GE+ +   +   H    +  E ++   + A D G P L
Sbjct: 2476 IVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVL-TPRATDKDEGLNAKLRFNLLGEHMHRFHIDSETGE------ISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPERISKGEFV-FGARALDLDDGENAVVHYTIS--GRDQHYFDINTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTVILRPPELFPTFAYMA--NSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGG-----IMGDSLRVDPNSGLLSVGQDGL-DYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYRLQNDF-----DGTFEITESGEIYTRMRLDREEIGD-YAFV----VEAVDQGVPHMTGTASVLLHLLDKNDNPPKFTRLFSLNVTENAEIGS-----FVIRVTSSDLDLGANANASYSFSENPGEKFRIEPQSGNITVAGHLDREQQ-DEYILKVVASDG----AWR--AETPITITIQDQNDNAPEF---EHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSLQQP--SPMFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPL 3104          

HSP 4 Score: 159.458 bits (402), Expect = 1.013e-38
Identity = 197/731 (26.95%), Postives = 305/731 (41.72%), Query Frame = 1
Query:  370 KILEIQILDENDNVPQW-SQNSIVIE-VVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNK-----PIFES-SFYTQSIDCNLEINST-LDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDS----------GMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETL-LPFKLNPNSGELYSYDLVDRETQPSQYTFSITARD-------------SPTNLLYRK--------------------TATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNIL-------FSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEI 2382
            K++ + + D NDN P + S N+ ++      +K  S  +    A+D+D   N +  Y+I    +  F    + N GI  F     G   +    + +TL + D    S+  S ++ I II           P FE  S  + S+  N  I ++ L +  H    +I   VT   +      V   FD++    IL     L  E    EY   + A+  G     S+T V + + ++N  PP  L      V  + E+  IG  I T    D D+          G DGKF   +LEP    +IL                 N   DRE K++ +L I   D  +    T A  +I + D NDN P FE   Y + I E  Q  + + Q+ A D D G NAQL Y +  D +    N +  +     ++ + +  R  Y     ++   Q  A D+G+P  S + TV   ++D+NDN P+F    Y+    E+      + +V    A D D G NG + YSI    +   F ++ N G + +   +DRE + S YT ++TARD             +   L YR                     ++TV V+I+I+D ND  P+FI  NE+     +   V + ++V  VKA+D D G N  I ++++E +   +       FS+N T G+L     L    +    L I A D G P  +   QL I I
Sbjct: 1585 KLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIVSGPQELF--KLQRNTGIITFTP---GPQFKQEVRYQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQFEQRSKLSGSVYENEPIGTSILTVTAHLASAEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFL--DTPFVYNVSEDLQIGHTISTLRAHDPDTLGSVTFLLMDGHDGKF---LLEPSTGKLIL-----------------NDTLDRETKSKYELRIRVSDGVQ---YTEAYATIQVSDTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSDWA----NDVFSLNPQTGMLTLTA--RLDYEEVQHYILIVQ--AQDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSEVFENV---PIATEVVTVSAKDIDSGNNGLIEYSITAGDVDSEFGIDSN-GTIRTRRNLDREHR-STYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVFISANET----AIMENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRI 2268          

HSP 5 Score: 151.754 bits (382), Expect = 2.372e-36
Identity = 145/568 (25.53%), Postives = 252/568 (44.37%), Query Frame = 1
Query:  712 IKIIDVNDNKPIF---ESSFYTQSIDCNLEINSTLDL-KIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTS---------------LYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVR-ETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLT 2355
            I IID+NDN P+F     S  T S+  N  +   + L ++   D  +N+ ++Y  + N        F + P   +L +++ ++ E   S     + A D G P   SK ++++ + + N + P  +    +    + E   +          D D G +G+ +  I+E     +                L      DRE +    L + C+D G+P+ ++   + I +ID NDN+PQF    + ++I E    +  + +LTA D D G NA+L + +   T                 +D   L+KV  N +        R      +  +   +   +D+G P+      V + + D+NDN P F +A Y+++  E  G+ + +    VF   D D G+NGDV YS+ +      F L+  +G+L     +DRE+Q   +   + A+D+   L +  ++  S++IV+ D NDN P F    +S+ ++ +    P G+ +   +A D D G+NSQ+ F +    R   F I+  +G L     L        TL I A DCG+P L+
Sbjct:  930 IAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSLTNNP----NQQFRIGPVTGVLYLQRPIRAEP-GSLIHVELMATDAGSPPLSSKLSLSVLIADVNDHTP--VFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNTERMFGVFPDGY--------LFVRAPLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLL---EATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISE--GASEGTHITHVF-TQDADEGLNGDVYYSLAKGNEAGQFNLDSATGQLSLGRRLDRESQEIHHLI-VVAKDAA--LKHPLSSNASITIVVLDENDNAPEF---TQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLS 1470          

HSP 6 Score: 148.288 bits (373), Expect = 2.496e-35
Identity = 176/683 (25.77%), Postives = 308/683 (45.10%), Query Frame = 1
Query:  376 LEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKY--FFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLD--INANVTYRFSLNVPFIVQD-CFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTT---VTLHLKNQNLYPPSILLPGNNAVI--RIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEX-----XXXXXDVNDNSPQFEKEFYHYTIFEENQP-NFTIAQLTAHDLDDGLNAQLRY---RIQWDTSLYDPNKLIKVESNCQIIAIQS-LDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQA--FYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKT-ATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLT 2355
            + I +LDENDN P+++Q+S  + V+E +   +  +   +A D+D+  N+   + I   ++   F I S      I   L L + +D E I+ + + + A D GTPS + ++   + ++D NDN PIF S+   + I   + + + + + + A D D  +N  V+Y  S   P + Q   F +N    ++   + +  E   + +R ++ A D  +P E+  +T   VT+ +++ N   P + +  N A++  +   ++     ++    KD DS  +G     I+        L        N  II+      F +EV  R QL +   D    +   S+E+     +        + PQFE+         EN+P   +I  +TAH      +A++ Y    +    S    ++L  +++   I++  + LDRE  P  +      +V A   G   R+  T V + ++D ND+ P F      YN+S  ED    +    ++   AHDPD    G VT+ ++      F L P++G+L   D +DRET+ S+Y   I   D    + Y +  AT+ VS    D NDN P+F    ++ Y   +      G  V  + A D D G N+Q+ + +  +  N +FS+N  +G L  +  L         L ++A D G P L+
Sbjct: 1370 ITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRF-RASDADQGVNSQVVFSISAGNRRDTFHIDS------ITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPI-VTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRESIDT-FRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAP-VFVSMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIVSGPQELFKL------QRNTGIITFTPGPQFKQEV--RYQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQFEQRSKLSGSVYENEPIGTSILTVTAHLA----SAEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEV----EVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVS--EDL---QIGHTISTLRAHDPD--TLGSVTFLLMDGHDGKFLLEPSTGKLILNDTLDRETK-SKYELRIRVSD---GVQYTEAYATIQVS----DTNDNPPLF---EDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSDWANDVFSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNGQPSLS 2008          

HSP 7 Score: 143.28 bits (360), Expect = 8.085e-34
Identity = 167/640 (26.09%), Postives = 284/640 (44.38%), Query Frame = 1
Query:  388 ILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNN-ISYYKIEPTSKYFFISSEKSNKGIKP--FLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSL-----NVPFIVQDCF--DLNPFN--AILRVKKSLKHECFASEYRFSIDA---------LDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENI--AIISLITNKIFDREVKTRIQLIIFCKDFG-KPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPY--QVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVR-ETLLP----FKLNPNSGELYSYDLVDRETQPS-QYTFSITARDSPTNLLYRKTATVS-VSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQF 2208
            I D ND+ P +   S    + E TK+++ +  L  A D D   N  ISY  IE  ++  F        G+ P  +L +R  +DRE   ++ +T+   D G PS++  + ++I +ID NDN P F +S +T SI  N   + T   K+ A D DI  N    F+L     +     ++ F   L PF+  A+++V ++ +        R S+            D+G P  + K  V + + + N   P  L    +  + I E    G  I     +D D G++G           Y  +   N+    N+  A   L   +  DRE +    LI+  KD   K   +++A I+I+++D NDN+P+F +     ++ E +     + +  A D D G+N+Q+ + I    S  +      ++S    + +        P  +  +  Y   + A+D G P  S +   ++ ++D NDN P+F          E    K     +    A DPD G+NG V+Y+I + E  LP    F +N  +G +++   +DRE+  + + T   T R  P+    R+ +T   V++++ED NDN P+F+  N +    + S      + V  V A D DS  N  + +
Sbjct: 1039 IADVNDHTPVFDHTSYETSLPETTKVNTRFFAL-AATDIDLGDNGRISYEIIEGNTERMF--------GVFPDGYLFVRAPLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPAD-TFVGKLTAVDRDIGRNAELSFTLSSQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYH--VTISEGASEGTHITHVFTQDADEGLNGDV---------YYSLAKGNEAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSI----SAGNRRDTFHIDSITGSLYLHK------PLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKT---PIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSE---RQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTY 1641          

HSP 8 Score: 142.124 bits (357), Expect = 2.085e-33
Identity = 186/760 (24.47%), Postives = 325/760 (42.76%), Query Frame = 1
Query:  127 IFENLPVGSVICKLSNV---IIPRPSDTTKFKLIKNRFFQIE-NGDNLKVSGLIDRDDNLELCAYRNVNFSCIWRGILFCGTNNLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRG-IDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFT-IAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRET-LLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGI-NSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEI 2382
            + EN  +GS + ++++    +    + +  F       F+IE    N+ V+G +DR+   E    + V     WR            + I I D+NDN P++  +       E  +  +   ++       + PN++  Y ++  S  F I         K  ++ +     R   + + +T+LA D G P       + I I+D ++N P FE + Y   +  +  +     +++HA D          +SL + F +   F +   +  + + K ++     + Y   + A D G P +  +T V + +  +N+  P   +  N+  + + EN+ +G  ILT    D+D+G +G    SI             +T         ++  +  D ++     L I  +D G    ++ A ++II+ DVNDN P F  + YH  I  EN+P  T + Q  A D D   NA + Y   +  S  D +  I  +SN  I +  S D E+     R +   Q+ A +      S    + + ++ +N+  P F Q  ++    E   +     +V    A D D G +G V Y +V  +    F+++ N+G +Y    +DRETQ ++   ++ A++   ++    T    V I I+D ND  P FI   +  Y   +S   PVG+ VT VKAIDKD    N+Q  + +        F I+  +GE+ T++ L         L I AID G P  T    + IE+
Sbjct: 2921 VTENAEIGSFVIRVTSSDLDLGANANASYSFSENPGEKFRIEPQSGNITVAGHLDREQQDEYI-LKVVASDGAWRA--------ETPITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSLQQPSPMFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDA-VRGQRIVRVHANDKQDLGTNEMDYSL-MTFNLSSIFSVGRHDGWITLVKPIQVPP-NTRYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSV--NSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNERQDFSVDERTGG-------IVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYI-PENKPVGTFVFQAHAADKDSPKNAIIHY--AFLPSGPDRHFFIMNQSNGTISSAVSFDYEE-----RRIYTLQIKAKNPDSSMES-YANLYVHVLGVNEFYPQFLQPVFHFDVSE---TSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDKGFRIDTNTGLIYVARHLDRETQ-NRVVLTVMAKNY-GSIRGNDTDEAQVIISIQDGND-PPEFI---KHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQTGEISTASRLDREETSTYNLVIGAIDTGLPPQTGSATVHIEL 3641          

HSP 9 Score: 141.739 bits (356), Expect = 2.710e-33
Identity = 183/674 (27.15%), Postives = 303/674 (44.96%), Query Frame = 1
Query:  373 ILEIQILDENDNVPQWS---QNSIVIEVVENTKLDSFYLELPKARDSDEHPNN-ISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIEN--QDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQ----------------------LIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKV---ESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSG-EPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIV----RETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNI----LFSINETSGELLT 2274
            I+ I I+D NDN P ++   ++   I + EN  +    + L + RD D   N+ ISY      ++ F I        +   L L+R I  E  S  +V L+A D G+P  +  L L + I DVND+ P+F+ + Y  S+    ++N+     + ATD+D+  N    + + +    +  F + P +  L V+  L  E     Y  ++   D G+P   S   V +H+ ++N   P      +     I EN   D  V  LT V  D D G + + + + L  +  D  +      + N  I +L   + FDRE   ++                       L     D G P      ++ +I+ DVNDN+P+F +  YH TI E       I  +   D D+GLN  + Y      SL   N+  +     +  Q+   + LDRE      + +    V+A D+  +   S + +++I ++D NDN P F Q+   +S LE   +     ++  F A D D GVN  V +SI     R+T   F ++  +G LY +  +D E   S YT +ITA D  T  L   + TV  ++++ D NDN P  IFP+ +  + Q+   +P+ + +  V A D DSG+N ++ + + +++  +     F IN  +G + T
Sbjct:  927 IVNIAIIDLNDNAPVFALDRESEPTISLPENAAVGQ-EIYLSRVRDRDAGVNSRISYSLTNNPNQQFRIGP------VTGVLYLQRPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSYETSLPETTKVNTRF-FALAATDIDLGDNGRISYEI-IEGNTERMFGVFP-DGYLFVRAPLDRE-ERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFT--NSTFTFSIPENAPADTFVGKLTAV--DRDIGRNAELSFT-LSSQTQDFTI-----DTRNGFIKTL---RPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYY------SLAKGNEAGQFNLDSATGQLSLGRRLDRES-----QEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLE---TSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDT---FHIDSITGSLYLHKPLDYEDITS-YTLNITASDCGTPSL---STTVLYNVLVVDDNDNPP--IFPSTAIVR-QIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHT 1552          

HSP 10 Score: 137.887 bits (346), Expect = 3.369e-32
Identity = 175/683 (25.62%), Postives = 298/683 (43.63%), Query Frame = 1
Query:  376 LEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNN-ISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTG-SLQLLIKIIDVNDNKPIF-ESSFYTQSIDCNLEINSTLDLKIHATDLD---INANVTYRFSLNVPFIVQ---DCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKD--FGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQ-QAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLL-PFKLNPNSGEL-YSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEI 2382
            L I+ILDENDN P +        V EN  + +  L++  A D DE  N  I Y  +     + F  SE +       +++ + ++ E +S +++T+ A D    +  G + +L I I+D+NDN+P F +S +  + ++  +  N    L ++A D D   +N+ V Y       F+ +   D F +N  +  + + K L  E   SEY  ++ A+D G P       V + +++ N   P   L   +A +R  EN   G  +LT    D D G++ K   ++L    +   +      SE   I +  T    DRE  +   L +  +D    +P   +S  ++I + DVNDN P+F+   Y+  + E       +    A DLDDG NA + Y I      Y       + +   +++ +   + K  +         + A D GE   S    +++ ++   +  P F   A  + +  ED    K   KV+   A  P  G+ G + Y+I    +    +++PNSG L    D +D E     Y   I A D  T  L   T    +++ + D NDN P+     +  Y  ++        L+ +VKA D+DSG N  + + L+ +     F I E SGE+ T   L     G+    ++A+D G P +T    + + +
Sbjct: 2264 LLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQV-SATDVDEGANGRIRYSIVLGDQNHDFSISEDTG-----VVRVAKNLNYERLSRYSLTVRAEDCALENPAGDTAELTINILDINDNRPTFLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRY-------FLKEGDSDLFRINASSGDIALLKPLDREQ-QSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVR--ENLPSGTHVLTPRATDKDEGLNAKLRFNLLGEHMHRFHI-----DSETGEISTATT---LDREETSVYHLTLMAQDSSITEPRA-SSVNLTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTISGRDQHY-----FDINTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTV-ILRPPELFPTFAYMANSHFAMSEDVRPGKMITKVS---ATSPKKGLVGKIRYAIAGGIMGDSLRVDPNSGLLSVGQDGLDYELT-HLYEIWIEAADGDTPSLRSVTL---ITLNVTDANDNAPVM---EQLIYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYRLQNDFDGT-FEITE-SGEIYTRMRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHL 2903          

HSP 11 Score: 126.716 bits (317), Expect = 9.495e-29
Identity = 140/548 (25.55%), Postives = 238/548 (43.43%), Query Frame = 1
Query:  898 FDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYD--IILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVES-----NC-QIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFY----NISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLP-FKLNPNSGELYSY---DLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCG-SPRLTAIQQLTIEIGEFRNPDSTPFNETEE--SFLSDQATFIIVGIILGT 2484
            F L+P    ++    L  E     Y   + +     P+E     + ++  +     PSI        I   E+   G  +L     D D G +G  +   +   N D    L      S + + + L T    DRE +   QL I  +D G P      ++++ I+DVNDN P F+   Y+ ++ E   P   +  + A D D G N+++ Y +      +  N    V S     NC Q   ++S   +K        C + V A D G P++ G T V++ L+D ND+ P+    F+     ++ +++  +  N   VA     D D G+NG  +  IV    L  F+L   + +L+      ++DRE +  +Y  ++ A D  T     +T T  + I + D ND+EP+F    +S Y   LS L P GS V  + A D+D+G+N+Q+ + +        FS++  +G ++T+  L    +    L I A D G +P+    Q   I + E  N ++  F++ E+  +   D     IV ++  T
Sbjct:  103 FTLDPVTGEVKTNVVLDREGMRDHYDLVVLSSQPTYPIEVRIKVLDVNDNSPEFPEPSI-------AISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYLAETEHQFTVNPETGVISTTERVNCPQQTNVKSSASQK-------SCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDE--NAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLE-EAADLHIVRVNGVLDRE-EIGKYNLTVVAMDQGTPA---RTTTAHLIIDVNDVNDHEPVF---EKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNELKWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGPNPKFAYTQLKVIILDE--NDEAPQFSQREQNVTLGEDAPPQTIVALMTAT 624          

HSP 12 Score: 126.716 bits (317), Expect = 9.657e-29
Identity = 153/595 (25.71%), Postives = 253/595 (42.52%), Query Frame = 1
Query:  619 GIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDL--KIHATDLDI--NANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLD-DGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRF---VCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLP-FKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTI 2376
            G+D EL   + + + A DG TPS      + + + D NDN P+ E   Y   +   LE  S   L   + A+D D   N NV YR   +        F++     I    +  + E    +Y F ++A+D G P      +V LHL ++N  PP          + + EN +IG  ++     D D G +   + S  E       +   + +S NI +   +     DRE +    L +   D    A+     I+I I D NDN+P+FE  FY ++  E  Q    + Q+ A D D  G N+ + Y      SL  P+ +  ++     +  +   R K+    R    +    V+ATD+G+P       V+I ++D ++N P F+QA Y     +D  + +  R V V      D G N ++ YS++   L   F +  + G +    LV     P    + +  R +   +  +   T  V IV+   N + P F     ++Y++ +    PVGS +  V A D D+G N  +++ +        FS++E +G ++    L      E  L I   D G   L+++  LTI
Sbjct: 2767 GLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAEV---LEEESPPQLIAVVKASDRDSGDNGNVIYRLQNDF----DGTFEITESGEIYTRMRLDREEI--GDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKFT---RLFSLNVTENAEIGSFVIRVTSSDLDLGANANASYSFSENPGEKFRI---EPQSGNITVAGHL-----DREQQDEYILKVVASDG---AWRAETPITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISY------SLQQPSPMFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQD--AVRGQRIVRVHANDKQDLGTN-EMDYSLMTFNLSSIFSVGRHDGWIT---LVKPIQVPPNTRYELVVRATDRGVPPQSDET-RVVIVVTGENMDTPRFSV---NSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNERQDFSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTI 3322          

HSP 13 Score: 119.783 bits (299), Expect = 1.361e-26
Identity = 154/599 (25.71%), Postives = 260/599 (43.41%), Query Frame = 1
Query:  622 IDRELISWH-NVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINAN-VTYRFSLNVPFIVQDCFDL----NPFNAI----LRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFY----HYTIFEENQPNFT-IAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQS-LDREKYPNGFRFVCPYQ--VIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYN--ISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLP-FKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILE---EEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSP 2346
            +DRE +  H ++ +L+     P     +++ IK++DVNDN P F       S   +    + L L   ATD D+  N VT ++ + V   V + F L    NP        L    +L  E   S Y+ +I A D G P       V + + + N  PP  +   ++  + + E    G  ++T +  DND G + K    + E ++   +       S    +       +     +      +F +D G P  +    +++ ++D ND+ P     F+         +EN  N T +A +   D D GLN +   RI     L   +  ++  ++  I+ +   LDRE+       +  Y   V+A D G P R+ +  + I++ D+ND+ PVF+++ Y+  +S L   GS      VA   A D D GVN  V Y I+    L  F ++P +G + +   +DRE + +    SI+ARD   N    K A   + ++I D ND  P F   ++    + L    P  ++V L+ A D D G N  + F L    E    + F+++  +G+L T   L      +  + + A D G+P
Sbjct:  118 LDREGMRDHYDLVVLSSQPTYP-----IEVRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLDA-ATDADVGENGVTDQYEI-VAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGS-YQLNISARDGGSPPRFGYLQVNVTILDVNDNPP--IFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYLAETEHQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNEL--GHFRLEEAADLHIVRVNGVLDREE-------IGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGS-----FVASITATDEDTGVNAQVHYDILSGNELKWFSMDPLTGLIVTTGPLDREIRDT-VELSISARDGGPN---PKFAYTQLKVIILDENDEAPQF---SQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAPSVERLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAP 685          

HSP 14 Score: 109.768 bits (273), Expect = 1.246e-23
Identity = 163/597 (27.30%), Postives = 252/597 (42.21%), Query Frame = 1
Query:  382 IQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDI--NANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKS----ENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTS--AEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLD-DGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVI--ATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYN--ISFLEDFGSKKNSRKVAVFIAHDPDFGVNGD-VTYSIVRETLLPF-KLNPNSGELYSYDLVDRETQP-----------------SQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDN 2076
            I +  EN + P++S NS  + V EN  + S  L +  A D D  PN +  Y I   ++    S ++   GI     +++ +D +LI  +++ +   D G    +    L I + DVNDN P+F    Y   I  N  +  T   + HA D D   NA + Y F  + P   +  F +N  N  +    S  +E     Y   I A +    +E S   + +H+   N + P  L P  +    + E   +G  +      D DSG DG+          Y +++  +  K      N  +I +   +  DRE + R+ L +  K++G    N +  A++ I I D ND  P+F K +Y  TI E       +  + A D D    N Q  Y I  + +L    K I V++  +I     LDRE+          Y ++  A D+G P ++GS TV IEL D+NDN P F     N  IS  E  G+      +   IA DPD   NG   TY ++      +  ++ NSG + S    DRE  P                 SQ+  +IT  D   N    ++  ++VS+   D   N
Sbjct: 3217 IVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTV-GATDDDTGPNGMLRYSISGGNERQDFSVDERTGGIV----IQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVG-TFVFQAHAADKDSPKNAIIHYAFLPSGPD--RHFFIMNQSNGTISSAVSFDYE-ERRIYTLQIKAKNPDSSME-SYANLYVHVLGVNEFYPQFLQPVFH--FDVSETSAVGTRVGAVQATDKDSGEDGRV---------YYLLVGSSNDKGFRIDTNTGLIYVA--RHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGND-PPEFIKHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSI-INGNLKQSFK-IDVQTG-EISTASRLDREE-------TSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTFTPEGLNGYISENEPAGT-----SIMTLIASDPDLPRNGGPFTYQLIGGKHKSWLSVDRNSGVVRSTTSFDREMTPILEAIIEVEDSGKPKQKSQHLLTITVLDQNDNPSTTRSLHIAVSLFNGDLPSN 3774          
BLAST of Protocadherin alpha-11 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304899)

HSP 1 Score: 195.667 bits (496), Expect = 6.537e-50
Identity = 201/730 (27.53%), Postives = 329/730 (45.07%), Query Frame = 1
Query:  376 LEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEK--------SNKGIKPFLKLRRGIDRELISWHNVTLLAVD---GGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLD---LKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQ--IIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETL------LPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEK-RNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGEFRNPDSTPFNETEESFLSDQATFII-----VGIILG 2481
            L++ +LD ND+ P +        + E   + S  + L +A D D   N    Y IE  +    ++ ++        S  G+   +  R  +DRE    +++ + A D     +  +T +  + +K++D NDN P F    YT  +  + +   T D     I ATD D   N   R+++ +    Q  F ++  +  + + K L +E   S YR  I A D G P   + T + +++ + N   P      +     ++EN  +G  I+     D+D G + +   SI E ++ +  L ++           + T K  DRE + R    +  KD G P  + S+ + I + DVNDN P F  ++Y   + E+  P   +  +TA D D+  +++L Y I   T+     +      N +  I   QSLD   Y    RF+    V ATDSG   RS + TV I + D N+  P+F+ A Y+ S  ED         V V  A D D GVN  +TYS+  E++       PF +NP +G + +   +DRET  S Y  ++TA+D     L   + T  V I + D NDN P F  P    Y+  +     VG+ V  V A D D G+N +I+++L +    +  F I+ TSG + T+  L         L   A+D GSP L++  ++ I + +         N++  +F SD+ T  +     VG ++G
Sbjct:  450 LQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITL-RATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGV---ISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPED-QWGGTEDNTVAHIRATDADQGNNAAIRYAI-IGGNTQSQFSIDSMSGDVSLVKPLDYESVRS-YRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYT--SQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISE-RDDNFPLAVDPRTGW------VQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDE--DSRLHYEI---TTGNTRGRFAITSQNGRGLITIAQSLD---YKQEKRFL--LTVAATDSG--GRSDTATVHINITDANNFAPIFENAPYSASVFED---APVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETT-SGYLLTVTAKDGGNPSL---SDTTDVEIGVTDVNDNAPAFKSP---LYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLED--------VNDSPPTFASDKITLYVPENSPVGSVVG 1133          

HSP 2 Score: 179.104 bits (453), Expect = 7.955e-45
Identity = 180/658 (27.36%), Postives = 301/658 (45.74%), Query Frame = 1
Query:  376 LEIQILDENDNVPQWSQNSIVIEVVENT--KLDSFYLELPKARDSDEHPNNISYYKI--EPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSL-----NVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDT--SLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETL--LPFKLNPNSGELYSYDLVDRETQPSQYTFSITA----RDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSG----ELLTSTVL 2286
            +++++LD+NDN PQ+S+ +  ++V E+     +   +   +A D+D+  N    Y I    T   F I S   +      + L + +D E +  + + + A DGG+PS++ + QLL+ +ID NDN P F +S + +S+  N+ +   + +++ A D D  AN    +S+     N P  V      +P    ++  K L  E     + F + A D G P + + ++V + +++ N   P+       A   + E+Q  G  + T    D D      +  +    +    I + N      IA       +  D + + R  L +   D G    + +A + I I D N+ +P FE   Y  ++FE+     T+  ++A D D G+NAQ+ Y +  ++   L  P+          I+    LDRE   +G+       V A D G P  S +T V I + D+NDN P F+   Y  S LED     +  +VA   A DPD G+NG + Y +    +    F ++P SG + +   +DRE   S   F +TA    + SP       ++TV V I +ED ND+ P F     + Y  + S   PVGS+V  + A D D G+N+ + + +     +  FS+    G    +LLT T L
Sbjct:  567 VQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGD------VSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNI-IRVQAYDSDEGANAEITYSISERDDNFPLAV------DPRTGWVQTIKPLDRE-EQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEA--NVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIA-------QSLDYKQEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETT-SGYLLT----VTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVA---ASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRE---SVAVFHLTAIAVDKGSPP-----LSSTVEVQIRLEDVNDSPPTFASDKITLYVPENS---PVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTEL 1180          

HSP 3 Score: 165.236 bits (417), Expect = 1.563e-40
Identity = 163/611 (26.68%), Postives = 277/611 (45.34%), Query Frame = 1
Query:  622 IDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNV----PFIVQD----CFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKT-TVTLHLK---NQNLYPPSILLPGNNAVIRIIENQDIGV---VILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQII-AIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVR-ETLLPFKLNPNSGE-LYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNIL-----FSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIG 2385
            +DREL+  H   ++A D   P ++G+  L + ++D ND+ P FE+  +  SI     + ST+ + + ATD DI  N    + +        + QD     F ++  + ++  + SL  E  +  Y   + A D      + +T T ++ +K   + + YP           +++ E+Q  G     +      D D G +     +I+   N     +++    +    +SL+  K  D E     +L+I  +D G P+ + + ++ + +ID NDN+P+F    +  ++ E     + I ++ A+D D+G NA++ Y I    S  D N  + V+     +  I+ LDRE+     RF   +QV+A D G P +S S++V I + D+NDN P F   +Y  +  ED   +     V    A DPD   +  + Y I    T   F +   +G  L +        Q  ++  ++ A DS       ++ T +V I I D N+  PIF     + Y   +    PVG+ V +V A D D G+N+QI + L EE  N L     FSIN  +G ++T+  L         L + A D G+P L+      +EIG
Sbjct:  422 LDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTV-ITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRET-SDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYP---QFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIG-GNTQSQFSIDSMSGD----VSLV--KPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSI----SERDDNFPLAVDPRTGWVQTIKPLDREEQ---GRFA--FQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGED---QPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGG-----RSDTATVHINITDANNFAPIF---ENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLS--DTTDVEIG 996          

HSP 4 Score: 159.073 bits (401), Expect = 1.205e-38
Identity = 184/724 (25.41%), Postives = 310/724 (42.82%), Query Frame = 1
Query:  361 NNLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNA--ILRVKKSLKHECFASEYRF--SIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTK--SENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVR---ETLLPFKLNPNS--GELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIF-----IFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEI---GEFRNPDSTPFNE-TEESFLSDQATFIIVGI 2472
            +N   L + ++D NDN P++  +     V+EN  +    + + +A DSDE  N    Y I      F ++ +     ++    L    DRE        ++A DGG P K+ S  ++I + DVNDN P F   +Y  ++  +    + +   + ATD D ++ + Y  +       +  F +   N   ++ + +SL    +  E RF  ++ A D G        TV +++ + N + P  +         + E+  +G  +L     D+D G++ +   S+    N + I  +      S N    +++TN   DRE  +   L +  KD G P+ + + ++ I + DVNDN+P F+   Y  +I E+     ++ Q+ A D D GLN +++Y +  D  + D + +I   S   I   + LDRE        V     IA D G P  S +  V I L D+ND+ P F      +   E+         V    AHDPD GVN  V YSI+             P S   +L +   +D E+   ++   + A   P     R  A   + I++ D NDN P+      IF N  ++        P G  +  + A D D  ++ ++ + +       L  +N +SG L+ S  L+       T+ +   D G     AI QL++ +       N  +   NE TEE+FLS    F + G+
Sbjct:  670 SNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRV-QAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPL----DREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPV-TTVTATDPDEDSRLHYEITTGN---TRGRFAITSQNGRGLITIAQSLD---YKQEKRFLLTVAATDSGG--RSDTATVHINITDANNFAP--IFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSL----NEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLS-DRDIEDGSFVIDPTSG-TIRTNKGLDRESVA-----VFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPEN---SPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAASPP----LRNDA--HIEILVTDVNDNAPVLRDFQVIFNNFRDH-------FPSGE-IGRIPAFDAD--VSDKLHYRILSGNNANLLRLNSSSGGLVLSPQLNTNVPKFATMEVSVSD-GINEAKAIMQLSVRLITEDMLFNSVTVRLNEMTEEAFLSPLLNFFLDGL 1346          

HSP 5 Score: 113.235 bits (282), Expect = 1.238e-24
Identity = 117/467 (25.05%), Postives = 208/467 (44.54%), Query Frame = 1
Query: 1030 VTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDT---SLYDPNKL--IKVESNCQIIAIQ-SLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIV-RETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARD--SPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGEFRNPD 2403
            V   L+NQ+ Y    L      V  ++E Q  G  + T   +D +         S+L+ ++  +    ++T         + T+   DRE+       +   D   P  + +  + + ++D ND+SP FE E +  +I E      T+  L A D D G NA++ Y I+  T    L    ++   +++S   +I+ + SLDRE   + +  +     +A+   E +R+ + +V ++++D NDN P F +  Y +   ED         VA   A D D G N  + Y+I+   T   F ++  SG++     +D E+  S Y   I A+D  SP+     ++ T  + + + D NDN P F     S ++  +   VPVG  +  V+A D D G N++I + + E   N   +++  +G + T   L    +G     + A D G P  +A   + I + +  + D
Sbjct:  348 VRRELRNQSPYFEQALY-----VASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSLLDSRSQSLFKVDSRTGV-------VTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRET-SDSYHLLVTAADLASAQSE-RRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRS-YRLVIRAQDGGSPS-----RSNTTQLLVNVIDANDNAPRFY---TSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDND 791          
BLAST of Protocadherin alpha-11 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0300578)

HSP 1 Score: 195.667 bits (496), Expect = 6.537e-50
Identity = 201/730 (27.53%), Postives = 329/730 (45.07%), Query Frame = 1
Query:  376 LEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEK--------SNKGIKPFLKLRRGIDRELISWHNVTLLAVD---GGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLD---LKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQ--IIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETL------LPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEK-RNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGEFRNPDSTPFNETEESFLSDQATFII-----VGIILG 2481
            L++ +LD ND+ P +        + E   + S  + L +A D D   N    Y IE  +    ++ ++        S  G+   +  R  +DRE    +++ + A D     +  +T +  + +K++D NDN P F    YT  +  + +   T D     I ATD D   N   R+++ +    Q  F ++  +  + + K L +E   S YR  I A D G P   + T + +++ + N   P      +     ++EN  +G  I+     D+D G + +   SI E ++ +  L ++           + T K  DRE + R    +  KD G P  + S+ + I + DVNDN P F  ++Y   + E+  P   +  +TA D D+  +++L Y I   T+     +      N +  I   QSLD   Y    RF+    V ATDSG   RS + TV I + D N+  P+F+ A Y+ S  ED         V V  A D D GVN  +TYS+  E++       PF +NP +G + +   +DRET  S Y  ++TA+D     L   + T  V I + D NDN P F  P    Y+  +     VG+ V  V A D D G+N +I+++L +    +  F I+ TSG + T+  L         L   A+D GSP L++  ++ I + +         N++  +F SD+ T  +     VG ++G
Sbjct:  450 LQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITL-RATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGV---ISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPED-QWGGTEDNTVAHIRATDADQGNNAAIRYAI-IGGNTQSQFSIDSMSGDVSLVKPLDYESVRS-YRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYT--SQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISE-RDDNFPLAVDPRTGW------VQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDE--DSRLHYEI---TTGNTRGRFAITSQNGRGLITIAQSLD---YKQEKRFL--LTVAATDSG--GRSDTATVHINITDANNFAPIFENAPYSASVFED---APVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETT-SGYLLTVTAKDGGNPSL---SDTTDVEIGVTDVNDNAPAFKSP---LYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLED--------VNDSPPTFASDKITLYVPENSPVGSVVG 1133          

HSP 2 Score: 179.104 bits (453), Expect = 7.955e-45
Identity = 180/658 (27.36%), Postives = 301/658 (45.74%), Query Frame = 1
Query:  376 LEIQILDENDNVPQWSQNSIVIEVVENT--KLDSFYLELPKARDSDEHPNNISYYKI--EPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSL-----NVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDT--SLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETL--LPFKLNPNSGELYSYDLVDRETQPSQYTFSITA----RDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSG----ELLTSTVL 2286
            +++++LD+NDN PQ+S+ +  ++V E+     +   +   +A D+D+  N    Y I    T   F I S   +      + L + +D E +  + + + A DGG+PS++ + QLL+ +ID NDN P F +S + +S+  N+ +   + +++ A D D  AN    +S+     N P  V      +P    ++  K L  E     + F + A D G P + + ++V + +++ N   P+       A   + E+Q  G  + T    D D      +  +    +    I + N      IA       +  D + + R  L +   D G    + +A + I I D N+ +P FE   Y  ++FE+     T+  ++A D D G+NAQ+ Y +  ++   L  P+          I+    LDRE   +G+       V A D G P  S +T V I + D+NDN P F+   Y  S LED     +  +VA   A DPD G+NG + Y +    +    F ++P SG + +   +DRE   S   F +TA    + SP       ++TV V I +ED ND+ P F     + Y  + S   PVGS+V  + A D D G+N+ + + +     +  FS+    G    +LLT T L
Sbjct:  567 VQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGD------VSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNI-IRVQAYDSDEGANAEITYSISERDDNFPLAV------DPRTGWVQTIKPLDRE-EQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEA--NVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIA-------QSLDYKQEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETT-SGYLLT----VTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVA---ASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRE---SVAVFHLTAIAVDKGSPP-----LSSTVEVQIRLEDVNDSPPTFASDKITLYVPENS---PVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTEL 1180          

HSP 3 Score: 165.236 bits (417), Expect = 1.563e-40
Identity = 163/611 (26.68%), Postives = 277/611 (45.34%), Query Frame = 1
Query:  622 IDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNV----PFIVQD----CFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKT-TVTLHLK---NQNLYPPSILLPGNNAVIRIIENQDIGV---VILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQII-AIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVR-ETLLPFKLNPNSGE-LYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNIL-----FSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIG 2385
            +DREL+  H   ++A D   P ++G+  L + ++D ND+ P FE+  +  SI     + ST+ + + ATD DI  N    + +        + QD     F ++  + ++  + SL  E  +  Y   + A D      + +T T ++ +K   + + YP           +++ E+Q  G     +      D D G +     +I+   N     +++    +    +SL+  K  D E     +L+I  +D G P+ + + ++ + +ID NDN+P+F    +  ++ E     + I ++ A+D D+G NA++ Y I    S  D N  + V+     +  I+ LDRE+     RF   +QV+A D G P +S S++V I + D+NDN P F   +Y  +  ED   +     V    A DPD   +  + Y I    T   F +   +G  L +        Q  ++  ++ A DS       ++ T +V I I D N+  PIF     + Y   +    PVG+ V +V A D D G+N+QI + L EE  N L     FSIN  +G ++T+  L         L + A D G+P L+      +EIG
Sbjct:  422 LDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTV-ITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRET-SDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYP---QFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIG-GNTQSQFSIDSMSGD----VSLV--KPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSI----SERDDNFPLAVDPRTGWVQTIKPLDREEQ---GRFA--FQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGED---QPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGG-----RSDTATVHINITDANNFAPIF---ENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLS--DTTDVEIG 996          

HSP 4 Score: 159.073 bits (401), Expect = 1.205e-38
Identity = 184/724 (25.41%), Postives = 310/724 (42.82%), Query Frame = 1
Query:  361 NNLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNA--ILRVKKSLKHECFASEYRF--SIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTK--SENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVR---ETLLPFKLNPNS--GELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIF-----IFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEI---GEFRNPDSTPFNE-TEESFLSDQATFIIVGI 2472
            +N   L + ++D NDN P++  +     V+EN  +    + + +A DSDE  N    Y I      F ++ +     ++    L    DRE        ++A DGG P K+ S  ++I + DVNDN P F   +Y  ++  +    + +   + ATD D ++ + Y  +       +  F +   N   ++ + +SL    +  E RF  ++ A D G        TV +++ + N + P  +         + E+  +G  +L     D+D G++ +   S+    N + I  +      S N    +++TN   DRE  +   L +  KD G P+ + + ++ I + DVNDN+P F+   Y  +I E+     ++ Q+ A D D GLN +++Y +  D  + D + +I   S   I   + LDRE        V     IA D G P  S +  V I L D+ND+ P F      +   E+         V    AHDPD GVN  V YSI+             P S   +L +   +D E+   ++   + A   P     R  A   + I++ D NDN P+      IF N  ++        P G  +  + A D D  ++ ++ + +       L  +N +SG L+ S  L+       T+ +   D G     AI QL++ +       N  +   NE TEE+FLS    F + G+
Sbjct:  670 SNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRV-QAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPL----DREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPV-TTVTATDPDEDSRLHYEITTGN---TRGRFAITSQNGRGLITIAQSLD---YKQEKRFLLTVAATDSGG--RSDTATVHINITDANNFAP--IFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSL----NEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLS-DRDIEDGSFVIDPTSG-TIRTNKGLDRESVA-----VFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPEN---SPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAASPP----LRNDA--HIEILVTDVNDNAPVLRDFQVIFNNFRDH-------FPSGE-IGRIPAFDAD--VSDKLHYRILSGNNANLLRLNSSSGGLVLSPQLNTNVPKFATMEVSVSD-GINEAKAIMQLSVRLITEDMLFNSVTVRLNEMTEEAFLSPLLNFFLDGL 1346          

HSP 5 Score: 113.235 bits (282), Expect = 1.238e-24
Identity = 117/467 (25.05%), Postives = 208/467 (44.54%), Query Frame = 1
Query: 1030 VTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDT---SLYDPNKL--IKVESNCQIIAIQ-SLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIV-RETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARD--SPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGEFRNPD 2403
            V   L+NQ+ Y    L      V  ++E Q  G  + T   +D +         S+L+ ++  +    ++T         + T+   DRE+       +   D   P  + +  + + ++D ND+SP FE E +  +I E      T+  L A D D G NA++ Y I+  T    L    ++   +++S   +I+ + SLDRE   + +  +     +A+   E +R+ + +V ++++D NDN P F +  Y +   ED         VA   A D D G N  + Y+I+   T   F ++  SG++     +D E+  S Y   I A+D  SP+     ++ T  + + + D NDN P F     S ++  +   VPVG  +  V+A D D G N++I + + E   N   +++  +G + T   L    +G     + A D G P  +A   + I + +  + D
Sbjct:  348 VRRELRNQSPYFEQALY-----VASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSLLDSRSQSLFKVDSRTGV-------VTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRET-SDSYHLLVTAADLASAQSE-RRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYESVRS-YRLVIRAQDGGSPS-----RSNTTQLLVNVIDANDNAPRFY---TSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDND 791          
BLAST of Protocadherin alpha-11 vs. Ensembl Zebrafish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 238.81 bits (608), Expect = 3.224e-64
Identity = 201/680 (29.56%), Postives = 325/680 (47.79%), Query Frame = 1
Query:  382 IQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIE--PTSKYFFISSEKSNKGIK-PFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPF-IVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPG------NNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNC-QIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGE 2388
            I++ D NDN PQ+    + + V ENT + + +  +P A D D   N ++ Y +   P +   F      ++G K P L +   +DREL   +++T+ AVDGG P +  S  L + I D NDN P FE S Y   +  N  I  ++ L++ A D D+  N    ++L+     V     ++  + I+ VK  L  E   +  +F + A D G   + SKT V++ + +QN   P++ + G      ++ V  I E+  +G  +    V D D G +    C +     + +    + +  +N     L T    D E     ++ I   D G PA +++  + + + D NDNSP F    +     EENQP   + ++ A D D G NA+L Y I  D+S      L +++ N  ++ A   LDRE + + + F    +V A D G P   G+ TV I+++D NDN P F  + Y+ S LE+         V +    D D G N  V  S V   +  F +   +G + S    DRE + S YTF + A D        +++ V V+I + D NDN P+   P+ S++ I+LS +    S+V +V+A D DSG N+++ + +     + LF I+ ++GE+  +  L+  H G   L IK  D G P   AI  + I + E
Sbjct:  119 IEVQDINDNTPQFPSPVLTLSVPENTHMGALF-SIPLATDKDTERNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSV-LQVKANDSDLGPNGEIEYTLHQAIDPVPKLLRIDRSSGIIYVKGPLDREEI-NNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQL-RPASDSSVDNKRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVEVVASDADSGTNAELVYSIIADSST---RGLFEIDPNSGEVRARSPLDRE-HKDRYEF----RVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSGYSFSVLENMPPLS---PVGMVTVQDMDEGENAQVQLS-VEPDVGKFVIQNGTGTILSSISFDREKE-SSYTFRLKAVDGGDP---PRSSYVGVTINVLDENDNAPVVTKPSNSSF-IRLSPMAAPDSVVEVVEAEDIDSGSNAELVYSIAGGNPHDLFYISPSNGEITLTKELTRKHSGLHRLVIKVSDRGKPSRHAIALVHIYVNE 777          

HSP 2 Score: 144.436 bits (363), Expect = 2.144e-34
Identity = 154/564 (27.30%), Postives = 253/564 (44.86%), Query Frame = 1
Query:  373 ILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYY----KIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFE--------SSFYTQSIDCNLEINSTLDL-KIHATDLDINANVTYRFSLNVPFIVQDCFDL---NPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLP-FKLNPNSGEL-YSYDLVDRETQPSQYTFSITARDSPT 2010
            +L + I D NDN P++ ++S   EV EN+ +    L++ KA DSD  PN    Y     I+P  K   I     + GI   + ++  +DRE I+     ++A D G   K+    + I + D NDN P  E         S    +I  ++ + + + L ++   D   NA VT   + +VPF ++   D    N     L+    L +E    +YR  I A+D G P   S  ++ + + + N   P I  P    V    ENQ  G  ++  V  D DSG + +   SI+   +   +  ++    E  A   L      DRE K R +  +   D G P+   +A + I ++D NDN P+F    Y +++ E   P   +  +T  D+D+G NAQ++  ++ D       K +       I++  S DREK  + + F    ++ A D G+P RS    V+I ++D NDN PV  +   N SF+           V V  A D D G N ++ YSI        F ++P++GE+  + +L  + +   +    ++ R  P+
Sbjct:  228 LLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQV-KANDSDLGPNGEIEYTLHQAIDPVPKLLRID---RSSGI---IYVKGPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSSVDNKRKYFLQTTTPLDYERV-RDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSP-IFSPTLFEVEFAEENQP-GEKVVEVVASDADSGTNAELVYSIIADSSTRGLFEIDPNSGEVRARSPL------DREHKDRYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVQDMDEGENAQVQLSVEPDV-----GKFVIQNGTGTILSSISFDREKE-SSYTF----RLKAVDGGDPPRSSYVGVTINVLDENDNAPVVTKP-SNSSFIRLSPMAAPDSVVEVVEAEDIDSGSNAELVYSIAGGNPHDLFYISPSNGEITLTKELTRKHSGLHRLVIKVSDRGKPS 764          

HSP 3 Score: 91.2781 bits (225), Expect = 4.727e-18
Identity = 103/403 (25.56%), Postives = 170/403 (42.18%), Query Frame = 1
Query: 1276 TNKIFDREVKTRIQLIIFCKDFGKPAF------------NTSA---EXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNC----QIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLP----FKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPI-----FIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGE------LLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEI 2382
            T  IF  E+    + +  C++ GKP F            N S    E  I + D+NDN+PQF       ++ E        +   A D D   N    Y +           L   E       Q+I + SLDRE      +      + A D G P R  S  + + + D NDN P F+++ Y     E+         V    A+D D G NG++ Y++  + + P     +++ +SG +Y    +DRE + +   F + ARD   +    K++   VSI + D NDN P            S+    +S  +PVG+ V LV+  DKD G N+ +  ++  +    L   +++S +      L T+T L      +  + I A+D G+P L++   L +++
Sbjct:   70 TGDIFTTEIPIDRETLKDCRNKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTERNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRE-----LKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAEN---SPIGHSVLQVKANDSDLGPNGEIEYTL-HQAIDPVPKLLRIDRSSGIIYVKGPLDRE-EINNLKFYVVARDKGPS---PKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSSVDNKRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQV 459          

HSP 4 Score: 62.003 bits (149), Expect = 4.882e-9
Identity = 80/304 (26.32%), Postives = 121/304 (39.80%), Query Frame = 1
Query: 1435 YTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQS-----------LDREKYPN----GFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVF---IAHDPDFGVNGDVTYSIVRE----TLLPFKLNPNSGE----LYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNI--LFSINETSG 2262
            Y + EE  P+  I  L A                 D  L D   L K+E     + +             +DRE   +    G      ++V  TD  + Q        IE+ DINDN P F      +S  E      N+   A+F   +A D D   NG   Y++        L   ++  + GE    L     +DRE + S Y  +I A D      Y   ++  + +VI D NDN P F    +S+Y+ +++   P+G  V  VKA D D G N +I++ L +    +  L  I+ +SG
Sbjct:   27 YRVHEEQPPSTLIGSLAA-----------------DQGLPDTGHLYKLEVGAPYLRVDGKTGDIFTTEIPIDRETLKDCRNKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVPE------NTHMGALFSIPLATDKDTERNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDS-YDLTIKAVDGGNPPRY---SSALLRVVIADANDNAPKF---EKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDPVPKLLRIDRSSG 300          
BLAST of Protocadherin alpha-11 vs. Ensembl Zebrafish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 238.039 bits (606), Expect = 1.400e-63
Identity = 201/680 (29.56%), Postives = 325/680 (47.79%), Query Frame = 1
Query:  382 IQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIE--PTSKYFFISSEKSNKGIK-PFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPF-IVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPG------NNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNC-QIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGE 2388
            I++ D NDN PQ+    + + V ENT + + +  +P A D D   N ++ Y +   P +   F      ++G K P L +   +DREL   +++T+ AVDGG P +  S  L + I D NDN P FE S Y   +  N  I  ++ L++ A D D+  N    ++L+     V     ++  + I+ VK  L  E   +  +F + A D G   + SKT V++ + +QN   P++ + G      ++ V  I E+  +G  +    V D D G +    C +     + +    + +  +N     L T    D E     ++ I   D G PA +++  + + + D NDNSP F    +     EENQP   + ++ A D D G NA+L Y I  D+S      L +++ N  ++ A   LDRE + + + F    +V A D G P   G+ TV I+++D NDN P F  + Y+ S LE+         V +    D D G N  V  S V   +  F +   +G + S    DRE + S YTF + A D        +++ V V+I + D NDN P+   P+ S++ I+LS +    S+V +V+A D DSG N+++ + +     + LF I+ ++GE+  +  L+  H G   L IK  D G P   AI  + I + E
Sbjct:  119 IEVQDINDNTPQFPSPVLTLSVPENTHMGALF-SIPLATDKDTERNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSV-LQVKANDSDLGPNGEIEYTLHQAIDPVPKLLRIDRSSGIIYVKGPLDREEI-NNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQL-RPASDSSVDNKRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVEVVASDADSGTNAELVYSIIADSST---RGLFEIDPNSGEVRARSPLDRE-HKDRYEF----RVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSGYSFSVLENMPPLS---PVGMVTVQDMDEGENAQVQLS-VEPDVGKFVIQNGTGTILSSISFDREKE-SSYTFRLKAVDGGDP---PRSSYVGVTINVLDENDNAPVVTKPSNSSF-IRLSPMAAPDSVVEVVEAEDIDSGSNAELVYSIAGGNPHDLFYISPSNGEITLTKELTRKHSGLHRLVIKVSDRGKPSRHAIALVHIYVNE 777          

HSP 2 Score: 144.436 bits (363), Expect = 2.874e-34
Identity = 149/568 (26.23%), Postives = 253/568 (44.54%), Query Frame = 1
Query:  373 ILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYY----KIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFE--------SSFYTQSIDCNLEINSTLDL-KIHATDLDINANVTYRFSLNVPFIVQDCFDL---NPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQN----LYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLP-FKLNPNSGEL-YSYDLVDRETQPSQYTFSITARDSPT 2010
            +L + I D NDN P++ ++S   EV EN+ +    L++ KA DSD  PN    Y     I+P  K   I     + GI   + ++  +DRE I+     ++A D G   K+    + I + D NDN P  E         S    +I  ++ + + + L ++   D   NA VT   + +VPF ++   D    N     L+    L +E    +YR  I A+D G P   S  ++ + + + N    ++ P++        +   E    G  ++  V  D DSG + +   SI+   +   +  ++    E  A   L      DRE K R +  +   D G P+   +A + I ++D NDN P+F    Y +++ E   P   +  +T  D+D+G NAQ++  ++ D       K +       I++  S DREK  + + F    ++ A D G+P RS    V+I ++D NDN PV  +   N SF+           V V  A D D G N ++ YSI        F ++P++GE+  + +L  + +   +    ++ R  P+
Sbjct:  228 LLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQV-KANDSDLGPNGEIEYTLHQAIDPVPKLLRID---RSSGI---IYVKGPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSSVDNKRKYFLQTTTPLDYERV-RDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLF------EVEFAEENQPGEKVVEVVASDADSGTNAELVYSIIADSSTRGLFEIDPNSGEVRARSPL------DREHKDRYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVQDMDEGENAQVQLSVEPDV-----GKFVIQNGTGTILSSISFDREKE-SSYTF----RLKAVDGGDPPRSSYVGVTINVLDENDNAPVVTKP-SNSSFIRLSPMAAPDSVVEVVEAEDIDSGSNAELVYSIAGGNPHDLFYISPSNGEITLTKELTRKHSGLHRLVIKVSDRGKPS 764          

HSP 3 Score: 90.8929 bits (224), Expect = 7.485e-18
Identity = 103/403 (25.56%), Postives = 170/403 (42.18%), Query Frame = 1
Query: 1276 TNKIFDREVKTRIQLIIFCKDFGKPAF------------NTSA---EXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNC----QIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLP----FKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPI-----FIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGE------LLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEI 2382
            T  IF  E+    + +  C++ GKP F            N S    E  I + D+NDN+PQF       ++ E        +   A D D   N    Y +           L   E       Q+I + SLDRE      +      + A D G P R  S  + + + D NDN P F+++ Y     E+         V    A+D D G NG++ Y++  + + P     +++ +SG +Y    +DRE + +   F + ARD   +    K++   VSI + D NDN P            S+    +S  +PVG+ V LV+  DKD G N+ +  ++  +    L   +++S +      L T+T L      +  + I A+D G+P L++   L +++
Sbjct:   70 TGDIFTTEIPIDRETLKDCRNKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTERNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRE-----LKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAEN---SPIGHSVLQVKANDSDLGPNGEIEYTL-HQAIDPVPKLLRIDRSSGIIYVKGPLDRE-EINNLKFYVVARDKGPS---PKSSKTYVSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSSVDNKRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQV 459          

HSP 4 Score: 61.2326 bits (147), Expect = 7.806e-9
Identity = 80/304 (26.32%), Postives = 121/304 (39.80%), Query Frame = 1
Query: 1435 YTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQS-----------LDREKYPN----GFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVF---IAHDPDFGVNGDVTYSIVRE----TLLPFKLNPNSGE----LYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNI--LFSINETSG 2262
            Y + EE  P+  I  L A                 D  L D   L K+E     + +             +DRE   +    G      ++V  TD  + Q        IE+ DINDN P F      +S  E      N+   A+F   +A D D   NG   Y++        L   ++  + GE    L     +DRE + S Y  +I A D      Y   ++  + +VI D NDN P F    +S+Y+ +++   P+G  V  VKA D D G N +I++ L +    +  L  I+ +SG
Sbjct:   27 YRVHEEQPPSTLIGSLAA-----------------DQGLPDTGHLYKLEVGAPYLRVDGKTGDIFTTEIPIDRETLKDCRNKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVPE------NTHMGALFSIPLATDKDTERNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDS-YDLTIKAVDGGNPPRY---SSALLRVVIADANDNAPKF---EKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDPVPKLLRIDRSSG 300          
BLAST of Protocadherin alpha-11 vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 226.483 bits (576), Expect = 4.140e-60
Identity = 197/670 (29.40%), Postives = 321/670 (47.91%), Query Frame = 1
Query:  382 IQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKI----EPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFI-VQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPG------NNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQS-LDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAI---DKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSP 2346
            I+ILDENDN PQ+S   + + + ENT + + +  +P A D D   N I+ Y +    E T+ +    ++ S++ + P L +   +DREL   +++ +  VDGG+P +  S  L I I D NDN P FE S Y   +  N  +  ++ L++ A D D+  N    +SL+ P   V     ++    I+ VK S+  E   S  +F + A D+G   + SK  VT+ +K+QN   PSI + G       + V  I E+  +G  +    V D D G +    C +     +  + + ++T ++      L T  + D E     ++ I   D G PA +++  + + + D+NDN+P F    Y    FEENQP   +  + A D D G NA+L Y I   +    P  L ++  N   + + S LDRE+  + ++F+    V A D G P   G+ TV ++++D NDN P F    Y+ S  E+         V +   +D D G N  V  S+  +    F +   +  + S    DRE + S Y+F + A D        +++ V ++I + D NDN P    P  S+YK    +L P  S  T V+++   D D G+NS++ F +     + LF I+ + GE+  +   +  H G   L +K  D G+P
Sbjct:  142 IEILDENDNTPQFSSPVLTLSIPENTHVGALF-AIPVATDRDSGSNGIADYALTTGPEATNLFSLQVAQDSDEKL-PQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSV-LQVKANDSDMGPNGEVTYSLHQPSSPVMRLLSIDRNTGIIFVKGSVDREEI-SILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQ-LRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSV---PEGLFEINPNTGEVRVMSQLDREQL-DHYQFL----VAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLS---PVGMVTVNDHDEGENARVQLSVEPDN-GKFMIQNGTYTILSTISFDREKE-STYSFRLKAVDGGDP---PRSSYVGITINVLDENDNAPYVTKPANSSYK----FLDPRTSPETHVESVEAEDIDIGLNSELDFNIVGGNPHGLFRIS-SEGEITLAKEFTPKHIGLHRLVVKVKDKGTP 785          

HSP 2 Score: 137.887 bits (346), Expect = 2.682e-32
Identity = 140/518 (27.03%), Postives = 237/518 (45.75%), Query Frame = 1
Query:  373 ILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNN-ISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKP--------IFESSFYTQSIDCNLEINSTLDL-KIHATDLDINANVTYRFSLNVPFIVQDCFDLN---PFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIP-VFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIV 1884
            +L I I D NDNVP++ ++    E+ EN+ +    L++ KA DSD  PN  ++Y   +P+S    + S   N GI   + ++  +DRE IS     + A D G  SK+    + I + D NDN P        +        +I  ++ + + + L ++   D   NA VT   + +VPF ++   +          L+    L +E    EYR  I A+D G P   S  ++ + + + N   P +  P    V    ENQ  G  +L  V  D DSG + +   SI      + +  +N    E + ++S +     DRE     Q ++   D G P+   +A + + ++D NDN P+F    Y +++ E   P   +  +T +D D+G NA+++  ++ D       K +       I++  S DREK          +++ A D G+P RS    ++I ++D NDN P V + A  +  FL+   S +    V    A D D G+N ++ ++IV
Sbjct:  251 LLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQV-KANDSDMGPNGEVTYSLHQPSSPVMRLLSIDRNTGI---IFVKGSVDREEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLLDYERI-KEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAP-VFSPTLYEVEFFEENQP-GDKVLDVVATDADSGTNAELTYSITGGSVPEGLFEINPNTGE-VRVMSQL-----DREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPDNG-----KFMIQNGTYTILSTISFDREK-----ESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPET--HVESVEAEDIDIGLNSELDFNIV 743          

HSP 3 Score: 113.62 bits (283), Expect = 7.898e-25
Identity = 120/453 (26.49%), Postives = 197/453 (43.49%), Query Frame = 1
Query: 1099 IRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPN----KLIKVESNCQIIAIQ-SLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIP----------VFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGE---------LYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQF-ILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEI 2382
            + I EN  +G +    V  D DSG +G  + ++        + ++   +  +  +  LI     DRE++    L I   D G P   +SA + I I D NDN P+FE+  Y   + E +    ++ Q+ A+D D G N ++ Y      SL+ P+    +L+ ++ N  II ++ S+DRE+       +  + V A D+G   +S    V+I + D NDN P            +    NIS     G+      VA+    D D G N  VT  +  +  +PF+L   S           L +  L+D E +  +Y   I A DS    L   ++T S+ + + D NDN P+F   + + Y+++       G  V  V A D DSG N+++ + I        LF IN  +GE+   + L           + A D G P L     + +++
Sbjct:  161 LSIPENTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTY------SLHQPSSPVMRLLSIDRNTGIIFVKGSVDREEIS-----ILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGT-----AVALVEVSDRDEGENAVVTCVVAGD--VPFQLRSASETGNDRKRKYFLQTTTLLDYE-RIKEYRIEIVAVDSGNPAL---SSTNSLKVQVTDMNDNAPVF---SPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSVPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKV 588          
BLAST of Protocadherin alpha-11 vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 226.098 bits (575), Expect = 4.760e-60
Identity = 197/670 (29.40%), Postives = 321/670 (47.91%), Query Frame = 1
Query:  382 IQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKI----EPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFI-VQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPG------NNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQS-LDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAI---DKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSP 2346
            I+ILDENDN PQ+S   + + + ENT + + +  +P A D D   N I+ Y +    E T+ +    ++ S++ + P L +   +DREL   +++ +  VDGG+P +  S  L I I D NDN P FE S Y   +  N  +  ++ L++ A D D+  N    +SL+ P   V     ++    I+ VK S+  E   S  +F + A D+G   + SK  VT+ +K+QN   PSI + G       + V  I E+  +G  +    V D D G +    C +     +  + + ++T ++      L T  + D E     ++ I   D G PA +++  + + + D+NDN+P F    Y    FEENQP   +  + A D D G NA+L Y I   +    P  L ++  N   + + S LDRE+  + ++F+    V A D G P   G+ TV ++++D NDN P F    Y+ S  E+         V +   +D D G N  V  S+  +    F +   +  + S    DRE + S Y+F + A D        +++ V ++I + D NDN P    P  S+YK    +L P  S  T V+++   D D G+NS++ F +     + LF I+ + GE+  +   +  H G   L +K  D G+P
Sbjct:  127 IEILDENDNTPQFSSPVLTLSIPENTHVGALFA-IPVATDRDSGSNGIADYALTTGPEATNLFSLQVAQDSDEKL-PQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSV-LQVKANDSDMGPNGEVTYSLHQPSSPVMRLLSIDRNTGIIFVKGSVDREEI-SILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQ-LRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSV---PEGLFEINPNTGEVRVMSQLDREQL-DHYQFL----VAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLS---PVGMVTVNDHDEGENARVQLSVEPDNGK-FMIQNGTYTILSTISFDREKE-STYSFRLKAVDGGDP---PRSSYVGITINVLDENDNAPYVTKPANSSYK----FLDPRTSPETHVESVEAEDIDIGLNSELDFNIVGGNPHGLFRIS-SEGEITLAKEFTPKHIGLHRLVVKVKDKGTP 770          

HSP 2 Score: 137.502 bits (345), Expect = 3.002e-32
Identity = 140/518 (27.03%), Postives = 237/518 (45.75%), Query Frame = 1
Query:  373 ILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNN-ISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKP--------IFESSFYTQSIDCNLEINSTLDL-KIHATDLDINANVTYRFSLNVPFIVQDCFDLN---PFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIP-VFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIV 1884
            +L I I D NDNVP++ ++    E+ EN+ +    L++ KA DSD  PN  ++Y   +P+S    + S   N GI   + ++  +DRE IS     + A D G  SK+    + I + D NDN P        +        +I  ++ + + + L ++   D   NA VT   + +VPF ++   +          L+    L +E    EYR  I A+D G P   S  ++ + + + N   P +  P    V    ENQ  G  +L  V  D DSG + +   SI      + +  +N    E + ++S +     DRE     Q ++   D G P+   +A + + ++D NDN P+F    Y +++ E   P   +  +T +D D+G NA+++  ++ D       K +       I++  S DREK          +++ A D G+P RS    ++I ++D NDN P V + A  +  FL+   S +    V    A D D G+N ++ ++IV
Sbjct:  236 LLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQV-KANDSDMGPNGEVTYSLHQPSSPVMRLLSIDRNTGI---IFVKGSVDREEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLLDYERI-KEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAP-VFSPTLYEVEFFEENQP-GDKVLDVVATDADSGTNAELTYSITGGSVPEGLFEINPNTGE-VRVMSQL-----DREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPDNG-----KFMIQNGTYTILSTISFDREK-----ESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPET--HVESVEAEDIDIGLNSELDFNIV 728          

HSP 3 Score: 113.235 bits (282), Expect = 9.986e-25
Identity = 118/450 (26.22%), Postives = 195/450 (43.33%), Query Frame = 1
Query: 1096 VIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQ-SLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIP----------VFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGE---------LYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQF-ILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEI 2382
             + I EN  +G +    V  D DSG +G  + ++        + ++   +  +  +  LI     DRE++    L I   D G P   +SA + I I D NDN P+FE+  Y   + E +    ++ Q+ A+D D G N ++ Y +   +S     +L+ ++ N  II ++ S+DRE+       +  + V A D+G   +S    V+I + D NDN P            +    NIS     G+      VA+    D D G N  VT  +  +  +PF+L   S           L +  L+D E +  +Y   I A DS    L   ++T S+ + + D NDN P+F   + + Y+++       G  V  V A D DSG N+++ + I        LF IN  +GE+   + L           + A D G P L     + +++
Sbjct:  145 TLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPSSPV--MRLLSIDRNTGIIFVKGSVDREEI-----SILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGT-----AVALVEVSDRDEGENAVVTCVVAGD--VPFQLRSASETGNDRKRKYFLQTTTLLDYE-RIKEYRIEIVAVDSGNPAL---SSTNSLKVQVTDMNDNAPVF---SPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSVPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKV 573          
BLAST of Protocadherin alpha-11 vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 225.713 bits (574), Expect = 5.103e-60
Identity = 197/670 (29.40%), Postives = 321/670 (47.91%), Query Frame = 1
Query:  382 IQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKI----EPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFI-VQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPG------NNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQS-LDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAI---DKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSP 2346
            I+ILDENDN PQ+S   + + + ENT + + +  +P A D D   N I+ Y +    E T+ +    ++ S++ + P L +   +DREL   +++ +  VDGG+P +  S  L I I D NDN P FE S Y   +  N  +  ++ L++ A D D+  N    +SL+ P   V     ++    I+ VK S+  E   S  +F + A D+G   + SK  VT+ +K+QN   PSI + G       + V  I E+  +G  +    V D D G +    C +     +  + + ++T ++      L T  + D E     ++ I   D G PA +++  + + + D+NDN+P F    Y    FEENQP   +  + A D D G NA+L Y I   +    P  L ++  N   + + S LDRE+  + ++F+    V A D G P   G+ TV ++++D NDN P F    Y+ S  E+         V +   +D D G N  V  S+  +    F +   +  + S    DRE + S Y+F + A D        +++ V ++I + D NDN P    P  S+YK    +L P  S  T V+++   D D G+NS++ F +     + LF I+ + GE+  +   +  H G   L +K  D G+P
Sbjct:  129 IEILDENDNTPQFSSPVLTLSIPENTHVGALFA-IPVATDRDSGSNGIADYALTTGPEATNLFSLQVAQDSDEKL-PQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSV-LQVKANDSDMGPNGEVTYSLHQPSSPVMRLLSIDRNTGIIFVKGSVDREEI-SILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQ-LRSASETGNDRKRKYFLQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSV---PEGLFEINPNTGEVRVMSQLDREQL-DHYQFL----VAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLS---PVGMVTVNDHDEGENARVQLSVEPDN-GKFMIQNGTYTILSTISFDREKE-STYSFRLKAVDGGDP---PRSSYVGITINVLDENDNAPYVTKPANSSYK----FLDPRTSPETHVESVEAEDIDIGLNSELDFNIVGGNPHGLFRIS-SEGEITLAKEFTPKHIGLHRLVVKVKDKGTP 772          

HSP 2 Score: 137.502 bits (345), Expect = 3.324e-32
Identity = 140/518 (27.03%), Postives = 237/518 (45.75%), Query Frame = 1
Query:  373 ILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNN-ISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKP--------IFESSFYTQSIDCNLEINSTLDL-KIHATDLDINANVTYRFSLNVPFIVQDCFDLN---PFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIP-VFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIV 1884
            +L I I D NDNVP++ ++    E+ EN+ +    L++ KA DSD  PN  ++Y   +P+S    + S   N GI   + ++  +DRE IS     + A D G  SK+    + I + D NDN P        +        +I  ++ + + + L ++   D   NA VT   + +VPF ++   +          L+    L +E    EYR  I A+D G P   S  ++ + + + N   P +  P    V    ENQ  G  +L  V  D DSG + +   SI      + +  +N    E + ++S +     DRE     Q ++   D G P+   +A + + ++D NDN P+F    Y +++ E   P   +  +T +D D+G NA+++  ++ D       K +       I++  S DREK          +++ A D G+P RS    ++I ++D NDN P V + A  +  FL+   S +    V    A D D G+N ++ ++IV
Sbjct:  238 LLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQV-KANDSDMGPNGEVTYSLHQPSSPVMRLLSIDRNTGI---IFVKGSVDREEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYFLQTTTLLDYERI-KEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAP-VFSPTLYEVEFFEENQP-GDKVLDVVATDADSGTNAELTYSITGGSVPEGLFEINPNTGE-VRVMSQL-----DREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQLSVEPDNG-----KFMIQNGTYTILSTISFDREK-----ESTYSFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPANSSYKFLDPRTSPET--HVESVEAEDIDIGLNSELDFNIV 730          

HSP 3 Score: 112.849 bits (281), Expect = 1.078e-24
Identity = 118/449 (26.28%), Postives = 195/449 (43.43%), Query Frame = 1
Query: 1099 IRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQ-SLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIP----------VFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGE---------LYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQF-ILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEI 2382
            + I EN  +G +    V  D DSG +G  + ++        + ++   +  +  +  LI     DRE++    L I   D G P   +SA + I I D NDN P+FE+  Y   + E +    ++ Q+ A+D D G N ++ Y +   +S     +L+ ++ N  II ++ S+DRE+       +  + V A D+G   +S    V+I + D NDN P            +    NIS     G+      VA+    D D G N  VT  +  +  +PF+L   S           L +  L+D E +  +Y   I A DS    L   ++T S+ + + D NDN P+F   + + Y+++       G  V  V A D DSG N+++ + I        LF IN  +GE+   + L           + A D G P L     + +++
Sbjct:  148 LSIPENTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPSSPV--MRLLSIDRNTGIIFVKGSVDREEI-----SILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGLVTHEDGVANISEDMPVGT-----AVALVEVSDRDEGENAVVTCVVAGD--VPFQLRSASETGNDRKRKYFLQTTTLLDYE-RIKEYRIEIVAVDSGNPAL---SSTNSLKVQVTDMNDNAPVF---SPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSVPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKV 575          
BLAST of Protocadherin alpha-11 vs. Ensembl Xenopus
Match: ENSXETT00000047801.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 229.18 bits (583), Expect = 7.431e-61
Identity = 220/770 (28.57%), Postives = 371/770 (48.18%), Query Frame = 1
Query:  124 QIFENLPVGSVICKLSNVIIPRPSDTTKFKLIKNR----FFQIE--NGDNLKVSGLIDRDDNLELCAYRNVNFSCIWR-GILFCGTNNLKILEIQIL--DENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIK-PFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDI--NANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSI----LLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNK--LIKVESNCQII-AIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLED---FGSKKNSRKVAVFIAHDPDFGVNGDVTYSIV--RETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARD--SPTNLLYRKTATVSVSIVIEDCNDNEPIFIFP-NESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGEL-LTSTVLSVIHKGEETLFIKAIDCGSPR 2349
            ++ EN+ +G+++  L+  + P  S   +FKL+         ++E   G+    S  IDR+   +LC+       C +   +        ++++I+ L  D NDN P +    I I + ENT ++S Y  +P A D D   N I +Y++      F +   ++ +G K P L +++ +DRE    + + +   DGG P+++ +  L + + DVNDN+P+F+      +I  +  + +++  ++HATD D+  NA + + F   +  + +  F ++    ++ VK+ L  E  +  ++ ++ A D       S+ TVT+++ + N   PSI    ++   N  +++ E   +   I    V D D+ ++GK  C      ++D+   +            L T    D E      + I   D GKP  N SA + I I D NDN+P F       +  E N P   + +++A D D G NA+L Y       +  PN   +  ++    I+ A++ LDREK     R+   + VIA D+G P    +TTV++ ++D NDN P F    YN    E+   +G+      V +    D D G N  VT S+V  R+    F ++P +G +      DRE Q S YTF + A D  SP     +K++TV V+I +ED NDN+P+F+ P N  +Y +  +   P GS+V  V AID D+GIN+ +++ +       LF+I E SG + L   +L+  H     L IK  D G P 
Sbjct:   53 ELPENVLIGNLLKDLNLTLDPDLSTPLQFKLVYKTGDVPLIRVEENTGEIFTTSNRIDRE---KLCSGIFTENKCFYEVEVAVLPDEVFRLVKIRFLIEDINDNSPLFPSTVINISIPENTAVNSRY-SVPSAIDPDVGVNGIQHYELLKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSV-TQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKEPLDREE-SPYHKLTVLASDGSS--TPSRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFT----DHDVPFRLKPVFDNQFL---LETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSY-------MLGPNAPTIFNLDRRTGILTAVRKLDREKQD---RYT--FTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGT------VGLITVTDADSGENAVVTLSLVNARDN---FIIDPLTGVIRPNITFDREQQGS-YTFQVKALDKGSP-----QKSSTVKVTIFVEDVNDNKPVFVIPSNNYSYDLVQTSTSP-GSVVARVYAIDNDTGINADLRYSIIGGNSRGLFAIGERSGNITLKEKLLAGDHGVLYKLVIKVNDSGKPE 779          

HSP 2 Score: 117.472 bits (293), Expect = 6.635e-26
Identity = 151/574 (26.31%), Postives = 248/574 (43.21%), Query Frame = 1
Query:  718 IIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAI-------LRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFN------CSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTI-----FEENQP-NFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPY--QVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTI 2376
            I D+NDN P+F S+    SI  N  +NS   +   A D D+  N    + L      Q+ F L+            L V++SL  E     Y   I   D G P   S   + + + + N   P  +    +  + I E+  +G  +      D D G + K +       + L  +++ I          N  +I++   +  DRE     +L +   D       + A ++I I D+NDN P  +  +    +       E  P N  IA +T  D D  LN ++      D     P +L  V  N      Q L     P  +     Y  +++A+DSG+P  + S  + I++ D NDN PVF      +SF+E+        K++   A D D G N +++Y +       F L+  +G L +   +DRE Q  +YTF++ A+D+    L   T TV++S++  D NDN P F   NE N+ +  +  +P+   V L+   D DSG N+ +   L   + N  F I+  +G +  +       +G  T  +KA+D GSP+ ++  ++TI
Sbjct:  147 IEDINDNSPLFPSTVINISIPENTAVNSRYSVP-SAIDPDVGVNGIQHYEL---LKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQ-KDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRP--VFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAI--------DNNTGLITV--KEPLDREESPYHKLTVLASDGSSTP--SRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHDV----PFRLKPVFDN------QFLLETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKIS---ATDADSGRNAELSYMLGPNAPTIFNLDRRTGILTAVRKLDREKQ-DRYTFTVIAKDNGNPSLQTNT-TVTLSVL--DQNDNSPSFTH-NEYNFYVPEN--LPMYGTVGLITVTDADSGENAVVTLSLVNARDN--FIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTI 679          

HSP 3 Score: 89.7373 bits (221), Expect = 2.164e-17
Identity = 89/341 (26.10%), Postives = 148/341 (43.40%), Query Frame = 1
Query: 1390 DVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESN--CQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTY----SIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPI----FIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEI 2382
            D+NDNSP F     + +I E    N   +  +A D D G+N    Y +    +++  + +   E +   Q+I  QSLDRE+     +     ++   D G P RS +  + + + D+NDN PVF++    ++  ED         V    A D D G N  + +     I       F ++ N+G +   + +DRE  P  +  ++ A D  +       +  +V+I I D NDN P     +I  N  N  +QLS   P+ + + L+   DKD+ +N ++    + +    L  + +    L T+  L      E  + I A D G P L     L I+I
Sbjct:  149 DINDNSPLFPSTVINISIPENTAVNSRYSVPSAIDPDVGVNGIQHYELLKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQ-----KDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPEDAAV---GTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKEPLDREESP-YHKLTVLASDGSST-----PSRATVTINITDINDNIPSIDTRYII-NPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHDVPFRLKPVFDNQFLLETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKI 474          
BLAST of Protocadherin alpha-11 vs. Ensembl Xenopus
Match: ENSXETT00000047798.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 228.794 bits (582), Expect = 8.749e-61
Identity = 220/770 (28.57%), Postives = 371/770 (48.18%), Query Frame = 1
Query:  124 QIFENLPVGSVICKLSNVIIPRPSDTTKFKLIKNR----FFQIE--NGDNLKVSGLIDRDDNLELCAYRNVNFSCIWR-GILFCGTNNLKILEIQIL--DENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIK-PFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDI--NANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSI----LLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNK--LIKVESNCQII-AIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLED---FGSKKNSRKVAVFIAHDPDFGVNGDVTYSIV--RETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARD--SPTNLLYRKTATVSVSIVIEDCNDNEPIFIFP-NESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGEL-LTSTVLSVIHKGEETLFIKAIDCGSPR 2349
            ++ EN+ +G+++  L+  + P  S   +FKL+         ++E   G+    S  IDR+   +LC+       C +   +        ++++I+ L  D NDN P +    I I + ENT ++S Y  +P A D D   N I +Y++      F +   ++ +G K P L +++ +DRE    + + +   DGG P+++ +  L + + DVNDN+P+F+      +I  +  + +++  ++HATD D+  NA + + F   +  + +  F ++    ++ VK+ L  E  +  ++ ++ A D       S+ TVT+++ + N   PSI    ++   N  +++ E   +   I    V D D+ ++GK  C      ++D+   +            L T    D E      + I   D GKP  N SA + I I D NDN+P F       +  E N P   + +++A D D G NA+L Y       +  PN   +  ++    I+ A++ LDREK     R+   + VIA D+G P    +TTV++ ++D NDN P F    YN    E+   +G+      V +    D D G N  VT S+V  R+    F ++P +G +      DRE Q S YTF + A D  SP     +K++TV V+I +ED NDN+P+F+ P N  +Y +  +   P GS+V  V AID D+GIN+ +++ +       LF+I E SG + L   +L+  H     L IK  D G P 
Sbjct:   33 ELPENVLIGNLLKDLNLTLDPDLSTPLQFKLVYKTGDVPLIRVEENTGEIFTTSNRIDRE---KLCSGIFTENKCFYEVEVAVLPDEVFRLVKIRFLIEDINDNSPLFPSTVINISIPENTAVNSRY-SVPSAIDPDVGVNGIQHYELLKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSV-TQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKEPLDREE-SPYHKLTVLASDGSS--TPSRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFT----DHDVPFRLKPVFDNQFL---LETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSY-------MLGPNAPTIFNLDRRTGILTAVRKLDREKQD---RYT--FTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGT------VGLITVTDADSGENAVVTLSLVNARDN---FIIDPLTGVIRPNITFDREQQGS-YTFQVKALDKGSP-----QKSSTVKVTIFVEDVNDNKPVFVIPSNNYSYDLVQTSTSP-GSVVARVYAIDNDTGINADLRYSIIGGNSRGLFAIGERSGNITLKEKLLAGDHGVLYKLVIKVNDSGKPE 759          

HSP 2 Score: 117.472 bits (293), Expect = 7.154e-26
Identity = 151/574 (26.31%), Postives = 249/574 (43.38%), Query Frame = 1
Query:  718 IIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAI-------LRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFN------CSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTI-----FEENQP-NFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPY--QVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTI 2376
            I D+NDN P+F S+    SI  N  +NS   +   A D D+  N    + L      Q+ F L+            L V++SL  E     Y   I   D G P   S   + + + + N   P  +    +  + I E+  +G  +      D D G + K +       + L  +++ I          N  +I++   +  DRE     +L +   D    +  + A ++I I D+NDN P  +  +    +       E  P N  IA +T  D D  LN ++      D     P +L  V  N      Q L     P  +     Y  +++A+DSG+P  + S  + I++ D NDN PVF      +SF+E+        K++   A D D G N +++Y +       F L+  +G L +   +DRE Q  +YTF++ A+D+    L   T TV++S++  D NDN P F   NE N+ +  +  +P+   V L+   D DSG N+ +   L   + N  F I+  +G +  +       +G  T  +KA+D GSP+ ++  ++TI
Sbjct:  127 IEDINDNSPLFPSTVINISIPENTAVNSRYSVP-SAIDPDVGVNGIQHYEL---LKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQ-KDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRP--VFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAI--------DNNTGLITV--KEPLDREESPYHKLTVLASDGS--STPSRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHDV----PFRLKPVFDN------QFLLETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKIS---ATDADSGRNAELSYMLGPNAPTIFNLDRRTGILTAVRKLDREKQ-DRYTFTVIAKDNGNPSLQTNT-TVTLSVL--DQNDNSPSFTH-NEYNFYVPEN--LPMYGTVGLITVTDADSGENAVVTLSLVNARDN--FIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTI 659          

HSP 3 Score: 89.7373 bits (221), Expect = 2.195e-17
Identity = 89/341 (26.10%), Postives = 148/341 (43.40%), Query Frame = 1
Query: 1390 DVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESN--CQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTY----SIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPI----FIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEI 2382
            D+NDNSP F     + +I E    N   +  +A D D G+N    Y +    +++  + +   E +   Q+I  QSLDRE+     +     ++   D G P RS +  + + + D+NDN PVF++    ++  ED         V    A D D G N  + +     I       F ++ N+G +   + +DRE  P  +  ++ A D  +       +  +V+I I D NDN P     +I  N  N  +QLS   P+ + + L+   DKD+ +N ++    + +    L  + +    L T+  L      E  + I A D G P L     L I+I
Sbjct:  129 DINDNSPLFPSTVINISIPENTAVNSRYSVPSAIDPDVGVNGIQHYELLKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQ-----KDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPEDAAV---GTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKEPLDREESP-YHKLTVLASDGSST-----PSRATVTINITDINDNIPSIDTRYII-NPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHDVPFRLKPVFDNQFLLETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKI 454          
BLAST of Protocadherin alpha-11 vs. Ensembl Xenopus
Match: ENSXETT00000047804.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 228.409 bits (581), Expect = 1.149e-60
Identity = 220/770 (28.57%), Postives = 371/770 (48.18%), Query Frame = 1
Query:  124 QIFENLPVGSVICKLSNVIIPRPSDTTKFKLIKNR----FFQIE--NGDNLKVSGLIDRDDNLELCAYRNVNFSCIWR-GILFCGTNNLKILEIQIL--DENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIK-PFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDI--NANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSI----LLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNK--LIKVESNCQII-AIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLED---FGSKKNSRKVAVFIAHDPDFGVNGDVTYSIV--RETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARD--SPTNLLYRKTATVSVSIVIEDCNDNEPIFIFP-NESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGEL-LTSTVLSVIHKGEETLFIKAIDCGSPR 2349
            ++ EN+ +G+++  L+  + P  S   +FKL+         ++E   G+    S  IDR+   +LC+       C +   +        ++++I+ L  D NDN P +    I I + ENT ++S Y  +P A D D   N I +Y++      F +   ++ +G K P L +++ +DRE    + + +   DGG P+++ +  L + + DVNDN+P+F+      +I  +  + +++  ++HATD D+  NA + + F   +  + +  F ++    ++ VK+ L  E  +  ++ ++ A D       S+ TVT+++ + N   PSI    ++   N  +++ E   +   I    V D D+ ++GK  C      ++D+   +            L T    D E      + I   D GKP  N SA + I I D NDN+P F       +  E N P   + +++A D D G NA+L Y       +  PN   +  ++    I+ A++ LDREK     R+   + VIA D+G P    +TTV++ ++D NDN P F    YN    E+   +G+      V +    D D G N  VT S+V  R+    F ++P +G +      DRE Q S YTF + A D  SP     +K++TV V+I +ED NDN+P+F+ P N  +Y +  +   P GS+V  V AID D+GIN+ +++ +       LF+I E SG + L   +L+  H     L IK  D G P 
Sbjct:   53 ELPENVLIGNLLKDLNLTLDPDLSTPLQFKLVYKTGDVPLIRVEENTGEIFTTSNRIDRE---KLCSGIFTENKCFYEVEVAVLPDEVFRLVKIRFLIEDINDNSPLFPSTVINISIPENTAVNSRY-SVPSAIDPDVGVNGIQHYELLKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSV-TQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKEPLDREE-SPYHKLTVLASDGSS--TPSRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFT----DHDVPFRLKPVFDNQFL---LETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSY-------MLGPNAPTIFNLDRRTGILTAVRKLDREKQD---RYT--FTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGT------VGLITVTDADSGENAVVTLSLVNARDN---FIIDPLTGVIRPNITFDREQQGS-YTFQVKALDKGSP-----QKSSTVKVTIFVEDVNDNKPVFVIPSNNYSYDLVQTSTSP-GSVVARVYAIDNDTGINADLRYSIIGGNSRGLFAIGERSGNITLKEKLLAGDHGVLYKLVIKVNDSGKPE 779          

HSP 2 Score: 116.701 bits (291), Expect = 9.792e-26
Identity = 151/574 (26.31%), Postives = 248/574 (43.21%), Query Frame = 1
Query:  718 IIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAI-------LRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFN------CSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTI-----FEENQP-NFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPY--QVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTI 2376
            I D+NDN P+F S+    SI  N  +NS   +   A D D+  N    + L      Q+ F L+            L V++SL  E     Y   I   D G P   S   + + + + N   P  +    +  + I E+  +G  +      D D G + K +       + L  +++ I          N  +I++   +  DRE     +L +   D       + A ++I I D+NDN P  +  +    +       E  P N  IA +T  D D  LN ++      D     P +L  V  N      Q L     P  +     Y  +++A+DSG+P  + S  + I++ D NDN PVF      +SF+E+        K++   A D D G N +++Y +       F L+  +G L +   +DRE Q  +YTF++ A+D+    L   T TV++S++  D NDN P F   NE N+ +  +  +P+   V L+   D DSG N+ +   L   + N  F I+  +G +  +       +G  T  +KA+D GSP+ ++  ++TI
Sbjct:  147 IEDINDNSPLFPSTVINISIPENTAVNSRYSVP-SAIDPDVGVNGIQHYEL---LKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQ-KDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRP--VFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAI--------DNNTGLITV--KEPLDREESPYHKLTVLASDGSSTP--SRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHDV----PFRLKPVFDN------QFLLETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKIS---ATDADSGRNAELSYMLGPNAPTIFNLDRRTGILTAVRKLDREKQ-DRYTFTVIAKDNGNPSLQTNT-TVTLSVL--DQNDNSPSFTH-NEYNFYVPEN--LPMYGTVGLITVTDADSGENAVVTLSLVNARDN--FIIDPLTGVIRPNITFDREQQGSYTFQVKALDKGSPQKSSTVKVTI 679          

HSP 3 Score: 89.3521 bits (220), Expect = 2.577e-17
Identity = 89/341 (26.10%), Postives = 148/341 (43.40%), Query Frame = 1
Query: 1390 DVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESN--CQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTY----SIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPI----FIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEI 2382
            D+NDNSP F     + +I E    N   +  +A D D G+N    Y +    +++  + +   E +   Q+I  QSLDRE+     +     ++   D G P RS +  + + + D+NDN PVF++    ++  ED         V    A D D G N  + +     I       F ++ N+G +   + +DRE  P  +  ++ A D  +       +  +V+I I D NDN P     +I  N  N  +QLS   P+ + + L+   DKD+ +N ++    + +    L  + +    L T+  L      E  + I A D G P L     L I+I
Sbjct:  149 DINDNSPLFPSTVINISIPENTAVNSRYSVPSAIDPDVGVNGIQHYELLKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQ-----KDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPEDAAV---GTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKEPLDREESP-YHKLTVLASDGSST-----PSRATVTINITDINDNIPSIDTRYII-NPVNGTVQLSEKAPLNTKIALITVTDKDADLNGKVTCFTDHDVPFRLKPVFDNQFLLETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKI 474          
BLAST of Protocadherin alpha-11 vs. Ensembl Xenopus
Match: ENSXETT00000027070.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:19099783:19110965:-1 gene:ENSXETG00000013163.1 transcript:ENSXETT00000027070.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 224.172 bits (570), Expect = 9.980e-60
Identity = 234/825 (28.36%), Postives = 388/825 (47.03%), Query Frame = 1
Query:  127 IFENLPVGSVICKLSN--VIIPRPSDTTKFKLI---KNRFF--QIENGDNLKVSGLIDRDDNLELCAYRN---VNFSCIWRGILFCGTNNLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIK-PFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLD--INANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAH--DPDFGVNGDVTYSIVRETL--LPF----KLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVP----VGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGE-FRNPDSTPFNETEESFLSDQATFIIVGII--LGTFFICCGLVTGI 2517
            I+E   +G VI  ++N   +      + KF ++   K ++    +ENGD L V+  IDR+    LC  +    +N   +    L   T N     ++I D NDN P +S++   I + E   + + +  L  A+D D   N+I  YK+   + YF +  + +  G K P L L + +DRE  +   + L A DGGTPSKTG+  + I + D+NDN P+F    Y  ++  N+ I   L + +HATD D   NA +TY F+ ++P   Q+ F +NP N  +++   L +E  A+ Y  +++A D G  V   K  + +   N N   P IL+   + +I   E+  +G VI    + D DSG +G+    I E   + +I       S +     L+T+   DRE  +   + I  +D G P    S  I +I+ DVNDN+P F+K  Y   I E N    +  ++ A D D   N ++ Y I     L D  + I + S   I  +  +   +    +  +  + + A D G PQ + + T+ + L D+NDN PVF++  Y ++++++     N    + F  H  D D   NG V Y I+ + +  +P      +N  SG LY+    D E+   ++   + A+DS +     ++A  +V I I D NDN P  ++P++ +    +   +P     G LVT V A+D DSG N+ + + L +        I + +GE+  +  L       + + +   D G P L++   L + + E F+       N+  ++  S  ATF +V  I  +   FI   LV  I
Sbjct:   38 IYEEQRLGYVIGNIANDLGVSAEELSSRKFHIVSRSKKQYLNVHLENGD-LYVADRIDRE---ALCGMQQNCFLNIEAVMESPLHFYTIN-----VEIQDVNDNSPSFSKSIFEISISELAVVGT-HFALGSAKDPDLGNNSIQSYKLS-ANDYFGMLEKVNTDGRKYPELVLEKTLDREKKNSSVLILSAFDGGTPSKTGTSLIRIVVTDINDNYPLFNKDTYRVTVSENVPI-GFLVIDLHATDADEGSNAEITYLFN-DIPENAQEVFAINPENGSVQITGKLDYEV-ATNYEMTVEAKDGGGLVSYCKLLIQVSDVNDN--APDILITSFSDIIP--EDSRVGTVIALVNLDDLDSGENGEVVGQISESLPFHLI-------SSSGNYYKLVTSMDLDREKTSEYNITIKAEDKGSPQLTNSKTIRLILTDVNDNAPVFDKMDYVAYIQENNPSGNSFYRVHATDPDINENGKVVYMI-----LTDIIEDIPISSYVSINTVSGVLYAQRSFDYEKLREFYIQAEDKGSPQLTNNKTIRLILTDVNDNAPVFEKMDY-VAYIQE----NNPSGSSFFRVHATDSDINENGKVVYMILTDIIEDMPLSSYISINTVSGVLYAQRSFDYESL-REFYIQVMAKDSGSP---SRSANATVKICITDQNDNAPKILYPSQDSEAASVFEFIPHFSTKGYLVTKVVAVDADSGHNAWLSYHLLQVPDPSFLIIGQNTGEIRITRDLQETDALRQRIVVMVKDNGYPMLSSTVTLNLVVAENFQQVLPEITNQHIDTESSSNATFYLVISIALISILFIFTVLVAVI 823          
BLAST of Protocadherin alpha-11 vs. Ensembl Xenopus
Match: vapa (VAMP associated protein A [Source:Xenbase;Acc:XB-GENE-990155])

HSP 1 Score: 217.238 bits (552), Expect = 4.196e-57
Identity = 193/671 (28.76%), Postives = 320/671 (47.69%), Query Frame = 1
Query:  367 LKILEIQIL--DENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIK-PFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDI--NANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSI----LLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPV-GSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPR 2349
             ++++I+I+  D NDN P +    I I + ENT ++S +  +P A D D   N + +Y++      F +   ++ +G K P L +++ +DRE    + + +   DGGTP K+ +  L + + DVNDNKP+F+ S     I  N  I +++ +++HATD DI  NA + Y F   V    +  F LN    ++ V++ L  E  A  ++ ++ A D       ++ TVT+++ + N  PP+I    ++   N  + + E   I   I    V D D+ ++ K  C I     + +     K   +N  +  L T+ + D E        I   D GKP+ N +A + + + D NDN P F +     ++ E N+    +  ++A D D G N+ + Y++  + S +D ++   V     + A +  DRE+     RF+  + V A D+G P       V + ++D NDN P F    +     E+         V V  A D D G N  VT SI+ +    F L+P SG + S    DRE Q S YTF + A D        +++T  V+I I D NDN P+ I P  SN   +L  L  + GS+V  V A+D D+G+N+++++ +       LF I+  +G +      S    G   L +   D G P+
Sbjct:  123 FRLIKIKIIVKDTNDNAPMFPSTVINISIPENTLINSRF-PIPSAVDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNKPVFKESQVEVHIPENAPIGTSV-VQLHATDADIGSNAEIKYIFGAQVTSATKRLFALNNTTGLITVQRPLDREETAV-HKLTVLATDGSS--TPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPINTKIALITVSDKDTDVNSKVICFIEREVPFHL-----KAVYDNQYL--LETSSLLDYEGIKEFSFKIVAADTGKPSLNQTALVRVELEDENDNPPIFSQPVIELSVSENNRRGLYLTTVSASDEDSGKNSDIVYQLGPNASFFDLDRKTGV-----LTASRVFDREEQE---RFI--FTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENL---PKYSTVGVITATDSDAGENKAVTLSILNDN-ENFVLDPYSGLIKSNVSFDREQQ-SSYTFDVKAVDGGQP---PRSSTAKVTINIMDANDNSPVVISP-PSNTSFKLVPLSAIPGSVVAEVFAVDTDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPSAADVGLHRLVVNISDLGYPK 762          

HSP 2 Score: 116.316 bits (290), Expect = 1.335e-25
Identity = 151/578 (26.12%), Postives = 249/578 (43.08%), Query Frame = 1
Query:  712 IKII--DVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAI-------LRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGK----FNCSILEPKNYDIILTMNKTKSENIAIISLIT-NKIFDREVKTRIQLIIFCKDFGK-PAFNTSAEXXXXXXDVNDNSPQFEKEFY----HYTIF--EENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEI 2382
            IKII  D NDN P+F S+    SI  N  INS   +   A D D   N    + L      Q  F L+            L V+++L  E     Y   I   D G P + S   + + + + N   P  +   +   + I EN  IG  ++     D D G + +    F   +        +  +N T         LIT  +  DRE     +L +   D    PA    A ++I + DVNDN P  +  +     + T++  E++  N  IA +T  D D  +N+++   I+ +     P  L  V  N  ++   SL   +    F F    +++A D+G+P  + +  V +EL D NDN P+F Q    +S  E+    +    +    A D D G N D+ Y +       F L+  +G L +  + DRE Q  ++ F++TARD+ T  L  + A +   + + D NDN P F     ++++  +S  +P  S V ++ A D D+G N  +   +  +  N  F ++  SG + ++       +   T  +KA+D G P  ++  ++TI I
Sbjct:  128 IKIIVKDTNDNAPMFPSTVINISIPENTLINSRFPIP-SAVDPDTGFNGVQHYEL---LNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQ-KDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNKP--VFKESQVEVHIPENAPIGTSVVQLHATDADIGSNAEIKYIFGAQVTSATKR--LFALNNT-------TGLITVQRPLDREETAVHKLTVLATDGSSTPA---RATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPINTKIALITVSDKDTDVNSKVICFIEREV----PFHLKAVYDNQYLLETSSLLDYEGIKEFSF----KIVAADTGKPSLNQTALVRVELEDENDNPPIFSQPVIELSVSEN---NRRGLYLTTVSASDEDSGKNSDIVYQLGPNASF-FDLDRKTGVLTASRVFDREEQ-ERFIFTVTARDNGTPPLQSQAAVI---VTVLDENDNSPKF---THNHFQFFVSENLPKYSTVGVITATDSDAGENKAVTLSILNDNEN--FVLDPYSGLIKSNVSFDREQQSSYTFDVKAVDGGQPPRSSTAKVTINI 665          
BLAST of Protocadherin alpha-11 vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 237.269 bits (604), Expect = 1.039e-63
Identity = 222/762 (29.13%), Postives = 361/762 (47.38%), Query Frame = 1
Query:  124 QIFENLPVGSVICKLSNVIIPRPSDTT--KFKLIKNR----FFQIENGDN--LKVSGLIDRDDNLELCAYRNVNFSCIWR-GILFCGTNNLKILEIQIL--DENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIK-PFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDI--NANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSI----LLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPV---GSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSP 2346
            ++ EN+ +G ++  L+  +IP  S TT  +FKL+         +IE G          IDR+   +LCA   ++  C +   +        ++++I+ L  D NDN P +    I I + EN+ ++S Y  LP A D D   N +  Y++  +   F +   ++ +G K P L +++ +DRE    + + +   DGG P ++ +  L + + D NDN PIF       SI  N  I S++  ++HATD DI  NA + + FS  V  I +  F LN    ++ VK+ L  E   S ++  + A D G     ++ TV +++ + N   PSI    ++   N  + + EN  +   I    V D DS  +G+  C      ++++   +    S       L T    D E      + +   D GKP  N S+ + I + D NDN+P F + F   ++ E N P   + +++A D D G NA++ Y + +D     P +    +    + A++ LDREK    +     + V+A D+G P    + TV + ++D NDN P+F    YN    E   S      V +    DPD+G N  VT SI+ +    F ++P SG +      DRE Q S YTF + A D        +++T  V+I + D NDN+PIFI P  SNY  +  +++P    G++V  V AID D G+N+++ + +       LF I +TSG +       V   G   + +KA D G P
Sbjct:   33 EMPENVLIGDLLKDLNLSLIPDKSLTTPMQFKLVYKTGDVPLIRIEEGTGEIFTTGARIDRE---KLCAGIVLDARCFYEVEVAVLPDEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRY-SLPAAIDPDIGINGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSV-TQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEPLDREESPS-HKLLVLATDGGS--TPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCF----TDHEVPFRLRPVFSNQFL---LETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDA----PPEFNLDQRTGILTAVKKLDREKQEKYY-----FTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPE---SLPKHGTVGLITVTDPDYGENSAVTLSIL-DVNDQFTIDPQSGVIRPNISFDRERQES-YTFYVKAEDGGR---VSRSSTARVTINVVDVNDNKPIFIDP-PSNYSFE--WVLPSTNPGTVVFKVVAIDDDIGMNAEVLYSIVGGNTKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLGQP 759          
BLAST of Protocadherin alpha-11 vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 236.498 bits (602), Expect = 3.130e-63
Identity = 222/762 (29.13%), Postives = 361/762 (47.38%), Query Frame = 1
Query:  124 QIFENLPVGSVICKLSNVIIPRPSDTT--KFKLIKNR----FFQIENGDN--LKVSGLIDRDDNLELCAYRNVNFSCIWR-GILFCGTNNLKILEIQIL--DENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIK-PFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDI--NANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSI----LLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPV---GSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSP 2346
            ++ EN+ +G ++  L+  +IP  S TT  +FKL+         +IE G          IDR+   +LCA   ++  C +   +        ++++I+ L  D NDN P +    I I + EN+ ++S Y  LP A D D   N +  Y++  +   F +   ++ +G K P L +++ +DRE    + + +   DGG P ++ +  L + + D NDN PIF       SI  N  I S++  ++HATD DI  NA + + FS  V  I +  F LN    ++ VK+ L  E   S ++  + A D G     ++ TV +++ + N   PSI    ++   N  + + EN  +   I    V D DS  +G+  C      ++++   +    S       L T    D E      + +   D GKP  N S+ + I + D NDN+P F + F   ++ E N P   + +++A D D G NA++ Y + +D     P +    +    + A++ LDREK    +     + V+A D+G P    + TV + ++D NDN P+F    YN    E   S      V +    DPD+G N  VT SI+ +    F ++P SG +      DRE Q S YTF + A D        +++T  V+I + D NDN+PIFI P  SNY  +  +++P    G++V  V AID D G+N+++ + +       LF I +TSG +       V   G   + +KA D G P
Sbjct:   33 EMPENVLIGDLLKDLNLSLIPDKSLTTPMQFKLVYKTGDVPLIRIEEGTGEIFTTGARIDRE---KLCAGIVLDARCFYEVEVAVLPDEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRY-SLPAAIDPDIGINGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSV-TQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEPLDREESPS-HKLLVLATDGGS--TPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCF----TDHEVPFRLRPVFSNQFL---LETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDA----PPEFNLDQRTGILTAVKKLDREKQEKYY-----FTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPE---SLPKHGTVGLITVTDPDYGENSAVTLSIL-DVNDQFTIDPQSGVIRPNISFDRERQES-YTFYVKAEDGGR---VSRSSTARVTINVVDVNDNKPIFIDP-PSNYSFE--WVLPSTNPGTVVFKVVAIDDDIGMNAEVLYSIVGGNTKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLGQP 759          
BLAST of Protocadherin alpha-11 vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 236.113 bits (601), Expect = 9.174e-63
Identity = 222/762 (29.13%), Postives = 361/762 (47.38%), Query Frame = 1
Query:  124 QIFENLPVGSVICKLSNVIIPRPSDTT--KFKLIKNR----FFQIENGDN--LKVSGLIDRDDNLELCAYRNVNFSCIWR-GILFCGTNNLKILEIQIL--DENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIK-PFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDI--NANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSI----LLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPV---GSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSP 2346
            ++ EN+ +G ++  L+  +IP  S TT  +FKL+         +IE G          IDR+   +LCA   ++  C +   +        ++++I+ L  D NDN P +    I I + EN+ ++S Y  LP A D D   N +  Y++  +   F +   ++ +G K P L +++ +DRE    + + +   DGG P ++ +  L + + D NDN PIF       SI  N  I S++  ++HATD DI  NA + + FS  V  I +  F LN    ++ VK+ L  E   S ++  + A D G     ++ TV +++ + N   PSI    ++   N  + + EN  +   I    V D DS  +G+  C      ++++   +    S       L T    D E      + +   D GKP  N S+ + I + D NDN+P F + F   ++ E N P   + +++A D D G NA++ Y + +D     P +    +    + A++ LDREK    +     + V+A D+G P    + TV + ++D NDN P+F    YN    E   S      V +    DPD+G N  VT SI+ +    F ++P SG +      DRE Q S YTF + A D        +++T  V+I + D NDN+PIFI P  SNY  +  +++P    G++V  V AID D G+N+++ + +       LF I +TSG +       V   G   + +KA D G P
Sbjct:   33 EMPENVLIGDLLKDLNLSLIPDKSLTTPMQFKLVYKTGDVPLIRIEEGTGEIFTTGARIDRE---KLCAGIVLDARCFYEVEVAVLPDEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRY-SLPAAIDPDIGINGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSV-TQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEPLDREESPS-HKLLVLATDGGS--TPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFT----DHEVPFRLRPVFSNQFL---LETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDA----PPEFNLDQRTGILTAVKKLDREKQEKYY-----FTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPE---SLPKHGTVGLITVTDPDYGENSAVTLSIL-DVNDQFTIDPQSGVIRPNISFDRERQES-YTFYVKAEDGGR---VSRSSTARVTINVVDVNDNKPIFIDP-PSNYSFE--WVLPSTNPGTVVFKVVAIDDDIGMNAEVLYSIVGGNTKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLGQP 759          
BLAST of Protocadherin alpha-11 vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 235.728 bits (600), Expect = 1.097e-62
Identity = 222/762 (29.13%), Postives = 361/762 (47.38%), Query Frame = 1
Query:  124 QIFENLPVGSVICKLSNVIIPRPSDTT--KFKLIKNR----FFQIENGDN--LKVSGLIDRDDNLELCAYRNVNFSCIWR-GILFCGTNNLKILEIQIL--DENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIK-PFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDI--NANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSI----LLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPV---GSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSP 2346
            ++ EN+ +G ++  L+  +IP  S TT  +FKL+         +IE G          IDR+   +LCA   ++  C +   +        ++++I+ L  D NDN P +    I I + EN+ ++S Y  LP A D D   N +  Y++  +   F +   ++ +G K P L +++ +DRE    + + +   DGG P ++ +  L + + D NDN PIF       SI  N  I S++  ++HATD DI  NA + + FS  V  I +  F LN    ++ VK+ L  E   S ++  + A D G     ++ TV +++ + N   PSI    ++   N  + + EN  +   I    V D DS  +G+  C      ++++   +    S       L T    D E      + +   D GKP  N S+ + I + D NDN+P F + F   ++ E N P   + +++A D D G NA++ Y + +D     P +    +    + A++ LDREK    +     + V+A D+G P    + TV + ++D NDN P+F    YN    E   S      V +    DPD+G N  VT SI+ +    F ++P SG +      DRE Q S YTF + A D        +++T  V+I + D NDN+PIFI P  SNY  +  +++P    G++V  V AID D G+N+++ + +       LF I +TSG +       V   G   + +KA D G P
Sbjct:   33 EMPENVLIGDLLKDLNLSLIPDKSLTTPMQFKLVYKTGDVPLIRIEEGTGEIFTTGARIDRE---KLCAGIVLDARCFYEVEVAVLPDEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRY-SLPAAIDPDIGINGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSV-TQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEPLDREESPS-HKLLVLATDGGS--TPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFT----DHEVPFRLRPVFSNQFL---LETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDA----PPEFNLDQRTGILTAVKKLDREKQEKYY-----FTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPE---SLPKHGTVGLITVTDPDYGENSAVTLSIL-DVNDQFTIDPQSGVIRPNISFDRERQES-YTFYVKAED---GGRVSRSSTARVTINVVDVNDNKPIFIDP-PSNYSFE--WVLPSTNPGTVVFKVVAIDDDIGMNAEVLYSIVGGNTKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLGQP 759          
BLAST of Protocadherin alpha-11 vs. Ensembl Mouse
Match: Pcdh11x (protocadherin 11 X-linked [Source:MGI Symbol;Acc:MGI:2442849])

HSP 1 Score: 235.343 bits (599), Expect = 1.539e-62
Identity = 222/762 (29.13%), Postives = 361/762 (47.38%), Query Frame = 1
Query:  124 QIFENLPVGSVICKLSNVIIPRPSDTT--KFKLIKNR----FFQIENGDN--LKVSGLIDRDDNLELCAYRNVNFSCIWR-GILFCGTNNLKILEIQIL--DENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIK-PFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDI--NANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSI----LLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPV---GSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSP 2346
            ++ EN+ +G ++  L+  +IP  S TT  +FKL+         +IE G          IDR+   +LCA   ++  C +   +        ++++I+ L  D NDN P +    I I + EN+ ++S Y  LP A D D   N +  Y++  +   F +   ++ +G K P L +++ +DRE    + + +   DGG P ++ +  L + + D NDN PIF       SI  N  I S++  ++HATD DI  NA + + FS  V  I +  F LN    ++ VK+ L  E   S ++  + A D G     ++ TV +++ + N   PSI    ++   N  + + EN  +   I    V D DS  +G+  C      ++++   +    S       L T    D E      + +   D GKP  N S+ + I + D NDN+P F + F   ++ E N P   + +++A D D G NA++ Y + +D     P +    +    + A++ LDREK    +     + V+A D+G P    + TV + ++D NDN P+F    YN    E   S      V +    DPD+G N  VT SI+ +    F ++P SG +      DRE Q S YTF + A D        +++T  V+I + D NDN+PIFI P  SNY  +  +++P    G++V  V AID D G+N+++ + +       LF I +TSG +       V   G   + +KA D G P
Sbjct:   33 EMPENVLIGDLLKDLNLSLIPDKSLTTPMQFKLVYKTGDVPLIRIEEGTGEIFTTGARIDRE---KLCAGIVLDARCFYEVEVAVLPDEIFRLVKIRFLIEDINDNAPLFPTTVINISIPENSAINSRY-SLPAAIDPDIGINGVQNYQLIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVADTNDNHPIFIEKEIEVSIPENAPIGSSV-TQLHATDADIGENARIHFYFSNLVSNIAKRLFHLNTTTGLITVKEPLDREESPS-HKLLVLATDGGS--TPARATVLVNVTDINDNVPSIDIRYIVNPTNGTVLLSENAPLNTKIALITVMDKDSEHNGRVTCFT----DHEVPFRLRPVFSNQFL---LETAAFLDFESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQSFISLSVPENNSPGAQLTKISATDADSGQNAEISYMLGFDA----PPEFNLDQRTGILTAVKKLDREKQEKYY-----FTVLAQDNGIPPLMSNATVFVTVLDQNDNSPIFTHNEYNFYVPE---SLPKHGTVGLITVTDPDYGENSAVTLSIL-DVNDQFTIDPQSGVIRPNISFDRERQES-YTFYVKAEDG---GRVSRSSTARVTINVVDVNDNKPIFIDP-PSNYSFE--WVLPSTNPGTVVFKVVAIDDDIGMNAEVLYSIVGGNTKGLFMIEQTSGNITLKEKCMVSDLGLHRVIVKANDLGQP 759          
BLAST of Protocadherin alpha-11 vs. UniProt/SwissProt
Match: sp|Q6KEQ9|PC11X_PIG (Protocadherin-11 X-linked OS=Sus scrofa OX=9823 GN=PCDH11X PE=2 SV=1)

HSP 1 Score: 231.491 bits (589), Expect = 8.843e-61
Identity = 214/763 (28.05%), Postives = 360/763 (47.18%), Query Frame = 1
Query:  124 QIFENLPVGSVICKLSNVIIPRPSDTT--KFKLIKNR----FFQIENGDN--LKVSGLIDRDDNLELCAYRNVNFSCIWR-GILFCGTNNLKILEIQIL--DENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIK-PFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDI--NANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSI----LLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVP----VGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSP 2346
            ++ EN+ +G ++  L+  +IP  S TT  +FKL+         +IE G          IDR+   +LCA   V+  C +   +        ++++I+ L  D NDN P +    I I + EN+ ++S Y  LP   D D   N +  Y +      F +   ++ +G K P L +++ +DRE    + + +   DGG P ++ +  L + + D NDN+P+F+ +    SI  N  + S++  ++HATD DI  NA + + FS  +  + +  F LN    ++ +K+ L  E  +  ++  + A D G    ++   V +   N N+  PSI    ++   N  + + EN  +   I    V D D+  +G  +C      ++++   +    S       L T    D E      + +   D GKP  N S+ + I + D NDN+P F + F   ++ E N P   + +++A D D G NA++ Y + +D     P++         + A++ LDREK    + F     V+A D+G P    + TV + ++D NDN PVF    YN    E+         V +    DPD+G N  V  SI+ +    F ++P +G +      DRE Q S YTF + A D        +++T  V+I + D NDN+P+F+ P+ SNY  +   LVP     G++V  V AID D+G+N+++++ +       LF I++TSG +           G   L +KA D G P
Sbjct:   33 EMPENVLIGDLLKDLNLSLIPDRSLTTPMQFKLVYKTGDVPLIRIEEGTGEIFTTGARIDRE---KLCAGIVVDAHCFYEVEVAVLPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSRY-ALPATIDPDTGINGVQNYHLIKGQSIFGLDVIETPEGEKMPQLIVQKELDREEKDTYVMKIKVEDGGFPQRSSTAILQVSVADTNDNRPVFKENEIEVSIPENAPVGSSV-TQLHATDADIGENAKIHFYFSNLISNMAKKLFHLNSTTGLITIKEPLDREE-SPNHKLLVLASDGGLTPARAMVLVNVTDINDNI--PSIDIRYIINPINGTVVLSENAPLNTKIALITVTDKDADHNGWVSCFT----DHEVPFRLRPVFSNQFL---LETAAYLDYESTREYAIKLLAADAGKPPLNQSSMLLIKVKDENDNAPVFTQPFLSLSVPENNSPGTQLTKISAMDADSGRNAEINYLLGFDA----PSEFNLDHRTGILTAVKKLDREKQ-EKYSFT----VLAKDNGMPPLMTNATVLVTVLDQNDNSPVFTHNEYNFYVPENL---PRHGTVGLITVTDPDYGENSAVILSIL-DANDDFTIDPQTGVIQPNISFDREKQES-YTFYVKAEDGGR---ISRSSTAKVTINVVDVNDNKPVFVVPS-SNYSFE---LVPPSTNPGTVVFTVVAIDNDTGMNAELRYSMVGGNTKGLFIIDQTSGNITLKEKCVFADLGLHRLVVKAKDLGQP 759          
BLAST of Protocadherin alpha-11 vs. UniProt/SwissProt
Match: sp|Q71M42|PC11X_PANTR (Protocadherin-11 X-linked OS=Pan troglodytes OX=9598 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 8.612e-60
Identity = 215/763 (28.18%), Postives = 363/763 (47.58%), Query Frame = 1
Query:  124 QIFENLPVGSVICKLSNVIIPRPSDTT--KFKLIKNR----FFQIE--NGDNLKVSGLIDRDDNLELCAYRNVNFSCIWR-GILFCGTNNLKILEIQIL--DENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIK-PFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDI--NANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILL-----PGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPV---GSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSP 2346
            ++ EN+ +G ++  L+  +IP  S TT  +FKL+         +IE   G+       IDR+   +LCA    +  C +   +        ++++I+ L  D NDN P +    I I + EN+ ++S Y  LP A D D   N +  Y++  +   F +   ++ +G K P L +++ +DRE    + + +   DGG P ++ +  L + + D NDN P+F+ +    SI  N  + +++  ++HATD DI  NA + + FS  V  I +  F LN    ++ +K+ L  E     ++  + A D G    ++   V +   N N+  PSI +     P N+ V+ + EN  +   I    V D D+  +G+  C      +++I   +    S       L T    D E      + +   D GKP  N SA + I + D NDN+P F + F   +I E N P   + +++A D D G NA++ Y +  D     P +         +  ++ LDREK  + + F     ++A D+G P  + + TV + ++D NDN PVF    YN    E+         V +    DPD+G N  VT SI+ E    F ++  +G +      DRE Q S YTF + A D        ++++  V+I + D NDN+P+FI P  SNY  +L  ++P    G++V  V A+D D+G+N+++++ +       LF+I++ +G +       V   G   + +KA D G P
Sbjct:   33 EMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDRE---KLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYT-LPAAVDPDVGTNGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSV-TQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDRE-ETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNV--PSIDIRYIVNPVNDTVV-LSENIPLNTKIALITVTDKDADHNGRVTCFT----DHEIPFRLRPVFSNQFL---LETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDA----PPEFSLDRRTGMLTVVKKLDREKE-DKYLFT----ILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGT---VGLITVTDPDYGDNSAVTLSILDEN-DDFTIDSQTGVIRPNISFDREKQES-YTFYVKAEDGGR---VSRSSSAKVTINVVDVNDNKPVFIVP-PSNYSYEL--VLPSTNPGTVVFQVMAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 759          
BLAST of Protocadherin alpha-11 vs. UniProt/SwissProt
Match: sp|Q6WYY1|PC11X_PANPA (Protocadherin-11 X-linked OS=Pan paniscus OX=9597 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 229.18 bits (583), Expect = 9.648e-60
Identity = 215/763 (28.18%), Postives = 363/763 (47.58%), Query Frame = 1
Query:  124 QIFENLPVGSVICKLSNVIIPRPSDTT--KFKLIKNR----FFQIE--NGDNLKVSGLIDRDDNLELCAYRNVNFSCIWR-GILFCGTNNLKILEIQIL--DENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIK-PFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDI--NANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILL-----PGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPV---GSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSP 2346
            ++ EN+ +G ++  L+  +IP  S TT  +FKL+         +IE   G+       IDR+   +LCA    +  C +   +        ++++I+ L  D NDN P +    I I + EN+ ++S Y  LP A D D   N +  Y++  +   F +   ++ +G K P L +++ +DRE    + + +   DGG P ++ +  L + + D NDN P+F+ +    SI  N  + +++  ++HATD DI  NA + + FS  V  I +  F LN    ++ +K+ L  E     ++  + A D G    ++   V +   N N+  PSI +     P N+ V+ + EN  +   I    V D D+  +G+  C      +++I   +    S       L T    D E      + +   D GKP  N SA + I + D NDN+P F + F   +I E N P   + +++A D D G NA++ Y +  D     P +         +  ++ LDREK  + + F     ++A D+G P  + + TV + ++D NDN PVF    YN    E+         V +    DPD+G N  VT SI+ E    F ++  +G +      DRE Q S YTF + A D        ++++  V+I + D NDN+P+FI P  SNY  +L  ++P    G++V  V A+D D+G+N+++++ +       LF+I++ +G +       V   G   + +KA D G P
Sbjct:   33 EMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDRE---KLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYT-LPAAVDPDVGTNGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSV-TQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDRE-ETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNV--PSIDIRYIVNPVNDTVV-LSENIPLNTKIALITVTDKDADHNGRVTCFT----DHEIPFRLRPVFSNQFL---LETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDA----PPEFSLDRRTGMLTVVKKLDREKE-DKYLFT----ILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGT---VGLITVTDPDYGDNSAVTLSILDEN-DDFTIDSQTGVIRPNISFDREKQES-YTFYVKAEDGGR---VSRSSSAKVTINVVDVNDNKPVFIVP-PSNYSYEL--VLPSTNPGTVVFQVMAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 759          
BLAST of Protocadherin alpha-11 vs. UniProt/SwissProt
Match: sp|Q6X862|PC11X_GORGO (Protocadherin-11 X-linked OS=Gorilla gorilla gorilla OX=9595 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 1.309e-59
Identity = 215/763 (28.18%), Postives = 363/763 (47.58%), Query Frame = 1
Query:  124 QIFENLPVGSVICKLSNVIIPRPSDTT--KFKLIKNR----FFQIE--NGDNLKVSGLIDRDDNLELCAYRNVNFSCIWR-GILFCGTNNLKILEIQIL--DENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIK-PFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDI--NANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILL-----PGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPV---GSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSP 2346
            ++ EN+ +G ++  L+  +IP  S TT  +FKL+         +IE   G+       IDR+   +LCA    +  C +   +        ++++I+ L  D NDN P +    I I + EN+ ++S Y  LP A D D   N +  Y++  +   F +   ++ +G K P L +++ +DRE    + + +   DGG P ++ +  L + + D NDN P+F+ +    SI  N  + +++  ++HATD DI  NA + + FS  V  I +  F LN    ++ +K+ L  E     ++  + A D G    ++   V +   N N+  PSI +     P N+ V+ + EN  +   I    V D D+  +G+  C      +++I   +    S       L T    D E      + +   D GKP  N SA + I + D NDN+P F + F   +I E N P   + +++A D D G NA++ Y +  D     P +         +  ++ LDREK  + + F     ++A D+G P  + + TV + ++D NDN PVF    YN    E+         V +    DPD+G N  VT SI+ E    F ++  +G +      DRE Q S YTF + A D        ++++  V+I + D NDN+P+FI P  SNY  +L  ++P    G++V  V A+D D+G+N+++++ +       LF+I++ +G +       V   G   + +KA D G P
Sbjct:   33 EMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDRE---KLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYT-LPAAVDPDVGINGVQNYELIKSQNMFGLDVIETPEGDKMPQLIVQKELDREKKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSV-TQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDRE-ETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNV--PSIDIRYIVNPVNDTVV-LSENIPLNTKIALITVTDKDADHNGRVTCFT----DHEIPFRLRPVFSNQFL---LETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDA----PPEFSLDRRTGMLTVVKKLDREKE-DKYLFT----ILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGT---VGLITVTDPDYGDNSAVTLSILDEN-DDFTIDSQTGVIRPNISFDREKQES-YTFYVKAEDGGR---VSRSSSAKVTINVVDVNDNKPVFIVP-PSNYSYEL--VLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 759          
BLAST of Protocadherin alpha-11 vs. UniProt/SwissProt
Match: sp|Q9BZA7|PC11X_HUMAN (Protocadherin-11 X-linked OS=Homo sapiens OX=9606 GN=PCDH11X PE=2 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 1.824e-59
Identity = 214/764 (28.01%), Postives = 365/764 (47.77%), Query Frame = 1
Query:  124 QIFENLPVGSVICKLSNVIIPRPSDTT--KFKLIKNR----FFQIE--NGDNLKVSGLIDRDDNLELCAYRNVNFSCIWR-GILFCGTNNLKILEIQIL--DENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIK-PFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDI--NANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILL-----PGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQ---IIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIF-PNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSP 2346
            ++ EN+ +G ++  L+  +IP  S TT  +FKL+         +IE   G+       IDR+   +LCA    +  C +   +        ++++I+ L  D NDN P +    I I + EN+ ++S Y  LP A D D   N +  Y++  +   F +   ++ +G K P L +++ +DRE    + + +   DGG P ++ +  L + + D NDN P+F+ +    SI  N  + +++  ++HATD DI  NA + + FS  V  I +  F LN    ++ +K+ L  E     ++  + A D G    ++   V +   N N+  PSI +     P N+ V+ + EN  +   I    V D D+  +G+  C      +++I   +    S       L T    D E      + +   D GKP  N SA + I + D NDN+P F + F   +I E N P   + +++A D D G NA++ Y       L  P+   +   +C+   +  ++ LDREK  + + F     ++A D+G P  + + TV + ++D NDN PVF    YN    E+         V +    DPD+G N  VT SI+ E    F ++  +G +      DRE Q S YTF + A D        ++++  V+I + D NDN+P+FI  P+  +Y++ L    P G++V  V A+D D+G+N+++++ +       LF+I++ +G +       V   G   + +KA D G P
Sbjct:   33 EMPENVLIGDLLKDLNLSLIPNKSLTTAMQFKLVYKTGDVPLIRIEEDTGEIFTTGARIDRE---KLCAGIPRDEHCFYEVEVAILPDEIFRLVKIRFLIEDINDNAPLFPATVINISIPENSAINSKYT-LPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSV-TQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDRE-ETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNV--PSIDIRYIVNPVNDTVV-LSENIPLNTKIALITVTDKDADHNGRVTCFT----DHEIPFRLRPVFSNQFL---LETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINY-------LLGPDAPPEFSLDCRTGMLTVVKKLDREKE-DKYLFT----ILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGT---VGLITVTDPDYGDNSAVTLSILDEN-DDFTIDSQTGVIRPNISFDREKQES-YTFYVKAEDGGR---VSRSSSAKVTINVVDVNDNKPVFIVPPSNCSYELVLPSTNP-GTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP 759          
BLAST of Protocadherin alpha-11 vs. TrEMBL
Match: A0A4E0RYN8 (Putative protocadherin alpha OS=Fasciola hepatica OX=6192 GN=D915_000027 PE=4 SV=1)

HSP 1 Score: 372.474 bits (955), Expect = 9.425e-105
Identity = 261/846 (30.85%), Postives = 415/846 (49.05%), Query Frame = 1
Query:  133 ENLPVGSVICKLSNVIIPRPSDTTKFKLIKNRFFQIENGDNLKVSGLIDRDDNLELCAYRNVNFSCIWRGILFCGTNNLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKI----EPTSKYFFI---------------SSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLK--------------------------IHATDLD--INANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSIL-----------------LPGNNA-----VIRIIENQDIGVVILTG-VVKDNDSGMDGKFNC----SILEPKNY-----DIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTT-VSIELMDINDNIPVFQQAFYNISFLEDFGSKKN-SRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARD-------------------SPTNLLYR-------KTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPR 2349
            EN P  +VI +L + I P+P+   ++ + +N +F I    +++V GL+DRD+N +LC   +    C+W   +  G      L + I D NDNVP W+++SI I V E  +  +F  ELP A+D D   N I  YK+    E   ++  I               S+E  +   K FL++ + +DRE    HN+TLLA DG  P  TG L ++++++D ND+ P F SS YT  +  +  + S + L+                          + ATD D   N  + Y F+ +    V D F L+ ++  +RV K L ++   + ++F + A D GRP   S TTV + LK+ N + P I                  +P   A     VI I EN    +  L    V D D+G  G+F+C    S +   N+     D  L     K  N  + SL   +  DRE     +L++ C D G+P  +T  ++++I++D NDN+PQF ++ Y + + E N+PN ++ +L AHD DDG N ++ YRI W  +    ++   +    ++I  ++LDRE  P G++F    QVIA D G+P+    T  V + L DIND  P F Q  YN +  ED+       R V    A D D G+NG V Y ++ +  LPF++  N G L +   +DRE + + Y+ ++ ARD                     T++  R       +T+   V I + D ND+ PIF++PN S+Y++++S     G ++T + A+DKD+G N QI++ + +  +  LF +   +GEL     LS  +KG   L ++A D G+P+
Sbjct:   71 ENTPNLTVIGRLVDSIRPKPNQNLRYTIPQNPYFDISPESSVRVIGLLDRDENRQLCTEPSYPQQCVWTSFVVTGNGQYIGLRVVINDVNDNVPAWAESSITIHVTEEMQT-TFSAELPVAKDPDLDKNGIQGYKLQTELEDAERFELIVKSSAVKSGVRFSIDSAETLSSRFKLFLQVLKPLDRETQPRHNLTLLAFDGSEPYHTGRLNIIVEVVDENDHSPQFTSSAYTAVVSEDASVGSDIPLQESTSVAVKQSDSGGFVPPSYVDRVSQMRATDRDEGPNGQIQYEFAASTDPQVLDLFTLDQYSGRIRVAKPLSYDIRPTGWKFQVLAKDGGRPSRSSSTTVVIQLKDANTHGPEIKTRLHEPKPFFEGITRLGIPSAPAEHITNVIYIPENTPPVLEPLAVFTVGDKDTGTGGEFDCVLTDSEMSASNHADGSADFRLNFT-AKLPNWNVYSLYVIRSIDREAAPVRELVVTCTDHGEPPRSTYEKLNVILVDENDNAPQFTQKTYQFHVLEGNRPNASVGKLRAHDPDDGPNGRVTYRIVWPPTQPISDRPFLIAEGGKLIVTKTLDREANPKGYKF----QVIAADGGKPRPLNDTAEVEVILDDINDCTPQFSQKHYNFTIEEDYAQNFTIGRFVGRVQAVDCDLGLNGAVQY-VILDPGLPFEITSN-GMLKTTRYIDREMR-AVYSLTVLARDGGNEGDADLDEELQEYRTAGSTDMFNRAINDQKVRTSAAQVQITVTDVNDHYPIFVYPNASSYQVRISMHEKRGFIITRLVAVDKDTGPNGQIRYGIIKGNQLGLFKVRPDTGELYLDRPLSAEYKGNLVLIVEASDLGTPK 907          
BLAST of Protocadherin alpha-11 vs. TrEMBL
Match: A0A267F7Y4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030061g1 PE=4 SV=1)

HSP 1 Score: 336.265 bits (861), Expect = 4.073e-94
Identity = 246/796 (30.90%), Postives = 406/796 (51.01%), Query Frame = 1
Query:  214 LIKNRFFQI-ENGDNLKVSGLIDRD-DNLELCAYRN--VNFSCIWRGILFCGTNNLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFF--ISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDI--NANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFA-SEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQF--EKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSI-VRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNES-NYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGEFRNPDSTPFNETEESFLSDQAT--FIIVGIILGTFFICCGLVTGICTMAYRRWHSSNN 2556
             +K+ +F + ++   + V   IDRD D  ELC  +   +N SC+    +        ++ I I D ND+ PQW  + + +   EN + ++     P A D D   N+++ Y++ P S  F   ++++     + P L +++ +DRE+ +++N TL A DGG   +  S+ L + ++DVND  P+F+ + Y  S+  +     T+ L + ATD DI  N NV+YRF+   P  ++  FD+  ++  + V+ S K +     +Y FS+ A D G   ++ + +V +++ + N   P I L  + AV  ++EN+ +   ++T +V D D+G  G+F+CSI + + Y  +  +N  +S       + T    DRE        + C D G P    S  +++ ++D ND+ P F     ++     E N P   +  +TA D D G NA+L Y+I W +S    N   ++++N  I A ++LDRE+ P GF F     V A+D        + TVSI L+DINDN PVF +  Y     E   +    + V    A D D G NG V +++   E  +PF+L      +Y+   +DRE + S Y F + A D       RKTAT +VS+V+ D ND +P+F FP  + + +++LSY  P    V  ++A D D+G NS++ F L++      FSI+  SG+L     +S    G   L I A D GSP+ +A   L I I      D  P +  ++++ +D  T   II+ I++ T  IC  L+T IC MA ++  S+ +
Sbjct:   52 FVKDGYFAVNQDTGVVTVKAPIDRDLDAAELCNLKPAPINGSCVREFTVMYDGGRFILVRIGIADRNDHSPQWGVSRLDVSFPENVRPNTARSISPTATDPDLGRNSVTAYRMRPDSPSFRLEVATDPITGALVPKLVVQQELDREITAFYNFTLTAEDGG--GRQTSVPLTVTVLDVNDESPVFQQNAYAGSVREDASNGWTV-LTVLATDKDIGLNGNVSYRFATETPKTIRSAFDIGLYSGSIFVRDSSKLDYETDKQYEFSVVARDAGSDPKEDRASVIINVIDVNDQKPEIELYWDKAVT-VMENK-VNATVVTLMVSDKDAGQAGEFDCSITDREQYFTLTKLNTVQSR--VFYRMATKVGLDREEFAVQNPTVSCTDRGLPPLTNSLPVTVQVLDENDSPPVFVSGGGYFRKEFAEGNSPGDQVLNVTAVDRDVGENARLTYQIVWKSSETSANPF-EIDANGLIRARETLDRERNPAGFEF----SVTASDG---PHVATATVSIPLIDINDNPPVFDRQLYQFRVTE---TDSTGQHVGDLNATDADAGSNGLVRFALHPAEVGVPFQLPSEGPSIYTLHPIDREFRAS-YQFRVIAFDQ--GATDRKTATATVSVVVADVNDCDPVFQFPTPAGDSEVRLSYQEPSDFQVAEIRATDADAGANSKLTFSLKQGNLYERFSIDPDSGKLYVKKPMSRSDMGVTRLTITATDSGSPQRSAEAALKIRID-----DRPPTSLLKDAWSADMETNKLIIICIVVATGVICAILITAICLMARKQPCSAGH 821          
BLAST of Protocadherin alpha-11 vs. TrEMBL
Match: A0A267F2A8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016480g1 PE=4 SV=1)

HSP 1 Score: 335.495 bits (859), Expect = 8.730e-94
Identity = 245/796 (30.78%), Postives = 407/796 (51.13%), Query Frame = 1
Query:  214 LIKNRFFQI-ENGDNLKVSGLIDRD-DNLELCAYRN--VNFSCIWRGILFCGTNNLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFF--ISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDI--NANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFA-SEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQF--EKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSI-VRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNES-NYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGEFRNPDSTPFNETEESFLSDQAT--FIIVGIILGTFFICCGLVTGICTMAYRRWHSSNN 2556
             +K+ +F + ++   + V   IDRD D  ELC  +   +N SC+    +        ++ I I D ND+ PQW  + + +   EN + ++     P A D D   N+++ Y++ P S  F   ++++     + P L +++ +DRE+ +++N TL A DGG   +  S+ L + ++DVND  P+F+ + Y  S+  +     T+ L + ATD DI  N NV+YRF+   P  ++  FD+  ++  + V+ S K +     +Y FS+ A D G   ++ + +V +++ + N   P I L  + AV  ++EN+ +   ++T +V D D+G  G+F+CSI++ + Y  +  +NK +S       + T    DRE        + C D G P    S  +++ ++D ND+ P F     ++     E N P   +  +TA D D G NA+L Y+I W +S    N   ++++N  I A ++LDRE+ P GF F     V A+D        + TVSI L+DINDN P+F +  Y     E   +    + V    A D D G NG V +++   E  +PF+L      +Y+   +DRE + S Y F + A D       R TAT +VS+V+ D ND +P+F FP  + + +++LSY  P    V  ++A D D+G NS++ F L++      FSI+  SG+L     +S    G   L I A D GSP+ +A   L I I      D  P +  ++++ +D  T   II+ I++ T  IC  L+T IC MA ++  S+ +
Sbjct:   52 FVKDDYFAVNQDTGVVTVKAPIDRDLDAAELCNLKPAPINGSCVREFTVMYDGGRFILVRIGIADRNDHSPQWGISRLDVSFPENVRPNTARSISPTATDPDLGRNSVTAYRMRPDSPSFRLEVATDPITGALVPKLVVQQELDREITAFYNFTLTAEDGG--GRQTSVPLTVTVLDVNDESPVFQQNAYAGSVREDASNGWTV-LTVLATDKDIGLNGNVSYRFATETPKTIRSAFDIGLYSGSIFVRDSSKLDYETDKQYEFSVVARDAGSDPKEDRASVIINVIDVNDQKPEIELYWDKAVT-VMENK-VNATVVTLMVSDKDAGQAGEFDCSIMDREQYFTLTKLNKVQSR--VFYRMATKVGLDREEFAVQNPTVSCTDRGLPPLTNSLPVTVQVLDENDSPPVFVSGGGYFRKEFAEGNSPGDQVLNVTAIDRDVGENARLTYQIVWKSSETSANPF-EIDANGLIRARETLDRERNPAGFEF----SVTASDG---PHVATATVSIPLIDINDNPPLFDRQLYQFRVTE---TDSTGQHVGDLNATDADAGSNGLVRFALHPAEVGVPFQLPSEGPSIYTLHPIDREFRAS-YQFRVIAFDQ--GATDRNTATATVSVVVADVNDCDPVFQFPTPAGDSEVRLSYQEPPDFQVAEIRATDADAGANSKLTFSLKQGNLYERFSIDPDSGKLYVKKPMSRSDMGVTRLTITATDSGSPQRSAEAALKIRID-----DRPPTSLLKDAWSADMETNKLIIICIVVATGVICAILITAICLMARKQPCSAGH 821          
BLAST of Protocadherin alpha-11 vs. TrEMBL
Match: A0A1I8JAE5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 335.495 bits (859), Expect = 1.392e-93
Identity = 245/796 (30.78%), Postives = 407/796 (51.13%), Query Frame = 1
Query:  214 LIKNRFFQI-ENGDNLKVSGLIDRD-DNLELCAYRN--VNFSCIWRGILFCGTNNLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFF--ISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDI--NANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFA-SEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQF--EKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSI-VRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNES-NYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGEFRNPDSTPFNETEESFLSDQAT--FIIVGIILGTFFICCGLVTGICTMAYRRWHSSNN 2556
             +K+ +F + ++   + V   IDRD D  ELC  +   +N SC+    +        ++ I I D ND+ PQW  + + +   EN + ++     P A D D   N+++ Y++ P S  F   ++++     + P L +++ +DRE+ +++N TL A DGG   +  S+ L + ++DVND  P+F+ + Y  S+  +     T+ L + ATD DI  N NV+YRF+   P  ++  FD+  ++  + V+ S K +     +Y FS+ A D G   ++ + +V +++ + N   P I L  + AV  ++EN+ +   ++T +V D D+G  G+F+CSI++ + Y  +  +NK +S       + T    DRE        + C D G P    S  +++ ++D ND+ P F     ++     E N P   +  +TA D D G NA+L Y+I W +S    N   ++++N  I A ++LDRE+ P GF F     V A+D        + TVSI L+DINDN P+F +  Y     E   +    + V    A D D G NG V +++   E  +PF+L      +Y+   +DRE + S Y F + A D       R TAT +VS+V+ D ND +P+F FP  + + +++LSY  P    V  ++A D D+G NS++ F L++      FSI+  SG+L     +S    G   L I A D GSP+ +A   L I I      D  P +  ++++ +D  T   II+ I++ T  IC  L+T IC MA ++  S+ +
Sbjct:   85 FVKDDYFAVNQDTGVVTVKAPIDRDLDAAELCNLKPAPINGSCVREFTVMYDGGRFILVRIGIADRNDHSPQWGISRLDVSFPENVRPNTARSISPTATDPDLGRNSVTAYRMRPDSPSFRLEVATDPITGALVPKLVVQQELDREITAFYNFTLTAEDGG--GRQTSVPLTVTVLDVNDESPVFQQNAYAGSVREDASNGWTV-LTVLATDKDIGLNGNVSYRFATETPKTIRSAFDIGLYSGSIFVRDSSKLDYETDKQYEFSVVARDAGSDPKEDRASVIINVIDVNDQKPEIELYWDKAVT-VMENK-VNATVVTLMVSDKDAGQAGEFDCSIMDREQYFTLTKLNKVQSR--VFYRMATKVGLDREEFAVQNPTVSCTDRGLPPLTNSLPVTVQVLDENDSPPVFVSGGGYFRKEFAEGNSPGDQVLNVTAIDRDVGENARLTYQIVWKSSETSANPF-EIDANGLIRARETLDRERNPAGFEF----SVTASDG---PHVATATVSIPLIDINDNPPLFDRQLYQFRVTE---TDSTGQHVGDLNATDADAGSNGLVRFALHPAEVGVPFQLPSEGPSIYTLHPIDREFRAS-YQFRVIAFDQ--GATDRNTATATVSVVVADVNDCDPVFQFPTPAGDSEVRLSYQEPPDFQVAEIRATDADAGANSKLTFSLKQGNLYERFSIDPDSGKLYVKKPMSRSDMGVTRLTITATDSGSPQRSAEAALKIRID-----DRPPTSLLKDAWSADMETNKLIIICIVVATGVICAILITAICLMARKQPCSAGH 854          
BLAST of Protocadherin alpha-11 vs. TrEMBL
Match: A0A068X3A5 (Protocadherin 1 OS=Echinococcus granulosus OX=6210 GN=EgrG_000150200 PE=4 SV=1)

HSP 1 Score: 325.865 bits (834), Expect = 5.586e-89
Identity = 245/818 (29.95%), Postives = 379/818 (46.33%), Query Frame = 1
Query:  124 QIFENLPVGSVICKLSNVIIPRPSDTTKFKLIKNRFFQIENGDNLKVSGLIDRDDNLELCAYRNVNFSCIWRGILFCGTNNLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKI------------------EPTSKYFF-------ISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLK--------------------IHATDLDINAN--VTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNA--------------VIRIIENQDIGVVILTGV-VKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSK-KNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNL------LYRK----------TATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCG 2340
            Q+ EN   G +I  + + I        +F L +N FF+ ++  +L V+G++DR+ +  LC       +C W   L     N   L + I D NDN P WS   + I + EN+  + F  EL  A D D   N I  YK+                   PT K          + S  S  G  P L L + +DRE + W N+TLLA+DG  P  T +L++ +++ D ND+ P F    Y   +     + ST+ L+                    + A D D  AN  V Y F+ + P   Q  F ++     LRV + L ++     + F + A D GRP   S T V++ LK+ N +PPSI +  + +               +RI EN  +    L  V V D D+G  G+F+C +L  ++ +    + K +   + I  L  +  FDRE      + IFC+D G P  ++S +I ++I D NDNSP FE  FY  T  E       + Q+ A D DDG  A+L Y IQW       ++++ ++ +  + A   LDRE  P G+       VI  D+G P RS S  V + L+D+ND IP+F Q+ YN + +ED+ +  +  R V +  A D D      V Y ++    L F ++   G +++   +DRE Q S Y   + A D P  +      +Y            TAT ++S+ I+D NDN P F+ P  ++  I++S+   VG ++T + AID D+G N  + + +    R+ +F + E SG+L     +     G  TL I+A D G
Sbjct:   21 QVEENTEQGQIIGSIYDKISLPLDQRFQFSLPQNPFFKFDSEGSLLVAGILDREGSSGLCKEPGFPETCEWSSFLVDNGGNYISLRVHIEDVNDNAPSWSVPFVTITIPENSAPN-FTTELSSAHDPDYGVNGIKEYKLIAPPAYEDLFMLKINPFHSPTLKRRQTRDQQRRVKSTPSPIG-SPILVLLKPLDREKLPWINLTLLAMDGSPPYYTAALEIHVRVSDDNDHSPAFTFQRYVAQLPEVAPVGSTIQLRPISSSRQSDDNGVTGPLVNHLQAMDPDEGANGRVYYSFARSTPLETQKTFAIDSHTGQLRVARPLSYDDGPIAWNFQVVATDSGRPPRSSFTDVSIQLKDANNHPPSISIQSSMSYRSQEDNEEHLDVTAVRIRENVKLMKKHLATVTVNDRDTGEGGEFDC-LLRSEDAEHFSLVLKGQLPQVMIYDLFVSGTFDREADKIRSVEIFCEDKGSPRLSSSHQIRLLIEDENDNSPVFEFPFYRLTTKEAQVKGSVVGQVKASDADDGEAARLSYEIQWPKGTRPADRVLAIDRDGNLTAKIPLDRESSPFGYNLT----VICRDNGTPSRSASAGVHLALLDVNDCIPLFSQSVYNFTLVEDYSTAFQGQRFVGIVHATDCDGPEFSRVVYLLLNSYHL-FSID-REGRIFTTRSLDRE-QESVYELHVLATDRPVGIETPEERVYTSEALLLSTPYNTATATISVSIQDLNDNPPHFVHPTNTSIPIRVSFQEDVGFVLTRMVAIDPDNGKNGTVSYRIVRGNRHGVFKLGEYSGDLYIGKKMVPEQVGTHTLQIEARDHG 828          
BLAST of Protocadherin alpha-11 vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 234.187 bits (596), Expect = 7.097e-63
Identity = 204/683 (29.87%), Postives = 325/683 (47.58%), Query Frame = 1
Query:  382 IQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIE--PTSKYFFISSEKSNKGIK-PFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEIN-STLDLKIHATDLDINANVTY---RFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPG------NNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVE-SNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGE 2388
            I++ D NDN PQ+    + + V EN  + + +  +P+A D D   N +  Y +   P +   F     +++G K P L +   +DREL   +++T+ AVDGGTPS+  S  L + I D NDN P FE S Y   +  N  +  S L +K + +DL  N  + Y   + S  VP ++Q    +     I+ VK  L  E  +S ++F + A D G   + S T V++ + +QN   P++ + G      ++ V  I E+  +G  +    V D D G +    C +     +  +     +  +N     L T    D E     ++ I   D G PA +++  + + + D NDNSP F    +     EENQP   +  + A D D G NA+L Y I  D+S      L +++ S+ ++ A   LDRE +   + F    +V A D G P   G+ TV I+++D NDN P F  + Y+ S LE+         V V    D D G N  V  S V   +  F +   +G + S    DRE + S YTF + A D        +++ V V+I + D NDN P+   P+ S+++ +LS L    S+V +V+A D D G N+++ + +     + LF I+ + GE+  +  L+  H G   L +K  D G P   AI  + I + E
Sbjct:  119 IEVQDINDNTPQFPSPVLTLSVQENAHMGATFA-IPQATDRDTERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQ----IERSTGIISVKGPLDREEISS-FKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQ-LRPAGDSSVDNKKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSST---RGLFEIDPSSGEVRARSPLDRE-HKERYEF----RVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVL---DMDKGENAQVQLS-VEPDVGNFVVQNGTGTILSSISFDREKE-SSYTFRLKAVDGGEP---PRSSYVGVTINVLDENDNAPVVTKPSNSSFR-RLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPSRHAIALVHIYVNE 777          

HSP 2 Score: 147.132 bits (370), Expect = 2.281e-35
Identity = 155/537 (28.86%), Postives = 244/537 (45.44%), Query Frame = 1
Query:  373 ILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKI----EPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFE--------SSFYTQSIDCNLEINSTLDL-KIHATDLDINANVTYRFSLNVPFIVQDCFDL---NPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLP-FKLNPNSGEL 1932
            +L + I D NDN PQ+ ++S   EV EN+ +    L++ KA DSD  PN    Y I    +P  K   I  E+S  GI   + ++  +DRE IS     ++A D G   K+ +  + I++ D NDN P  E         S    +I  ++ + + + L ++   D   NA VT   + +VPF ++   D    N     L+    L +E    +YR  I A+D G P   S  ++ + + + N   P I  P    V    ENQ  G  +L  +  D DSG + +   SI+   +   +  ++ +  E  A   L      DRE K R +  +   D G P+   +A + I ++D NDN P+F    Y +++ E   P   +  +T  D+D G NAQ++  ++ D         +       I++  S DREK  + + F    ++ A D GEP RS    V+I ++D NDN PV  +   N SF            V V  A D D+G N ++ YSI        F ++P+ GE+
Sbjct:  228 LLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQV-KANDSDLGPNGEIEYTIHQASDPVPKMLQI--ERST-GI---ISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDNKKKYFLQTTTPLDYERI-RDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSP-IFSPPLFEVEFAEENQP-GEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARSPL------DREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVEPDV-----GNFVVQNGTGTILSSISFDREKE-SSYTF----RLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKP-SNSSFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHELFYISPSDGEI 737          

HSP 3 Score: 61.6178 bits (148), Expect = 5.406e-9
Identity = 81/304 (26.64%), Postives = 119/304 (39.14%), Query Frame = 1
Query: 1435 YTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQS-----------LDREKYPN----GFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFI---AHDPDFGVNGDVTYSIV----RETLLPFKLNPNSGELYSYDLV----DRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNI--LFSINETSG 2262
            Y + EE  PN  I  L A                 D  L D   L K+E     + +             +DRE   +    G      ++V  TD  + Q        IE+ DINDN P F      +S  E      N+   A F    A D D   NG + Y +        L   ++  + GE     +V    DRE + S Y  +I A D  T   Y   ++  + +VI D NDN P F    +S+Y+ ++S   PVG  V  VKA D D G N +I++ + +    +  +  I  ++G
Sbjct:   27 YHVREEQPPNTLIGSLAA-----------------DQGLPDSGHLYKLEVGAPYLRVDGKTGEIFTTEIPIDRETLKDCRIKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQE------NAHMGATFAIPQATDRDTERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDS-YDLTINAVDGGTPSRY---SSALLRVVITDANDNAPQF---EKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTG 300          
BLAST of Protocadherin alpha-11 vs. Ensembl Cavefish
Match: pcdh1b (protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-2])

HSP 1 Score: 233.032 bits (593), Expect = 2.220e-62
Identity = 199/672 (29.61%), Postives = 315/672 (46.88%), Query Frame = 1
Query:  382 IQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTS---KYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEIN-STLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPG------NNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDI-ILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTS---LYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDK---DSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSP 2346
            I+I DENDN PQ+    + + + ENT + + Y  +P A D D   N I+ YK+   S     F +    +     P L +   +DRE    +++++  +DGGTP +  S  L I I D NDN P FE S Y   +  N  +  S L +K +  DL  N  VTY F    P  VQ    ++    I++VK S+  E      +FS+ A D+G   + SK  VT+ +K++N   PSI + G       + +  + E+  +G  +    V D D G +    C +     + +   + + + S+    +   T   ++R  + RI+++    D G PA +++  + + + D+NDN+P F    Y     EENQP   +  + A D D G NA+L Y I  D++   L+D N      +  ++  +  LDRE Y   + F     V A D G P   G+ TV + ++D NDN P F    Y+ S LE+         V V    D D G N  V  S+  E    F +   +G + S    DRE + S YTF + A D        +++ V ++I + D NDN P    P+ S+YK    +L P+ S  T V+ +D    D+G+N+++ + +     + LF I+ T GE+  +   +  H G   L +K  D G P
Sbjct:  131 IEIQDENDNTPQFPSPILELAIPENTYVGAHY-SIPVAMDKDAGSNGIADYKLNSGSDAMNLFSLQVADNTDEKVPQLIVLGNLDREQRDTYDLSIKVIDGGTPPRYSSALLRITITDTNDNVPKFERSHYEGEMAENTPVGQSVLQVKANDDDLGANGQVTYSFHQPSPN-VQRLLHIDHNTGIIQVKGSVDREEVPL-LKFSVQARDNGPQAKSSKAMVTITVKDRNDNAPSIRIRGFGLVAHEDGIANVSEDMPVGTPVALVEVSDKDEGENAVVTCVVAGDVPFQLRSASASDSTSKRKYFLQTTTPLDYERIKEYRIEIVAV--DSGNPALSSTNSLKVQVTDMNDNAPVFSPSLYEVDFAEENQPGDKVLDVVATDADSGTNAELLYSIITDSATKGLFDINP-----NTGEVRVMNQLDRE-YKERYEF----HVEAADKGVPSLKGTATVVVRVLDRNDNDPKFMLNGYSFSVLENMPPLSPVGMVTVI---DADKGENAHVQLSVEPEN-GKFVIQNGTGTILSSISFDREKE-STYTFRLKAVDGGDP---PRSSYVGITINVLDENDNAPYVTKPSNSSYK----FLQPLTSPDTRVEKVDAEDIDTGLNAELVYSITGGNPHGLFRISSTDGEITLAKEFTRKHNGLHRLVVKVSDKGKP 775          

HSP 2 Score: 147.132 bits (370), Expect = 2.534e-35
Identity = 151/576 (26.22%), Postives = 257/576 (44.62%), Query Frame = 1
Query:  712 IKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAI------LRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPK-NYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFT--------IAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPY--QVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLP--FKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEI 2382
            I+I D NDN P F S     +I  N  + +   + + A D D  +N    + LN      + F L   +        L V  +L  E   + Y  SI  +D G P   S   + + + + N   P      ++    + EN  +G  +L     D+D G +G+   S  +P  N   +L ++     N  II +  +   DRE    ++  +  +D G  A ++ A ++I + D NDN+P      +     E+   N +        +A +   D D+G NA +   +  D     P +L    ++      +   +   P  +  +  Y  +++A DSG P  S + ++ +++ D+NDN PVF  + Y + F E+    +   KV   +A D D G N ++ YSI+ ++     F +NPN+GE+   + +DRE +  +Y F + A D     L + TATV V ++  D NDN+P F+    + Y   +   +P  S V +V  ID D G N+ +Q  +E E  N  F I   +G +L+S       +   T  +KA+D G P  ++   +TI +
Sbjct:  131 IEIQDENDNTPQFPSPILELAIPENTYVGAHYSIPV-AMDKDAGSNGIADYKLNSGSDAMNLFSLQVADNTDEKVPQLIVLGNLDREQRDT-YDLSIKVIDGGTPPRYSSALLRITITDTNDNVPKFER--SHYEGEMAENTPVGQSVLQVKANDDDLGANGQVTYSFHQPSPNVQRLLHID----HNTGIIQVKGS--VDREEVPLLKFSVQARDNGPQAKSSKAMVTITVKDRNDNAPSIRIRGFGLVAHEDGIANVSEDMPVGTPVALVEVSDKDEGENAVVTCVVAGDV----PFQLRSASASDSTSKRKYFLQTTTPLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPSLYEVDFAEE---NQPGDKVLDVVATDADSGTNAELLYSIITDSATKGLFDINPNTGEVRVMNQLDREYK-ERYEFHVEAADKGVPSL-KGTATVVVRVL--DRNDNDPKFML---NGYSFSVLENMPPLSPVGMVTVIDADKGENAHVQLSVEPE--NGKFVIQNGTGTILSSISFDREKESTYTFRLKAVDGGDPPRSSYVGITINV 680          

HSP 3 Score: 129.413 bits (324), Expect = 8.383e-30
Identity = 136/519 (26.20%), Postives = 228/519 (43.93%), Query Frame = 1
Query:  373 ILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNN-ISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKP----------IFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNA---ILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIP-VFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIV 1884
            +L I I D NDNVP++ ++    E+ ENT +    L++ KA D D   N  ++Y   +P+     +     N GI   ++++  +DRE +     ++ A D G  +K+    + I + D NDN P            E      S D  +     L +++   D   NA VT   + +VPF ++     +  +     L+    L +E    EYR  I A+D G P   S  ++ + + + N   P +  P    V    ENQ  G  +L  V  D DSG + +   SI+       +  +N    E       + N++ DRE K R +  +   D G P+   +A + + ++D NDN P+F    Y +++ E   P   +  +T  D D G NA ++  ++ +       K +       I++  S DREK          +++ A D G+P RS    ++I ++D NDN P V + +  +  FL+   S     +V    A D D G+N ++ YSI 
Sbjct:  240 LLRITITDTNDNVPKFERSHYEGEMAENTPVGQSVLQV-KANDDDLGANGQVTYSFHQPSPNVQRLLHIDHNTGI---IQVKGSVDREEVPLLKFSVQARDNGPQAKSSKAMVTITVKDRNDNAPSIRIRGFGLVAHEDGIANVSEDMPVGTPVAL-VEVSDKDEGENAVVTCVVAGDVPFQLRSASASDSTSKRKYFLQTTTPLDYERI-KEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAP-VFSPSLYEVDFAEENQP-GDKVLDVVATDADSGTNAELLYSIITDSATKGLFDINPNTGE-----VRVMNQL-DREYKERYEFHVEAADKGVPSLKGTATVVVRVLDRNDNDPKFMLNGYSFSVLENMPPLSPVGMVTVIDADKGENAHVQLSVEPENG-----KFVIQNGTGTILSSISFDREK-----ESTYTFRLKAVDGGDPPRSSYVGITINVLDENDNAPYVTKPSNSSYKFLQPLTSPDT--RVEKVDAEDIDTGLNAELVYSIT 732          
BLAST of Protocadherin alpha-11 vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 233.802 bits (595), Expect = 2.828e-62
Identity = 204/683 (29.87%), Postives = 325/683 (47.58%), Query Frame = 1
Query:  382 IQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIE--PTSKYFFISSEKSNKGIK-PFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEIN-STLDLKIHATDLDINANVTY---RFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPG------NNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVE-SNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGE 2388
            I++ D NDN PQ+    + + V EN  + + +  +P+A D D   N +  Y +   P +   F     +++G K P L +   +DREL   +++T+ AVDGGTPS+  S  L + I D NDN P FE S Y   +  N  +  S L +K + +DL  N  + Y   + S  VP ++Q    +     I+ VK  L  E  +S ++F + A D G   + S T V++ + +QN   P++ + G      ++ V  I E+  +G  +    V D D G +    C +     +  +     +  +N     L T    D E     ++ I   D G PA +++  + + + D NDNSP F    +     EENQP   +  + A D D G NA+L Y I  D+S      L +++ S+ ++ A   LDRE +   + F    +V A D G P   G+ TV I+++D NDN P F  + Y+ S LE+         V V    D D G N  V  S V   +  F +   +G + S    DRE + S YTF + A D        +++ V V+I + D NDN P+   P+ S+++ +LS L    S+V +V+A D D G N+++ + +     + LF I+ + GE+  +  L+  H G   L +K  D G P   AI  + I + E
Sbjct:  155 IEVQDINDNTPQFPSPVLTLSVQENAHMGATFA-IPQATDRDTERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQ----IERSTGIISVKGPLDREEISS-FKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQ-LRPAGDSSVDNKKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVYSIIADSST---RGLFEIDPSSGEVRARSPLDRE-HKERYEF----RVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVL---DMDKGENAQVQLS-VEPDVGNFVVQNGTGTILSSISFDREKE-SSYTFRLKAVDGGEP---PRSSYVGVTINVLDENDNAPVVTKPSNSSFR-RLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPSRHAIALVHIYVNE 813          

HSP 2 Score: 147.902 bits (372), Expect = 2.189e-35
Identity = 155/537 (28.86%), Postives = 244/537 (45.44%), Query Frame = 1
Query:  373 ILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKI----EPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFE--------SSFYTQSIDCNLEINSTLDL-KIHATDLDINANVTYRFSLNVPFIVQDCFDL---NPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLP-FKLNPNSGEL 1932
            +L + I D NDN PQ+ ++S   EV EN+ +    L++ KA DSD  PN    Y I    +P  K   I  E+S  GI   + ++  +DRE IS     ++A D G   K+ +  + I++ D NDN P  E         S    +I  ++ + + + L ++   D   NA VT   + +VPF ++   D    N     L+    L +E    +YR  I A+D G P   S  ++ + + + N   P I  P    V    ENQ  G  +L  +  D DSG + +   SI+   +   +  ++ +  E  A   L      DRE K R +  +   D G P+   +A + I ++D NDN P+F    Y +++ E   P   +  +T  D+D G NAQ++  ++ D         +       I++  S DREK  + + F    ++ A D GEP RS    V+I ++D NDN PV  +   N SF            V V  A D D+G N ++ YSI        F ++P+ GE+
Sbjct:  264 LLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQV-KANDSDLGPNGEIEYTIHQASDPVPKMLQI--ERST-GI---ISVKGPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDNKKKYFLQTTTPLDYERI-RDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSP-IFSPPLFEVEFAEENQP-GEKVLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEVRARSPL------DREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVEPDV-----GNFVVQNGTGTILSSISFDREKE-SSYTF----RLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKP-SNSSFRRLSPLAAPDSVVEVVEAEDIDYGSNAELVYSIAGGNPHELFYISPSDGEI 773          

HSP 3 Score: 61.6178 bits (148), Expect = 6.231e-9
Identity = 81/304 (26.64%), Postives = 119/304 (39.14%), Query Frame = 1
Query: 1435 YTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQS-----------LDREKYPN----GFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFI---AHDPDFGVNGDVTYSIV----RETLLPFKLNPNSGELYSYDLV----DRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNI--LFSINETSG 2262
            Y + EE  PN  I  L A                 D  L D   L K+E     + +             +DRE   +    G      ++V  TD  + Q        IE+ DINDN P F      +S  E      N+   A F    A D D   NG + Y +        L   ++  + GE     +V    DRE + S Y  +I A D  T   Y   ++  + +VI D NDN P F    +S+Y+ ++S   PVG  V  VKA D D G N +I++ + +    +  +  I  ++G
Sbjct:   63 YHVREEQPPNTLIGSLAA-----------------DQGLPDSGHLYKLEVGAPYLRVDGKTGEIFTTEIPIDRETLKDCRIKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQE------NAHMGATFAIPQATDRDTERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDS-YDLTINAVDGGTPSRY---SSALLRVVITDANDNAPQF---EKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTG 336          
BLAST of Protocadherin alpha-11 vs. Ensembl Cavefish
Match: ENSAMXT00000035285.1 (pep primary_assembly:Astyanax_mexicanus-2.0:8:8923404:8955697:1 gene:ENSAMXG00000041384.1 transcript:ENSAMXT00000035285.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 219.164 bits (557), Expect = 1.554e-58
Identity = 181/626 (28.91%), Postives = 313/626 (50.00%), Query Frame = 1
Query:  229 FFQIENGDN-LKVSGLIDRDDNLELCAYRNVNFSCIWRGILFCGTNNLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLD--INANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSID--ALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKL---IKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISF------LEDFGSKKNSRKVAVFI-AHDPDFGVNGDVTYSI--VRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIV 2055
             F++   D  L V+G IDR++  E  +   +N        L      +  + ++I+D ND+ P +S+    +E+ EN  +     +L  ARD+D   N++  YK+     +     ++   G  PFL L++ +DRE  + H + L A+DGG P K+G++++++ +ID+NDN P+F    Y+  +  N  I + + ++++ATDLD   N  V Y F  +V   ++  FDL+P    + VK  +    F  +Y++ ID  A D       +   + + + + N   P I +   +  I + EN   G  +    V D DSGM+GK +CS+ E    DI  ++ ++  EN  I SL+T    DRE  ++  +    KD G P  ++   +++ + DVNDNSP+F    Y + + E N P  ++  ++AHDLD   NA + Y I  D +  + +     I  E+   I A++S D E     ++F     ++A+DSG P  S + TV++ ++D NDN+PV     Y +S       +E+     N+  +   + A+D D G NG + +S+  V +  L F L+  +G++ +      ET  + +   I  +D+  N+    TATV + IV
Sbjct:   73 LFRVNRNDGVLHVNGKIDREEVCERSSSCLINLKIALENPL-----EIHYVTVEIVDINDHPPIFSEKEKRLEISENA-IAGVRFQLQGARDADSGVNSVQMYKLSQNEHFRIEVRDRGEDGKMPFLILQKSLDRETCARHKLLLTALDGGRPQKSGTMEIIVDVIDINDNAPVFTKDTYSAKLSENAPIGTKV-IQVNATDLDNGPNGEVFYIFGQDVNRNLRRVFDLDPVTGEIVVKGPID---FEQKYQYEIDIQASDKALAPLTTDKIILIQIVDVNDNAPEIEV--TSLSIAVPENSHSGTTVALISVSDVDSGMNGKVSCSVPE----DIPFSLLQSSQEN--IYSLVTKSSLDREKTSQYDITFIAKDAGHPPLSSIKTLTVFVSDVNDNSPEFSLNPYTFYVPENNVPGMSMFSVSAHDLDLDENAIISYHIWRDPAQENKHSSFLNINPETGA-IYALKSFDFES-TKSYQFY----IVASDSGTPSLSSNVTVNVFILDQNDNVPVI---LYPVSSNGSAEGVEEIPRNVNAGHLVTKVRAYDADIGYNGWLLFSLQEVSDHSL-FGLDRYTGQIRTLRSF-TETDEALHKLVILVKDN-GNVSLSATATVIIKIV 668          

HSP 2 Score: 140.198 bits (352), Expect = 2.696e-33
Identity = 158/582 (27.15%), Postives = 259/582 (44.50%), Query Frame = 1
Query:  712 IKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLD--INANVTYRFSLNVPFIVQDCFDLN-----PFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKV--ESNCQIIAIQSLDREKYPNGFRFVCPYQV--IATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFI--AHDPDFGVNGDVTYSIVRETLLPFK------LNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVP----VGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGE 2388
            ++I+D+ND+ PIF        I  N        L+  A D D  +N+   Y+ S N  F ++   D       PF   L ++KSL  E  A  ++  + ALD GRP +     + + + + N   P  +   +    ++ EN  IG    T V++ N + +D   N  +      D+   + +    +     ++     D E K + ++ I   D       T   I I I+DVNDN+P+ E       + E +    T+A ++  D+D G+N ++   +  D     P  L++   E+   ++   SLDREK          Y +  IA D+G P  S   T+++ + D+NDN P F    Y     E+     N   +++F   AHD D   N  ++Y I R+     K      +NP +G +Y+    D E+  S Y F I A DS T  L   ++ V+V++ I D NDN P+ ++P  SN   +    +P     G LVT V+A D D G N  + F L+E   + LF ++  +G++ T    +   +    L I   D G+  L+A   + I+I E
Sbjct:  120 VEIVDINDHPPIFSEKEKRLEISENAIAGVRFQLQ-GARDADSGVNSVQMYKLSQNEHFRIE-VRDRGEDGKMPF---LILQKSLDRETCA-RHKLLLTALDGGRPQKSGTMEIIVDVIDINDNAP--VFTKDTYSAKLSENAPIG----TKVIQVNATDLDNGPNGEVFYIFGQDVNRNLRRVFDLDPVTGEIVVKGPIDFEQKYQYEIDIQASDKALAPLTTDKIILIQIVDVNDNAPEIEVTSLSIAVPENSHSGTTVALISVSDVDSGMNGKVSCSVPEDI----PFSLLQSSQENIYSLVTKSSLDREK-------TSQYDITFIAKDAGHPPLSSIKTLTVFVSDVNDNSPEFSLNPYTFYVPEN-----NVPGMSMFSVSAHDLDLDENAIISYHIWRDPAQENKHSSFLNINPETGAIYALKSFDFESTKS-YQFYIVASDSGTPSL---SSNVTVNVFILDQNDNVPVILYPVSSNGSAEGVEEIPRNVNAGHLVTKVRAYDADIGYNGWLLFSLQEVSDHSLFGLDRYTGQIRTLRSFTETDEALHKLVILVKDNGNVSLSATATVIIKIVE 669          

HSP 3 Score: 60.4622 bits (145), Expect = 1.056e-8
Identity = 60/233 (25.75%), Postives = 113/233 (48.50%), Query Frame = 1
Query: 1711 VSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGE------LYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEE-KRNI--LFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEI 2382
            V++E++DIND+ P+F +    +   E+  +     +  +  A D D GVN    Y + +      ++  + GE      L     +DRET  +++   +TA D       +K+ T+ + + + D NDN P+F    +  Y  +LS   P+G+ V  V A D D+G N ++ +I  ++  RN+  +F ++  +GE++    +    K +  + I+A D     LT  + + I+I
Sbjct:  118 VTVEIVDINDHPPIFSEKEKRLEISENAIA---GVRFQLQGARDADSGVNSVQMYKLSQNEHFRIEVR-DRGEDGKMPFLILQKSLDRET-CARHKLLLTALDGGRP---QKSGTMEIIVDVIDINDNAPVF---TKDTYSAKLSENAPIGTKVIQVNATDLDNGPNGEVFYIFGQDVNRNLRRVFDLDPVTGEIVVKGPIDFEQKYQYEIDIQASDKALAPLTTDKIILIQI 339          
BLAST of Protocadherin alpha-11 vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 219.164 bits (557), Expect = 7.005e-58
Identity = 197/675 (29.19%), Postives = 325/675 (48.15%), Query Frame = 1
Query:  367 LKILEIQIL--DENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIK-PFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDI--NANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSI----LLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAI-QSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLED---FGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQL-SYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPR 2349
             ++++I+ L  D NDN P +    I I + ENT +++ Y  +P A D D   N I +Y++  +   F +   ++ +G K P L +++ +DRE      + +   DGG P K+ +  L + + DVNDN+P+F+ S    ++  N  + +++  ++HATD D+  NA + + FS  +    +  F ++    ++ VK+ L  E         + +     P   S+ TV +++ + N   PSI    ++   N  + + EN  +   I    V D D+ ++GK  C      ++D+   +    ++      L T    D E      + I   D GKP  NTSA + I I D NDN+P F +     +I E N P   + ++TA D D G NA + Y +  D     P+    ++    I+++ + LDREK    + F     VIA D+G      + TV + + D NDN P F  A YN    E+   +G+      V +    D D G N  VT SI+      F ++P +G +      DRE Q S YTF + A DS    L + T+   V+I + D NDN P+F+ P+ SNY   L  +    GS+VT V AID D+G+N+++Q+ +       LF+I++T+G +     ++   +G   L +K  D G P 
Sbjct:  160 FRLVKIRFLIEDINDNAPLFQSTVINISIPENTAINNRY-PVPSAFDPDVGINGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSV-TQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGSATP---SRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDRDADLNGKVTCYT----DHDVPFRLKPVFNDQFL---LETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPDA----PDGF-NIDPRSGILSVSKRLDREKQ-EKYSFT----VIARDNGSNPLQSNVTVKLIVQDQNDNSPAFTHAEYNFYVPENLPLYGT------VGLITVTDADAGDNAIVTLSIINGKD-NFIIDPKTGVIKPNITFDREQQ-SSYTFVVKAVDSG---LIQTTSYAKVTINVVDVNDNRPVFVIPS-SNYSYDLVPFTTNPGSVVTRVFAIDNDTGMNAELQYSIIGGSPRGLFAIDKTTGNITLQEKIANADQGLHRLVVKVKDLGQPE 800          

HSP 2 Score: 82.8037 bits (203), Expect = 1.908e-15
Identity = 85/333 (25.53%), Postives = 154/333 (46.25%), Query Frame = 1
Query:  361 NNLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIE-NQDIGVVILTGVVKDNDSGMDGKFNCSIL--EPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKP 1350
            N   ++ I+I DENDN P + Q  I + + EN    +  +++  A D+D   N +  Y + P +   F    +S       L + + +DRE    ++ T++A D G+     ++ + + + D NDN P F  + Y   +  NL +  T+ L I  TD D   N     S+      +D F ++P   +++   +   E   S Y F + A+D G     S   VT+++ + N   P  ++P +N    ++    + G V+      DND+GM+ +   SI+   P+    +  ++KT + NI +   I N   D+ +    +L++  KD G+P
Sbjct:  487 NTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKI-TATDADSGSNALIIYSLGPDAPDGFNIDPRSG-----ILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPAFTHAEYNFYVPENLPLYGTVGL-ITVTDADAGDNAIVTLSI---INGKDNFIIDPKTGVIKPNITFDREQ-QSSYTFVVKAVDSGLIQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPFTTNPGSVVTRVFAIDNDTGMNAELQYSIIGGSPRG---LFAIDKT-TGNITLQEKIANA--DQGLH---RLVVKVKDLGQP 799          
BLAST of Protocadherin alpha-11 vs. Ensembl Sea Lamprey
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 199.519 bits (506), Expect = 1.726e-52
Identity = 197/710 (27.75%), Postives = 328/710 (46.20%), Query Frame = 1
Query:  286 DNLELCAYRNVNFSC---IWRGILFCGTNNL-KILEIQI--LDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPT-----SKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDI--NANVTYRF-----SLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSI----LLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAI-QSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIV-RETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIF-PNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCG 2340
            D   LC  ++    C   +  G+L        K++E++I   D NDN P ++   + + V EN      +   P A D D   N +  Y++ P+     S +    +E +N    P+L +R+ +DRE    + + L AVDGG+P  +GS  L I + D NDN P+F+ +     I  N  + + + +++HA+D D   NA V YR              +  F L+  + ++ V   L  E  +  YR  I A D G     +  TVT+ + + N   P+I    ++   N VI I E   + + +    V D D G +G   C I  P   ++   + K    N  ++   T +  D E K    + I   D G  + + +  ++I ++D NDN+P F +  Y  ++ E N     +  ++A D D   NA++ Y +  D        +  ++    II++ + LDREK  N       + ++A D G P   G+ TV + ++D+NDN P F  A ++    E+    K+S    V +A D D G NG V  SI+  +    F ++P SG + S    DRE Q   Y   + A D    +   +++TV V I + D NDN PI +  P+ + YK  +   +P G++VT V A+D D+ IN+++++ +     + LF I+   G +     L+  H G   L ++  D G
Sbjct:  103 DREALCGGQDPGDECHVDVQVGVLPVQPGPFFKLIEVRINVEDINDNAPAFAAPVLTVSVPENAPAGKRFPIQP-ANDPDSEANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHV-VQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREE-SPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIYISEASHVNLPVALITVSDPDIGANGAVTCYIYNP---EVPFQLKKLTYPNQYLLE--TRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMVYFLGPDAP-----TMFHMDPETGIISLTEQLDREKKAN-----YSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENV--PKHSTVGMVTVA-DSDEGENGRVRLSILGTDNRQLFSIDPESGMIRSNVGFDRE-QRHYYVLEVQATDGGEPV---RSSTVKVVIHVMDINDNSPIVLMPPSNTTYKFVVPRTLP-GTIVTEVSAVDNDAEINAELRYHIVGGNPHNLFHIDPVIGNITLMEPLTETHHGLHRLVVRVSDIG 786          

HSP 2 Score: 109.383 bits (272), Expect = 2.228e-24
Identity = 148/586 (25.26%), Postives = 261/586 (44.54%), Query Frame = 1
Query:  700 LQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSL--NVPFIVQDCFDLN----------PFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTK---SENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFE-KEFYHYT-----IFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPN---KLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQF-ILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEI 2382
            +++ I + D+NDN P F +   T S+  N        ++  A D D  AN   R+ L  + P  V   F+L+          P+   L V+KSL  E     Y  ++ A+D G P       + +++ + N   P  +       + I EN  +G  ++     D D+G + +    +             K      +N  ++++  N + +RE     ++II   D G      +A +++ + DVNDNSP  E ++          I E +  N  +A +T  D D G N  +   I      Y+P    +L K+    Q + +++ +   Y     +V   Q+ A D+G    S + +V+I+L+D NDN PVF +  Y +S  E+    K+   V+   A D D   N ++ Y +  +    F ++P +G +   + +DRE + + Y+F+I A+D    +L    ATV V+++  D NDN P F     + +   ++  VP  S V +V   D D G N +++  IL  + R  LFSI+  SG + ++       +    L ++A D G P  ++  ++ I +
Sbjct:  137 IEVRINVEDINDNAPAFAAPVLTVSVPENAPAGKRFPIQ-PANDPDSEANGVRRYELLPSDPATVS-AFELSVTETANGEKVPY---LVVRKSLDREE-RQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSP--VFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTV--NGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIYISEASHVNLPVALITVSDPDIGANGAVTCYI------YNPEVPFQLKKLTYPNQYL-LETRETLDYETKNEYVV--QIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLITVS---ATDRDMDKNAEMVYFLGPDAPTMFHMDPETGIISLTEQLDREKK-ANYSFTILAKDQGIPVL-EGNATVIVNVL--DVNDNRPRFSL---AEFDFYVNENVPKHSTVGMVTVADSDEGENGRVRLSILGTDNRQ-LFSIDPESGMIRSNVGFDREQRHYYVLEVQATDGGEPVRSSTVKVVIHV 692          
BLAST of Protocadherin alpha-11 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004042.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004042.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 192.2 bits (487), Expect = 1.632e-49
Identity = 182/691 (26.34%), Postives = 309/691 (44.72%), Query Frame = 1
Query:  355 GTNNLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGG-TPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPN--KLIKVESNC-QIIAIQSLDREKYPNGFRFVCPYQ--VIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVL---------SVIHKGEETLFIKAIDCGSPRLTAIQQLTIEI 2382
            GT  + +L   + DENDN+P++    +   V E+  + S  + L  A D+D   N I  Y++     +F ++           +     +DRE    + + + A+DGG TP  + S  L++ + DVND+ P F ++ Y      +    + +   + A D D   N   RFSL+        F ++P   ++   ++L+      +   ++   D G P   + TTVT+  ++   +P     PG  +     E+Q  G  I   VV    S   G  +  +    N   +  ++    E      +  ++  D E +   +L++  +D G P F+   ++ + ++D+NDN+P+F    + +    EN P  TI  LTA D D G+N Q+ Y      S+ D N   + +V  N  +I ++ +LDRE        V  Y+  V ATD G P +  +  V I + D NDN P F Q F +    ED        +V+     D D G N  +T+S++ +  LPF ++P++GE+     ++RE + S Y   + A D         T +  V+IV++D NDN P F    ++ Y I+        +LV  V A D D G N Q+ F +  +  N  F +   SGE+ +   L         S  +  + +  + A+D G P L++   +TI I
Sbjct:    8 GTGTVTVL---VEDENDNLPRFGAAELRAAVPEDAPIGS-DVALVNATDADAGLNAIISYRLRGGDGHFSVNPSTGQ------IITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAV-FAVTARDADAGPNGDLRFSLS--GSASAGFSVDPRRGVIHAARALQGP--RDDLTLTVRVSDGGAPPRSAVTTVTVRFRDAGEFP--RFAPGPRS-FSFREDQPPGTTIT--VVAARSSRRAGPVSYHLASGGNLGDVFAVDPQSGE------VSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRF-WAKVPENTPPRTIVVLTAVDKDSGINGQVDY------SIIDGNIGNVFRVNPNSGEIRSVSTLDREN-------VASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQIF-SAHVREDAAVGFPVLRVSTL---DADEGPNAAITFSLL-DPSLPFSIHPSTGEITVSRRLNREDR-SGYAVKVRASDP------AWTVSTDVTIVVDDVNDNAPRF---GQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTEN--FRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINI 641          

HSP 2 Score: 144.436 bits (363), Expect = 7.339e-35
Identity = 169/684 (24.71%), Postives = 293/684 (42.84%), Query Frame = 1
Query:  367 LKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNN-ISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPF----IVQDCFDLNPFNAILRVKKSLKHECFAS--EYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSIL---EPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWD--TSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEI 2382
            +K+L I + DENDN P+++Q  I    V       F +      D+DE PN  I++  ++P+  +    S          + + R ++RE  S + V + A D   P+ T S  + I + DVNDN P F  + Y        E    L  ++ A+D D  AN    F +        + +D  +++     LR +        A+  +Y F + A+D GRP   S  TVT+++   N   P  L         +      G  IL     D D  ++G+   S++     + +D+         +    + L  +   D    +   + +  +D G+P  ++ A   I + + N  +P+F       ++ E +    ++A++TA D D G+N  + Y I     + L+D   + +   +  ++     + EK  N         V A D G   ++  + VSI + D+NDN P+   + Y     E+  S      V V  A D D   N    YS+       F LN  +G L +   +D ET+   Y  ++ A + P    Y   +T  V + I   N+  P F+   +  Y   +S   PVG+ V  V A D+D+GI+  + ++L  E R+  FS+NE +GE++ S+ L    +   TL + A + GS R   + ++ + +
Sbjct:  424 VKVL-ISVTDENDNSPRFTQ--IFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLDPSLPFSIHPSTGE-------ITVSRRLNREDRSGYAVKVRASD---PAWTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSE-GEALVARVSASDADDGANGQVFFFMRSQTENFRVGRDSGEIHSVRP-LRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLR--ERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNASRRFDV---------DAGGFLHLRASLAGD--AGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFD---ISRASGDVLLVGELDYETEKLYN-------LSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTT---VLVMDAVDADSPSNAVTMYSLDDGEADLFVLNQKTGVLTTQGFLDYETK-QTYELTVRAFNYPDTFHY---STAQVHVQITGVNEYFPRFV---QREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNV 1059          

HSP 3 Score: 141.354 bits (355), Expect = 5.657e-34
Identity = 147/603 (24.38%), Postives = 263/603 (43.62%), Query Frame = 1
Query:  604 LKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNG---------FRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARD-SPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEI 2382
            + + R +D E    + + + A D G P  +  L+L + ++D+NDN P F SS +   +  N    + + L     D  IN  V Y     +   + + F +NP +  +R   +L  E  AS Y  ++ A D G P +     V + + ++N   P            + E+  +G  +L     D D G +     S+L+P    +  +++ +  E      +  ++  +RE ++   + +   D   PA+  S +++I++ DVNDN+P+F +  Y+    E ++    +A+++A D DDG N Q+ + ++  T     N  +  +S  +I +++ L R + P G         + FV    V A D G P  S   TV+I ++  N N P F +  Y+        + +   ++    A DPD  VNG + YS+V       + + ++G              S ++ ++ ARD     L  R TA +SV+    + N   P F  P     ++ L    P GS +  V A D D+G+N  I + +     + LF I+  SG++L    L    +    L + A D G    T    ++I +
Sbjct:  288 VSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVVLTAVDKDSGINGQVDYSI---IDGNIGNVFRVNPNSGEIRSVSTLDRENVAS-YELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFT---QIFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLDPS---LPFSIHPSTGE------ITVSRRLNREDRSGYAVKVRASD---PAWTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTE----NFRVGRDSG-EIHSVRPL-RYRDPAGGGSGANLNKYSFV----VTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVA---ATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNAS-RRFDVDAGGFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVT----EENQYAPRFAHP---PLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISV 850          

HSP 4 Score: 112.079 bits (279), Expect = 5.595e-25
Identity = 124/477 (26.00%), Postives = 201/477 (42.14%), Query Frame = 1
Query: 1000 GRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIR--IIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGK-PAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSL---YDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLED--------FGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDS--PTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEI 2382
            G P      TVT+ ++++N   P        A +R  + E+  IG  +      D D+G++   +  +   +  D   ++N +  +      +IT    DRE +    L +   D G  P  ++SA + + + DVND++P+F    Y             +  +TA D D G N  LR+ +    S     DP + +       I A ++L       G R      V  +D G P RS  TTV++   D  +  P F     + SF ED          + ++SR+      H    G  GDV           F ++P SGE+  +  +D E Q   Y   + ARDS  P    Y K     + + + D NDN P F   + S +  ++    P  ++V L  A+DKDSGIN Q+ + + +     +F +N  SGE+ + + L   +     L +KA D GSP     Q  T+++
Sbjct:    2 GEPRLTGTGTVTVLVEDENDNLPRF----GAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRL---RGGDGHFSVNPSTGQ------IITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAGFSVDPRRGV-------IHAARAL------QGPRDDLTLTVRVSDGGAPPRSAVTTVTVRFRDAGE-FPRFAPGPRSFSFREDQPPGTTITVVAARSSRRAGPVSYHLASGGNLGDV-----------FAVDPQSGEVSVHRALDHEYQ-HHYELVVEARDSGFPPFSAYLK-----LEVDVLDINDNAPEF---SSSRFWAKVPENTPPRTIVVLT-AVDKDSGINGQVDYSIIDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSP----TQHCTVKV 426          

HSP 5 Score: 110.153 bits (274), Expect = 1.938e-24
Identity = 148/614 (24.10%), Postives = 259/614 (42.18%), Query Frame = 1
Query:  382 IQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPT--SKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTK--SENIAIISLITNKIFDREVKTRIQLIIFCKDFGK-PAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQ-LRYRIQWDTSLYDPNKLIKVESNCQIIAIQS-LDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVN-GDVTYSIVRETLL---PFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNES-NYKIQLSYLVP--VGSLVTLVKAIDKD 2181
            I + +EN   P+++   + + + EN    S    +  A D+D   N    Y I     S  F IS    +      + L   +D E    +N+++ A DGG  +KT    + I + DVNDN P+  +S Y   I  N    +T+ L + A D D  +N    +SL+      D F LN    +L  +  L +E     Y  ++ A ++      S   V + +   N Y P  +    N V+   E+  +G  + +    D D+G+DG           + ++   +++K  S N     +I +   DRE +    L +  K+ G    F+    +  + I   ++ P F    YH  + E       +  ++AHD D     +   + IQ   +     +   + ++  +I + S LDRE  P     +    V+A D GEP  +G+T V + L D+NDN P    +   ++  +  G       V    A DPD   N G  T+ ++         F L+ +SG L +   +DRE +P ++   +   D+ +  L   T+TV++ + + D NDN      P+E+ + ++ ++Y      G  +  V+  D D
Sbjct:  743 ISVTEENQYAPRFAHPPLELSLPENHPAGSSLARV-TATDTDAGVNGAIVYSIASGDGSGLFDISRASGD------VLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTV-LVMDAVDADSPSNAVTMYSLD--DGEADLFVLNQKTGVLTTQGFLDYET-KQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVS--ESAPVGAPVGSVFATDRDAGIDGTV---------FYMLFGESRSKGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDANDPPVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNA----GRAFSINAHTGLIVVASPLDRESVP-----LYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPFLLTSSAKVTENQPAG-----MTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSLS-SSGLLKTARPIDREQKP-EFHLPVAIADAGSPPL---TSTVTLHLSVLDQNDN------PSEARDVRVHVNYFGSPFPGGFIGDVRPRDPD 1309          

HSP 6 Score: 91.6633 bits (226), Expect = 8.838e-19
Identity = 160/686 (23.32%), Postives = 278/686 (40.52%), Query Frame = 1
Query:  376 LEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKI--EPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSE----NIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKV-ESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQR--SGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETL---LPFKLNPNSGELYSYDLVDRETQPSQYTFSITARD--SPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINS---QIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEI 2382
            + I I+  N N P++ +      V    +  +  L++  A D D   N    Y +     S+ F + +         FL LR  +  +  S  +VT+ A D G P  +     +I + + N   P F       S+  N    S+L  ++ ATD D   N    +S+         FD++  +  + +   L +E     Y  S+ A D G   +   + V++ + + N  PP  +L  ++    I EN   G  +L     D DS            P N   + +++  +++    N     L T    D E K   +L +   ++      ++A++ + I  VN+  P+F +  Y++ + E       +  + A D D G++  + Y +  ++     +K   V E   +II    LDRE+  +        +VIA ++G  +        V++ + D ND  PVF  A Y+    E   +      V    AHD D    G  T+S + ++      F +N ++G +     +DRE+ P  Y  ++ A D   P       T T  V + +ED NDN P  +    S+ K+  +   P G  V  ++A D D   N      Q +  +      FS++ +SG L T+  +    K E  L +   D GSP LT+   L + +
Sbjct:  637 VTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDM-SAVDPDRDVNGQIAYSVVGGNASRRFDVDAGG-------FLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSL-ARVTATDTDAGVNGAIVYSI-ASGDGSGLFDISRASGDVLLVGELDYET-EKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPP--MLNASDYYPVIPENAPSGTTVLVMDAVDADS------------PSNAVTMYSLDDGEADLFVLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESR----SKGFSVNEHTGEIIVSSQLDREREASAT-----LRVIAKNAGSIRGFDVDEVLVNVAITDANDP-PVFSSALYHGRVSE---AASVGTHVVGVSAHDFD-SPPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVP-LYNLTVVAVDMGEPP-----ATGTTVVVVALEDVNDNGPFLL---TSSAKVTENQ--PAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSLS-SSGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSV 1271          

HSP 7 Score: 89.3521 bits (220), Expect = 4.393e-18
Identity = 72/244 (29.51%), Postives = 124/244 (50.82%), Query Frame = 1
Query: 1678 SGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLED--FGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARD-SPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTI---EIGEF 2391
            +GEP+ +G+ TV++ + D NDN+P F  A    +  ED   GS      VA+  A D D G+N  ++Y + R     F +NP++G++ +   +DRE + S Y   +TA D  PT  L   +++ ++ + + D ND+ P F+    + Y        P G+ V  V A D D+G N  ++F L     +  FS++   G +  +  L    + + TL ++  D G+P  +A+  +T+   + GEF
Sbjct:    1 AGEPRLTGTGTVTVLVEDENDNLPRFGAAELRAAVPEDAPIGS-----DVALVNATDADAGLNAIISYRL-RGGDGHFSVNPSTGQIITTASLDREGRES-YVLEVTALDGGPTPGL---SSSATLVVAVTDVNDHTPRFL---NAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSA-SAGFSVDPRRGVIHAARALQG-PRDDLTLTVRVSDGGAPPRSAVTTVTVRFRDAGEF 229          

HSP 8 Score: 51.6026 bits (122), Expect = 1.418e-6
Identity = 82/391 (20.97%), Postives = 149/391 (38.11%), Query Frame = 1
Query:  376 LEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKI--EPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLI--KIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYR-FSLNVPFIVQD-----CFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIF------DREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLD 1500
            + +QI   N+  P++ Q      V E+  + +    +  A D D   +   +Y +  E  SK F ++           + +   +DRE  +   + ++A + G+       ++L+   I D ND  P+F S+ Y   +     + + + + + A D D  +   +R FS    F++Q       F +N    ++ V   L  E     Y  ++ A+D G P     T V + L++ N   P +L     +  ++ ENQ  G+ +L     D D           L P        +  +        SL ++ +       DRE K    L +   D G P   ++  + + ++D NDN  +      H   F    P   I  +   D D
Sbjct:  950 VHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSV-FATDRDAGIDGTVFYMLFGESRSKGFSVNEHTGE------IIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDAND-PPVFSSALYHGRVSEAASVGTHV-VGVSAHDFD--SPPGWRTFS----FLIQSGNAGRAFSINAHTGLIVVASPLDRESV-PLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPFLL----TSSAKVTENQPAGMTVLNLEAGDPD-----------LPPNKGPYTFQLLGSDPAWRGYFSLSSSGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQNDNPSEARDVRVHVNYFGSPFPGGFIGDVRPRDPD 1309          
BLAST of Protocadherin alpha-11 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004043.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004043.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 191.815 bits (486), Expect = 1.930e-49
Identity = 182/691 (26.34%), Postives = 309/691 (44.72%), Query Frame = 1
Query:  355 GTNNLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGG-TPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPN--KLIKVESNC-QIIAIQSLDREKYPNGFRFVCPYQ--VIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVL---------SVIHKGEETLFIKAIDCGSPRLTAIQQLTIEI 2382
            GT  + +L   + DENDN+P++    +   V E+  + S  + L  A D+D   N I  Y++     +F ++           +     +DRE    + + + A+DGG TP  + S  L++ + DVND+ P F ++ Y      +    + +   + A D D   N   RFSL+        F ++P   ++   ++L+      +   ++   D G P   + TTVT+  ++   +P     PG  +     E+Q  G  I   VV    S   G  +  +    N   +  ++    E      +  ++  D E +   +L++  +D G P F+   ++ + ++D+NDN+P+F    + +    EN P  TI  LTA D D G+N Q+ Y      S+ D N   + +V  N  +I ++ +LDRE        V  Y+  V ATD G P +  +  V I + D NDN P F Q F +    ED        +V+     D D G N  +T+S++ +  LPF ++P++GE+     ++RE + S Y   + A D         T +  V+IV++D NDN P F    ++ Y I+        +LV  V A D D G N Q+ F +  +  N  F +   SGE+ +   L         S  +  + +  + A+D G P L++   +TI I
Sbjct:    8 GTGTVTVL---VEDENDNLPRFGAAELRAAVPEDAPIGS-DVALVNATDADAGLNAIISYRLRGGDGHFSVNPSTGQ------IITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAV-FAVTARDADAGPNGDLRFSLS--GSASAGFSVDPRRGVIHAARALQGP--RDDLTLTVRVSDGGAPPRSAVTTVTVRFRDAGEFP--RFAPGPRS-FSFREDQPPGTTIT--VVAARSSRRAGPVSYHLASGGNLGDVFAVDPQSGE------VSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRF-WAKVPENTPPRTIVVLTAVDKDSGINGQVDY------SIIDGNIGNVFRVNPNSGEIRSVSTLDREN-------VASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQIF-SAHVREDAAVGFPVLRVSTL---DADEGPNAAITFSLL-DPSLPFSIHPSTGEITVSRRLNREDR-SGYAVKVRASDP------AWTVSTDVTIVVDDVNDNAPRF---GQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTEN--FRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINI 641          

HSP 2 Score: 144.05 bits (362), Expect = 9.522e-35
Identity = 169/684 (24.71%), Postives = 293/684 (42.84%), Query Frame = 1
Query:  367 LKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNN-ISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPF----IVQDCFDLNPFNAILRVKKSLKHECFAS--EYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSIL---EPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWD--TSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEI 2382
            +K+L I + DENDN P+++Q  I    V       F +      D+DE PN  I++  ++P+  +    S          + + R ++RE  S + V + A D   P+ T S  + I + DVNDN P F  + Y        E    L  ++ A+D D  AN    F +        + +D  +++     LR +        A+  +Y F + A+D GRP   S  TVT+++   N   P  L         +      G  IL     D D  ++G+   S++     + +D+         +    + L  +   D    +   + +  +D G+P  ++ A   I + + N  +P+F       ++ E +    ++A++TA D D G+N  + Y I     + L+D   + +   +  ++     + EK  N         V A D G   ++  + VSI + D+NDN P+   + Y     E+  S      V V  A D D   N    YS+       F LN  +G L +   +D ET+   Y  ++ A + P    Y   +T  V + I   N+  P F+   +  Y   +S   PVG+ V  V A D+D+GI+  + ++L  E R+  FS+NE +GE++ S+ L    +   TL + A + GS R   + ++ + +
Sbjct:  424 VKVL-ISVTDENDNSPRFTQ--IFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLDPSLPFSIHPSTGE-------ITVSRRLNREDRSGYAVKVRASD---PAWTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSE-GEALVARVSASDADDGANGQVFFFMRSQTENFRVGRDSGEIHSVRP-LRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLR--ERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNASRRFDV---------DAGGFLHLRASLAGD--AGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFD---ISRASGDVLLVGELDYETEKLYN-------LSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTT---VLVMDAVDADSPSNAVTMYSLDDGEADLFVLNQKTGVLTTQGFLDYETK-QTYELTVRAFNYPDTFHY---STAQVHVQITGVNEYFPRFV---QREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNV 1059          

HSP 3 Score: 141.354 bits (355), Expect = 6.916e-34
Identity = 140/566 (24.73%), Postives = 251/566 (44.35%), Query Frame = 1
Query:  604 LKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNG---------FRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARD-SPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELL 2271
            + + R +D E    + + + A D G P  +  L+L + ++D+NDN P F SS +   +  N    + + L     D  IN  V Y     +   + + F +NP +  +R   +L  E  AS Y  ++ A D G P +     V + + ++N   P            + E+  +G  +L     D D G +     S+L+P    +  +++ +  E      +  ++  +RE ++   + +   D   PA+  S +++I++ DVNDN+P+F +  Y+    E ++    +A+++A D DDG N Q+ + ++  T     N  +  +S  +I +++ L R + P G         + FV    V A D G P  S   TV+I ++  N N P F +  Y+        + +   ++    A DPD  VNG + YS+V       + + ++G              S ++ ++ ARD     L  R TA +SV+    + N   P F  P     ++ L    P GS +  V A D D+G+N  I + +     + LF I+  SG++L
Sbjct:  288 VSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVVLTAVDKDSGINGQVDYSI---IDGNIGNVFRVNPNSGEIRSVSTLDRENVAS-YELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFT---QIFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLDPS---LPFSIHPSTGE------ITVSRRLNREDRSGYAVKVRASD---PAWTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTE----NFRVGRDSG-EIHSVRPL-RYRDPAGGGSGANLNKYSFV----VTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVA---ATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNAS-RRFDVDAGGFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVT----EENQYAPRFAHP---PLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDISRASGDVL 813          

HSP 4 Score: 112.079 bits (279), Expect = 6.027e-25
Identity = 124/477 (26.00%), Postives = 201/477 (42.14%), Query Frame = 1
Query: 1000 GRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIR--IIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGK-PAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSL---YDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLED--------FGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDS--PTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEI 2382
            G P      TVT+ ++++N   P        A +R  + E+  IG  +      D D+G++   +  +   +  D   ++N +  +      +IT    DRE +    L +   D G  P  ++SA + + + DVND++P+F    Y             +  +TA D D G N  LR+ +    S     DP + +       I A ++L       G R      V  +D G P RS  TTV++   D  +  P F     + SF ED          + ++SR+      H    G  GDV           F ++P SGE+  +  +D E Q   Y   + ARDS  P    Y K     + + + D NDN P F   + S +  ++    P  ++V L  A+DKDSGIN Q+ + + +     +F +N  SGE+ + + L   +     L +KA D GSP     Q  T+++
Sbjct:    2 GEPRLTGTGTVTVLVEDENDNLPRF----GAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRL---RGGDGHFSVNPSTGQ------IITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAGFSVDPRRGV-------IHAARAL------QGPRDDLTLTVRVSDGGAPPRSAVTTVTVRFRDAGE-FPRFAPGPRSFSFREDQPPGTTITVVAARSSRRAGPVSYHLASGGNLGDV-----------FAVDPQSGEVSVHRALDHEYQ-HHYELVVEARDSGFPPFSAYLK-----LEVDVLDINDNAPEF---SSSRFWAKVPENTPPRTIVVLT-AVDKDSGINGQVDYSIIDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSP----TQHCTVKV 426          

HSP 5 Score: 110.153 bits (274), Expect = 2.214e-24
Identity = 144/596 (24.16%), Postives = 253/596 (42.45%), Query Frame = 1
Query:  382 IQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPT--SKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTK--SENIAIISLITNKIFDREVKTRIQLIIFCKDFGK-PAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQ-LRYRIQWDTSLYDPNKLIKVESNCQIIAIQS-LDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVN-GDVTYSIVRETLL---PFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNES-NYKIQLSYL 2133
            I + +EN   P+++   + + + EN    S    +  A D+D   N    Y I     S  F IS    +      + L   +D E    +N+++ A DGG  +KT    + I + DVNDN P+  +S Y   I  N    +T+ L + A D D  +N    +SL+      D F LN    +L  +  L +E     Y  ++ A ++      S   V + +   N Y P  +    N V+   E+  +G  + +    D D+G+DG           + ++   +++K  S N     +I +   DRE +    L +  K+ G    F+    +  + I   ++ P F    YH  + E       +  ++AHD D     +   + IQ   +     +   + ++  +I + S LDRE  P     +    V+A D GEP  +G+T V + L D+NDN P    +   ++  +  G       V    A DPD   N G  T+ ++         F L+ +SG L +   +DRE +P ++   +   D+ +  L   T+TV++ + + D NDN      P+E+ + ++ ++Y 
Sbjct:  743 ISVTEENQYAPRFAHPPLELSLPENHPAGSSLARV-TATDTDAGVNGAIVYSIASGDGSGLFDISRASGD------VLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTV-LVMDAVDADSPSNAVTMYSLD--DGEADLFVLNQKTGVLTTQGFLDYET-KQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVS--ESAPVGAPVGSVFATDRDAGIDGTV---------FYMLFGESRSKGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDANDPPVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNA----GRAFSINAHTGLIVVASPLDRESVP-----LYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPFLLTSSAKVTENQPAG-----MTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSLS-SSGLLKTARPIDREQKP-EFHLPVAIADAGSPPL---TSTVTLHLSVLDQNDN------PSEARDVRVHVNYF 1291          

HSP 6 Score: 91.6633 bits (226), Expect = 9.933e-19
Identity = 160/686 (23.32%), Postives = 278/686 (40.52%), Query Frame = 1
Query:  376 LEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKI--EPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSE----NIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKV-ESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQR--SGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETL---LPFKLNPNSGELYSYDLVDRETQPSQYTFSITARD--SPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINS---QIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEI 2382
            + I I+  N N P++ +      V    +  +  L++  A D D   N    Y +     S+ F + +         FL LR  +  +  S  +VT+ A D G P  +     +I + + N   P F       S+  N    S+L  ++ ATD D   N    +S+         FD++  +  + +   L +E     Y  S+ A D G   +   + V++ + + N  PP  +L  ++    I EN   G  +L     D DS            P N   + +++  +++    N     L T    D E K   +L +   ++      ++A++ + I  VN+  P+F +  Y++ + E       +  + A D D G++  + Y +  ++     +K   V E   +II    LDRE+  +        +VIA ++G  +        V++ + D ND  PVF  A Y+    E   +      V    AHD D    G  T+S + ++      F +N ++G +     +DRE+ P  Y  ++ A D   P       T T  V + +ED NDN P  +    S+ K+  +   P G  V  ++A D D   N      Q +  +      FS++ +SG L T+  +    K E  L +   D GSP LT+   L + +
Sbjct:  637 VTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDM-SAVDPDRDVNGQIAYSVVGGNASRRFDVDAGG-------FLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSL-ARVTATDTDAGVNGAIVYSI-ASGDGSGLFDISRASGDVLLVGELDYET-EKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPP--MLNASDYYPVIPENAPSGTTVLVMDAVDADS------------PSNAVTMYSLDDGEADLFVLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESR----SKGFSVNEHTGEIIVSSQLDREREASAT-----LRVIAKNAGSIRGFDVDEVLVNVAITDANDP-PVFSSALYHGRVSE---AASVGTHVVGVSAHDFD-SPPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVP-LYNLTVVAVDMGEPP-----ATGTTVVVVALEDVNDNGPFLL---TSSAKVTENQ--PAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSLS-SSGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSV 1271          

HSP 7 Score: 89.3521 bits (220), Expect = 4.855e-18
Identity = 72/244 (29.51%), Postives = 124/244 (50.82%), Query Frame = 1
Query: 1678 SGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLED--FGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARD-SPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTI---EIGEF 2391
            +GEP+ +G+ TV++ + D NDN+P F  A    +  ED   GS      VA+  A D D G+N  ++Y + R     F +NP++G++ +   +DRE + S Y   +TA D  PT  L   +++ ++ + + D ND+ P F+    + Y        P G+ V  V A D D+G N  ++F L     +  FS++   G +  +  L    + + TL ++  D G+P  +A+  +T+   + GEF
Sbjct:    1 AGEPRLTGTGTVTVLVEDENDNLPRFGAAELRAAVPEDAPIGS-----DVALVNATDADAGLNAIISYRL-RGGDGHFSVNPSTGQIITTASLDREGRES-YVLEVTALDGGPTPGL---SSSATLVVAVTDVNDHTPRFL---NAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSA-SAGFSVDPRRGVIHAARALQG-PRDDLTLTVRVSDGGAPPRSAVTTVTVRFRDAGEF 229          

HSP 8 Score: 51.6026 bits (122), Expect = 1.441e-6
Identity = 82/391 (20.97%), Postives = 149/391 (38.11%), Query Frame = 1
Query:  376 LEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKI--EPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLI--KIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYR-FSLNVPFIVQD-----CFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIF------DREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLD 1500
            + +QI   N+  P++ Q      V E+  + +    +  A D D   +   +Y +  E  SK F ++           + +   +DRE  +   + ++A + G+       ++L+   I D ND  P+F S+ Y   +     + + + + + A D D  +   +R FS    F++Q       F +N    ++ V   L  E     Y  ++ A+D G P     T V + L++ N   P +L     +  ++ ENQ  G+ +L     D D           L P        +  +        SL ++ +       DRE K    L +   D G P   ++  + + ++D NDN  +      H   F    P   I  +   D D
Sbjct:  950 VHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSV-FATDRDAGIDGTVFYMLFGESRSKGFSVNEHTGE------IIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDAND-PPVFSSALYHGRVSEAASVGTHV-VGVSAHDFD--SPPGWRTFS----FLIQSGNAGRAFSINAHTGLIVVASPLDRESV-PLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPFLL----TSSAKVTENQPAGMTVLNLEAGDPD-----------LPPNKGPYTFQLLGSDPAWRGYFSLSSSGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQNDNPSEARDVRVHVNYFGSPFPGGFIGDVRPRDPD 1309          
BLAST of Protocadherin alpha-11 vs. Ensembl Sea Lamprey
Match: si:ch211-199f5.1 (protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660])

HSP 1 Score: 181.03 bits (458), Expect = 8.135e-47
Identity = 170/683 (24.89%), Postives = 308/683 (45.10%), Query Frame = 1
Query:  127 IFENLPVGSVICKLSNVIIPRPSD--TTKFKLIKNRFF---QIENGDN-LKVSGLIDRDDNLELCAYRNVNFSCIWRGILFC----GTNNLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEIN-----STLDLKIHATDLD--INANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSI----LLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYR-IQWDTSLYDPNKLIKVE-SNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPV-----FQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVR--ETLLPFKLNPNSGELY--SYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNE 2079
            ++E  P G+++ +LS+ +  R ++  +  F+L++   F    +E  D  +    +IDR+   + C       SC+ R  + C    G   L   E+++LD ND+ P ++++ + +E+ E+  L +  + L  ARD D   N +  Y ++   ++      +++      L ++  +DRE    + + L A DGG P ++G+  + I ++D NDN P+F  +       CN+ +       T+ L ++ATD+D   N  V Y FS  V   V+  F L+P    L +K  L HE   SEY  SI A D G     +   V +H+++ N   P I    ++      + + E       +    V D DS  +G   C +    ++ ++   +           ++TN   DRE      L++   D G P    + + ++ ++D NDN P+F +  Y  ++ E N P   +  +TA D D   N  + Y  ++ + +    +  + +  S+  I A++ LD E   +       +QV A D G P    + TVS+ ++D NDN PV      +     +    D G       V V  A D D   NG+++Y IV+  E  L F++N   GE++  +  + D     ++++  +  RD  +  L   +AT ++ I +    D +
Sbjct:   35 LYEEQPAGTLVGRLSDDLQGRVAEHPSRHFRLMRRDDFSLVHVEEADGTVSAREVIDRE---QQCGQAP---SCVIRFDVLCTLPRGLFQLVHAEVELLDINDHAPDFARSEMHVEISESVALGT-RVPLEGARDLDVGGNALRAYHLDENERFGLALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQT------SCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHE-LNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHLRGHPHFKLLPYRDD--------YVVVTNSSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTS-----LTFQVQARDDGVPPLVTNATVSVRIVDENDNAPVVTHPPLRNGTGVVRLPRDAGL---GYLVTVVRARDSDSEANGELSYRIVQGNERNL-FRINRLGGEVFTNAASVTDAAASATRHSLVVMVRDRGSPAL---SATAAIEIRVGAHGDGD 683          

HSP 2 Score: 154.836 bits (390), Expect = 1.452e-38
Identity = 166/642 (25.86%), Postives = 275/642 (42.83%), Query Frame = 1
Query:  694 GSLQLL---IKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLN----VPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDI--ILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHY----TIFEENQPNFT--IAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLP------FKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYK--IQLSYLVPVGSLVTLVKAIDKDSGINSQIQF-ILEEEKRNILFSINETSGELLT---STVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGEFRNPDSTPFNETE---ESFLSDQATFIIVGIILGTFFICCGLVTGICTMA 2529
            G  QL+   ++++D+ND+ P F  S     I  ++ + + + L+  A DLD+  N    + L+        ++   D   + A L VK  L  E    EY   + A D G P     T V + + + N   P       N  +R  E+   G V+LT    D D G +G+   S   P + ++  +  ++    +      L      D E+ +  ++ I  +D G  +     ++ + + D+NDN+P+ + +F       T+F      +   +  +T  D+D   N  +   ++         KL+    +  ++   SLDRE+  + F  +      A+D G P R  +   ++ L+D NDN P F ++ Y  S LE+         V    A D D   NG + Y++V   +          +NP+SG +Y+   +D E   S  TF + ARD     L    ATVSV IV  D NDN P+   P   N    ++L     +G LVT+V+A D DS  N ++ + I++  +RN LF IN   GE+ T   S   +       +L +   D GSP L+A   + I +G   + D    +ET+    S L+  A      + L    +     +G C  A
Sbjct:  115 GLFQLVHAEVELLDINDHAPDFARSEMHVEISESVALGTRVPLE-GARDLDVGGNALRAYHLDENERFGLALRARTDGAKY-AELVVKSRLDRE-QEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVR--EDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGK------LSLKGQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHLRGHPHF----KLLPYRDDYVVVTNSSLDREQMADYFLVL-----EASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLEN---NSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTS-LTFQVQARDDGVPPLV-TNATVSVRIV--DENDNAPVVTHPPLRNGTGVVRLPRDAGLGYLVTVVRARDSDSEANGELSYRIVQGNERN-LFRINRLGGEVFTNAASVTDAAASATRHSLVVMVRDRGSPALSATAAIEIRVGAHGDGDDGA-DETQPLDASMLAVMALGAACALTLAAVVLVASTKSGSCGAA 727          
BLAST of Protocadherin alpha-11 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006996.1 (pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 gene:ENSPMAG00000006222.1 transcript:ENSPMAT00000006996.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 181.8 bits (460), Expect = 2.839e-46
Identity = 190/682 (27.86%), Postives = 316/682 (46.33%), Query Frame = 1
Query:  262 VSGLIDRDDNLELCAYRNVNFSCIWRGILFCGTNNLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKY--FFISSEKSNKGIKPFLKLRRGIDRELISWHNV--TLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSK--TTVTLHLKNQNLYPPSIL-LPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKN--YDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPA--FNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQ--VIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETL-LPFKLNPNSGELYSYDLVDRETQPSQYTFSITARD-SPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSG 2262
             SGLI     L+  A      + + R     G      + I +LD NDN P + ++S V    EN    +  + + +A D D  PNN   Y I PTS Y  +F  +     G+   + L R +D E I    +  T++A+DGG+P    ++  ++++ D NDN PIF+ + Y+ +I  N+   +T+ L ++ATD D +     + SL         F +N  +  +     L  E   S+Y   + A+D G   ++     TV + L + N   P+   LP     + I+EN   G  I T    D D   +G    +I +P N  Y I     K ++  + +     N I    +++   +++   D G P      SA +++++ DVNDN P F    Y   + E    N T+ Q+TA D D+G N  + Y +    +L  P+  +   +      +Q LDRE        V  YQ  ++ATD G P  S +TT+S+ ++D+NDN P F  A   +S +E   S      V      D D G+N ++++ I        F +    G + +   +DRET+ S Y+  I A D  P     R+T T ++ +++ D NDN P+F+   E +Y++ +   V  G+++  V+A D D GIN ++ + +    ++  F +N +SG
Sbjct:   81 ASGLISVAAALDFEATPRFTVTVMARD--GGGQETAGRVRINLLDVNDNTPVFQRDSYVGTARENDNSLTPVVRV-RATDEDSPPNNQITYSILPTSAYSSYFSITVSGGYGV---VTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFDRNSYSIAIPENILAGATV-LYVNATDGDQSPEYG-QLSLIYSLEGSTQFRINARSGDITSTTLLDREAV-SQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLP---YAVTIVENTPGGTDIFTVSAADPDLNENGTLVYAI-DPPNPFYRINAASGKIRTTGLQLDREDLNPISFASMRS---IVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTYSMT--AALPRPDFQLDAATGLITTLVQ-LDREA-------VAAYQLRLVATDRGTPALSSTTTLSLVVLDVNDNAPTFHPARSAVSLME---SVARDSVVISLNCTDADSGLNAELSFFITGGNQDGQFSVGFRDGLVRTVVSLDRETKAS-YSLVIEAIDNGPAG--SRRTGTTTLDVLVLDVNDNRPLFL---EGSYEVSVPENVTRGAIILQVQATDIDEGINGRVWYRIISGNQDGNFLVNVSSG 727          

HSP 2 Score: 157.918 bits (398), Expect = 5.180e-39
Identity = 184/702 (26.21%), Postives = 308/702 (43.87%), Query Frame = 1
Query:  373 ILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPK---ARDSDEHPN-NISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNV--TLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINA--NVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKI-----FDREVKTRIQLIIFCKDFG----------KPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYT-IFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNK---LIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVF-QQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSG--ELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAI--DCGSPRLTAIQQLTIEI 2382
            I+ + ILDENDN P +SQ +   E+ EN+   +    L     A D+D   N  ++Y  +  +S YF I  ++ N      + L +G+DRE I    +  T+L  DGG   +  +++L + ++DVNDN P F  +  T  +  N     T  + + A D D+      T R+S+       D F ++    ++     + +E    EY   + A D   P   +   + + L+N+     S  L    A +   E    G V++        +        +IL  K ++      + +S+N  +I+ +  +I      DRE      L +  +D G          KP     A + + + D NDNSP+FE        + E   P   +  L A D D G N  +  R    T    P +   +I+ ES   I+ +   D  +  + F     ++++A D G P RS +  +S+ ++D+NDN+P+F     Y +S +E  G+      VA   A D D G NG VT+ I         + P+ G   +     +DRET+ + YT  + A D     L   + +  V ++++D ND  P F+ P ++   + +   + VGS V  VKA +   G N++  + +    +N  F+++ TSG L+TST L    K  E   + A+  D G P L     L +E+
Sbjct: 1485 IMIVTILDENDNSPVFSQVTYEAEIPENSPNGTVLTVLNGPIYASDADFGVNATLAYSLLGGSSAYFLIDRDRGNVS----MALGQGLDREGIPGGRLELTILVQDGG--RRNATVRLGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGG--NDTFGIDESTGLIVTVAPIDYET-RPEYLLMVVATDQAPPFHTASCELRVSLQNELDEKLSFSLAAYQAALS--EAAVPGTVVVRVAAPQMKAPPKLPLPLAILVQKWHED-KRHKQQESDNAELIAALQGEITTQAALDREATDSYMLTVLSRDGGPREAIAVLTNKPG----AYVYVNVTDENDNSPEFEAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNESGVTIVDVAKADFVEKTSQFIL---FRIVALDGGSPPRSTTFNLSVIVLDVNDNVPIFLSPGGYAVSVVE-LGAPGT--LVASVWATDADAGPNGQVTFRIESGGGDKLSIGPSDGIIRVAPGANIDRETR-AAYTLMVVAVDRGNPPL---SGSAIVRVLVDDVNDERPAFLAPVQT---VSVLESLSVGSFVATVKATENYKGHNTKYTYKIAGIGKNA-FTVHATSG-LVTSTRL---LKSYERFNLTAVATDHGRPPLWGQAGLYVEV 2152          

HSP 3 Score: 154.451 bits (389), Expect = 5.917e-38
Identity = 180/667 (26.99%), Postives = 291/667 (43.63%), Query Frame = 1
Query:  376 LEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHP-NNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDI--NANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECF-ASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIIS--LITNKIFDREVKTRIQLIIFCKDFGKPAFNTS--AEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKY-PNGFRFVCPYQVIATDSGEPQR--SGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLP-FKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCG 2340
            + I +++ENDN P +S     + V EN  L +  +++  A D D      +SY+  + + K+    +          + +   +D E      VT++A DGG     G ++  I ++DVNDN P+F+   Y  +   N + + T  +++ ATD D   N  +TY       +       ++    ++ + ++L +E         +I ALD G P   S  T  + + ++N   P  +   N+  I I EN   G  +L     D D            E     +I ++  +    I   S  + +  + DRE  ++  LI+   D G      +  A ++I ++DVNDN P +    Y  TI E       I  ++A D D   N  L Y I      Y   ++       +   +Q LDRE   P  F  +    V   D G P R  + S TV++ L D+NDN P F    Y +  LE  G   NS    V  A DPD G NG+VTYS+      P F+L+  +G + +   +DRE   + Y   + A D  T  L   ++T ++S+V+ D NDN P F   + +   + L   V   S+V  +   D DSG+N+++ F +    ++  FS+    G + T   L    K   +L I+AID G
Sbjct:   16 VHITLINENDNRPIFSLPLYNVSVWENATLGTSVVQV-LATDLDAGVFGQVSYHFSDDSDKFSLDPASG-------LISVAAALDFEATPRFTVTVMARDGGGQETAGRVR--INLLDVNDNTPVFQRDSYVGTAREN-DNSLTPVVRVRATDEDSPPNNQITYSILPTSAYSSYFSITVSGGYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSP--IFDRNSYSIAIPENILAGATVLYVNATDGDQSP---------EYGQLSLIYSLEGSTQFRINARSGDITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFTVSAADPDLNENGTLVYAIDPPNPFY---RINAASGKIRTTGLQ-LDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLE--GLPANSTLFQV-TATDPDEGANGNVTYSMTAALPRPDFQLDAATGLITTLVQLDREAV-AAYQLRLVATDRGTPAL---SSTTTLSLVVLDVNDNAPTF---HPARSAVSLMESVARDSVVISLNCTDADSGLNAELSFFITGGNQDGQFSVGFRDGLVRTVVSLDRETKASYSLVIEAIDNG 646          

HSP 4 Score: 143.665 bits (361), Expect = 1.327e-34
Identity = 148/578 (25.61%), Postives = 258/578 (44.64%), Query Frame = 1
Query:  694 GSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDIN--ANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDG---LNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPF-KLNPNSGELYSYDL-VDRE-------TQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFI-FPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEI 2382
            GS ++ I +I+ NDN+PIF    Y  S+  N  + +++ +++ ATDLD      V+Y FS +      D F L+P + ++ V  +L    F +  RF++  +      +++   V ++L + N   P  +   ++ V    EN +    ++     D DS  + +   SIL    Y    ++  T S    +++L     +++     I L I   D G P  N++    + + D NDNSP F++  Y   I E      T+  + A D D         L Y ++  T        I   S   I +   LDRE      +++   + +    G  Q++G  TV+I L+D+NDN P ++   Y ++ +E+     +   V+   A DPD   NG + Y+I  +   PF ++N  SG++ +  L +DRE               S   R SP     R TA+ +V+++++D NDNEP F+  P    Y +Q+   +P  S +  V A D D G N  + + +        F ++  +G + T   L         L + A D G+P L++   L++ +
Sbjct:   12 GSARVHITLINENDNRPIFSLPLYNVSVWENATLGTSV-VQVLATDLDAGVFGQVSYHFSDD-----SDKFSLDPASGLISVAAALD---FEATPRFTVTVMARDGGGQETAGRVRINLLDVNDNTP--VFQRDSYVGTARENDNSLTPVVRVRATDEDSPPNNQITYSILPTSAYSSYFSI--TVSGGYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQSPEYGQLSLIYSLEGSTQFR-----INARSG-DITSTTLLDREAVS---QYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFTVS---AADPDLNENGTLVYAI--DPPNPFYRINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPR---RATASATVTVLLQDVNDNEPSFVGLP----YALQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAALPRPDFQLDAATGLITTLVQLDREAVAAYQLRLVATDRGTPALSSTTTLSLVV 555          

HSP 5 Score: 135.191 bits (339), Expect = 5.290e-32
Identity = 150/590 (25.42%), Postives = 262/590 (44.41%), Query Frame = 1
Query:  676 GTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGR-PVEK--SKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSIL--EPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAI-QSLDREKYPNGFRFVCPYQVIATDSGEP-----QRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVF----IAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDL---VDRETQP-SQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGI--NSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEI 2382
             TP++  +  +LI+I D NDN P F ++ Y   +             + A+D D   N    +++ V       F ++    +L   K+L  E  A  Y   + A D  R P  +  S  TV++H+ + N   P   L      I + E Q  G  I T +  D DSG++G+   SI+  +P+N  +I         ++ +   +     DRE +    L I  KD G P  N++  + + ++DV+DN P F     + ++ E       ++++ A D ++G N     +    TS  +  +    +S   ++ + + LDRE+       V  Y++  T    P      R  S  + + ++D NDN PVF Q  Y     E+     N   + V      A D DFGVN  + YS++  +   F ++ + G + S  L   +DRE  P  +   +I  +D       R+ ATV + + + D NDN P F   +++ + ++ S    VG+ V +VKA+D+D G+     +++ +     N  F I+E++G ++T   +    + E  L + A D   P  TA  +L + +
Sbjct: 1149 ATPAQ-ATTSVLIRITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPDEGDNARVVYAI-VSGNTAATFGIDNGTGVLTAVKALDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTP-WFLRSYEGPIDVSEGQP-GPRIATFMASDQDSGLNGELEYSIIDGDPRNEFVI----SPADGDLRVRRYVE---LDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAVLAIVSRVRASDANEGRNCAALLQ-HSPTSFCNGERAFYADSQTGLVYVNRPLDRER-------VAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSPVFSQVTYEAEIPEN---SPNGTVLTVLNGPIYASDADFGVNATLAYSLLGGSSAYFLIDRDRGNV-SMALGQGLDREGIPGGRLELTILVQDG-----GRRNATVRLGVTVLDVNDNTPTFNVTSQTAHVLENSPA--VGTSVIVVKAMDRDLGVCDAGTVRYSIASGG-NDTFGIDESTGLIVTVAPIDYETRPEYLLMVVATDQAPPFHTASCELRVSL 1707          

HSP 6 Score: 115.931 bits (289), Expect = 3.548e-26
Identity = 158/633 (24.96%), Postives = 264/633 (41.71%), Query Frame = 1
Query:  376 LEIQILDENDNVPQW-SQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKP---FLKLRRG--IDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDAL--DHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKP-AFNTSAEXXXXXXDVNDNSPQF------EKEFYHYTIFEENQPNFTIAQLT-AHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTT---------------VSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNS--------------------GELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQ 2121
            L + +LD NDNVP + S     + VVE     +    +  A D+D  PN    ++IE        S       I P    +++  G  IDRE  + + + ++AVD G P  +GS  + + + DVND +P F +   T S+  +L + S +   + AT+     N  Y +   +  I ++ F ++  + ++   + LK     S  RF++ A+  DHGRP    +  + + + + N + P  +LP N  V+ I E   + + I+  +  D D G +G    S L           +   +    IIS  T +  DRE +    LI+   D G+P ++ ++  + +++ D++DN P F         +  ++I E + P   +  ++ A D D G NA + Y I       + NK   +     ++ +  LDRE  P        Y +I   S  P  + + T               V + L DIND  PVF    Y      D    K   ++    A D D G N  V Y I+  ++L  K + NS                    G L +YDL      P  +   + A D      +  TATV V I+     D++ + I  NE+  +++
Sbjct: 1939 LSVIVLDVNDNVPIFLSPGGYAVSVVELGAPGTLVASV-WATDADAGPNGQVTFRIE--------SGGGDKLSIGPSDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFV-ATVKATENYKGHNTKYTY--KIAGIGKNAFTVHATSGLVTSTRLLK-----SYERFNLTAVATDHGRPPLWGQAGLYVEVLDVNDHRPVFVLPPNGTVVNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWESFRINATSGIIS--TARALDRESQAVYSLILLASDQGQPVSYESTQPLQVVLDDIDDNEPVFIVLPDGGAPYQSFSIPEHSPPGTAVGNVSGAVDADVGANAIVYYFIAAGN---EGNKF-NLSRWGLLVVLSDLDREVSPY-------YAIIVKASSNPNWTPAVTTGPEFDPSKDRTLREVRVYLEDINDQWPVFTNHEYTAGVAVD---AKVGSELLQLEAVDRDVGNNSIVLYRIL--SILYIKHSSNSSTRMYNIFTLGRCARAGERDGILRTYDLF-TAYGPGYFMLEVVAADLAG---HNDTATVGVYIL----RDDQRVKIVINETPERVR 2528          

HSP 7 Score: 110.923 bits (276), Expect = 1.437e-24
Identity = 184/790 (23.29%), Postives = 312/790 (39.49%), Query Frame = 1
Query:  124 QIFENLPVGSVICKLSNVIIPRPSDTTKFKLIKNRFFQIENGDNLKVSGLIDRD-DNLELCAYRNVNFSCIWRGILFC-------GTNNLKI-LEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKL---RRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFD--------------LNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVE-------KSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILE------PKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQF-EKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDT----SLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEE----KRNI-LFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSP 2346
            +I EN P G+V+  L+  I    +D   F +     + +  G +     LIDRD  N+ +   + ++   I  G L         G  N  + L + +LD NDN P ++  S    V+EN+      + + KA D D    +        T +Y   S      GI     L      ID E    + + ++A D   P  T S +L + + +  D K  F  + Y Q+      +  T+ +++ A  +        +  L +  +VQ   +              +      +  + +L  E   S Y  ++ + D G P E       K    V +++ ++N   P     G+  ++ + E+   G ++      D D+G +G  +           P  Y +I+     ++E+   I  +    F  +    I   I   D G P  +T+  +S+I++DVNDN P F     Y  ++ E   P   +A + A D D G N Q+ +RI+       S+   + +I+V     I      DRE      R      V+A D G P  SGS  V + + D+ND  P F      +S LE   S      VA   A +   G N   TY I       F ++  SG + S  L+       ++  +  A D     L+ +     + + + D ND+ P+F+ P      + ++ ++PV   +  V A+D D G N  +++          R+   F IN TSG + T+  L    +   +L + A D G P
Sbjct: 1508 EIPENSPNGTVLTVLNGPIYASDAD---FGVNATLAYSLLGGSSAYF--LIDRDRGNVSMALGQGLDREGIPGGRLELTILVQDGGRRNATVRLGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAG------TVRYSIASGGNDTFGIDESTGLIVTVAPIDYETRPEYLLMVVATDQAPPFHTASCELRVSLQNELDEKLSFSLAAY-QAALSEAAVPGTVVVRVAAPQM----KAPPKLPLPLAILVQKWHEDKRHKQQESDNAELIAALQGEITTQAALDREATDS-YMLTVLSRDGG-PREAIAVLTNKPGAYVYVNVTDENDNSPE-FEAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYILII-----QNESGVTIVDVAKADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNVPIFLSPGGYAVSVVELGAPGTLVASVWATDADAGPNGQVTFRIESGGGDKLSIGPSDGIIRVAPGANI------DRET-----RAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLE---SLSVGSFVATVKATENYKGHNTKYTYKIAGIGKNAFTVHATSGLVTSTRLLKSY---ERFNLTAVATDHGRPPLWGQAG---LYVEVLDVNDHRPVFVLPPNGTV-VNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWESFRINATSGIISTARALDRESQAVYSLILLASDQGQP 2252          

HSP 8 Score: 100.908 bits (250), Expect = 1.566e-21
Identity = 195/789 (24.71%), Postives = 316/789 (40.05%), Query Frame = 1
Query:  325 SCIWRGILFCGT--NNLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEP--TSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGG----TPSK--TGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKK--SLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSIL-LPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDF-GKPAF--NTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTI-----AQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLI-KVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGV--NGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFIL-----EEEKRNILFS------INETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGEFRNPDSTPFNETEESFLSDQATFIIV------GIILGTFFICCGLVTGICTMAYRRWHSSNNRSPP 2568
            S   RGI    T       + I+I DENDN P +   +  + + E        +    A D DE  N    Y I    T+  F I    +  G+   L   + +D E+ +   + LL V        P++  T +  + + + DVND  P F  S Y   ID +            A+D D   N    +S+ +    ++ F ++P +  LRV++   L  E  A  Y  +I A D G P   S  TV + + + +   P  L LP N ++     ++   V+ +   V+ +D+  +G+ NC+ L   +        +    +     +  N+  DRE     +L +  +D    P++    S  + + I+D NDNSP F +  Y   I  EN PN T+       + A D D G+NA L Y +   +S Y    LI +   N  +   Q LDRE  P G        ++  D G  +R+ +  + + ++D+NDN P F         LE+  S      V V  A D D GV   G V YSI       F ++ ++G + +   +D ET+P +Y   + A D         TA+  + + +++  D +  F     + Y+  LS     G++V  V A    +     +   +      E+KR+          I    GE+ T   L         L + + D G PR  AI  LT + G +   + T  N+    F +  AT + V      G +L              T++ R    +  R PP
Sbjct: 1139 SASTRGICLTATPAQATTSVLIRITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPDEGDNARVVYAIVSGNTAATFGI---DNGTGV---LTAVKALDFEVSA--GLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWFLRS-YEGPIDVSEGQPGPRIATFMASDQDSGLNGELEYSI-IDGDPRNEFVISPADGDLRVRRYVELDRETQAF-YNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPANASL-----SEAAAVLAIVSRVRASDAN-EGR-NCAALLQHSPTSFCNGERAFYADSQTGLVYVNRPLDRERVAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSPVFSQVTYEAEI-PENSPNGTVLTVLNGPIYASDADFGVNATLAYSLLGGSSAY---FLIDRDRGNVSMALGQGLDREGIPGGR---LELTILVQDGG--RRNATVRLGVTVLDVNDNTPTFNVTSQTAHVLEN--SPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGGNDTFGIDESTGLIVTVAPIDYETRP-EYLLMVVATDQAPPF---HTASCELRVSLQNELDEKLSFSL---AAYQAALSEAAVPGTVVVRVAAPQMKAPPKLPLPLAILVQKWHEDKRHKQQESDNAELIAALQGEITTQAALDREATDSYMLTVLSRD-GGPR-EAIAVLTNKPGAYVYVNVTDENDNSPEFEAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPP 1889          

HSP 9 Score: 73.559 bits (179), Expect = 2.945e-13
Identity = 77/248 (31.05%), Postives = 117/248 (47.18%), Query Frame = 1
Query: 1699 GSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNY----KIQLSYLVPVGSLVTLVKAIDKDSGINSQIQF-ILEEEKRNILFSINETSGELLTSTVLSV----IHKGEETLFIKAIDCGSPRLTAIQQLTIEIGEFRNPDSTPF 2415
            GS  V I L++ NDN P+F    YN+S  E+         V   +A D D GV G V+Y    ++   F L+P SG +     +D E  P ++T ++ ARD       ++TA   V I + D NDN P+F      +Y    +   + L P    V  V+A D+DS  N+QI + IL     +  FSI  + G  + +   ++    I  G  +L I A+D GSP L +     +E+  F   D++P 
Sbjct:   12 GSARVHITLINENDNRPIFSLPLYNVSVWEN---ATLGTSVVQVLATDLDAGVFGQVSYHFSDDS-DKFSLDPASGLISVAAALDFEATP-RFTVTVMARDGGG----QETAG-RVRINLLDVNDNTPVF---QRDSYVGTARENDNSLTP----VVRVRATDEDSPPNNQITYSILPTSAYSSYFSITVSGGYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEV--FDENDNSPI 240          
BLAST of Protocadherin alpha-11 vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 220.705 bits (561), Expect = 3.508e-58
Identity = 201/680 (29.56%), Postives = 330/680 (48.53%), Query Frame = 1
Query:  376 LEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNK-GIKP---FLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTK---SENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQ-WDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLL-PFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGE 2388
            + I I DENDN P ++  S    + E++   +   +L  A D D  PN    Y I        IS  + N   + P    L +R  +DRE I  + + + A D G+P ++ +  + + ++DVNDN P FE S ++  I  +  ++ST+ L++   D D  +N     SL+      D F ++    +L  K  L +E  A+ Y+ ++ A D G P + +   V + + N N   PS + P    V  I E+    V I T VVK N +  DG        P  +DI+     +     ++  +IS+   K  DRE      L++   + G    +     +I ++DVNDN+P F    Y  ++ E      T+A++TA D D+G NA++ Y +   DTS ++ N    +     +   + LDRE   +        +V A D G+P +S    +++ + D+NDN P F Q+ Y ++  E+  +  N  +V   +A DPD G NG VTYSI+       F+++  +G +    +VDRE   S Y  +I+A+DS    +    +T  V+I + D NDN PIF   NE++Y I     V +GS V +V A D+D G N+Q+ + +     +  F+IN  +G L     ++       TL I+A D GSP +T+ ++LT+ + +
Sbjct:  776 VNISIADENDNQPTFTGPS-RFNISEDSPTGTRVGQL-TATDRDIGPNGAVTYAI--------ISGNQGNSFQLDPRSGILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTV-LQVKVEDKDEGSNGAITLSLSGEG--SDNFTIDSTGFVLS-KTPLDYETTAA-YQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQ--VTSIPED----VAINTHVVKLNATDSDGT-------PLTFDIVEGNAGSSFKIDQSSGLISVA--KRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSKFEVNPATGL-----VTTKRPLDREDQAS-----YSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRV---LASDPDAGANGRVTYSIISGNHGNAFRIDSTTGRITVVGVVDREALAS-YNLTISAKDSG---VPPWVSTAFVAITVADENDNSPIFA-SNETSYGIDEG--VSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTS-AFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVND 1404          

HSP 2 Score: 210.305 bits (534), Expect = 6.281e-55
Identity = 211/713 (29.59%), Postives = 331/713 (46.42%), Query Frame = 1
Query:  325 SCIWRGILFCGTNNLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPN-NISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQS-LDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAF-YNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGE-------FRNPDSTPFNETEES 2433
            S   R   F G +   +  I + D NDN P ++ +     V E+  + S   +L  A D D   N  +SY  +   + YF + S+         ++ +   DRE  + + V L A DGG+PS++G   + I+I+DVNDN+P+F S+ YT S+D ++ I + + + + A+D D   N   R+S          F L+    ++ V +SL  E  +S Y   +   D G P     + + +++ + N  PP +  P      R+ EN   G  +      D DS  +G     I++  N D + T++ +      IIS+   K  D E KTR  L +  +D G P    +A+++I I DVND+SP F    Y   I E      T+  +TA DLD G   +L YR+       +      +++N   I + S LDRE  P+        QV A D G   RS ST V+I L DINDN P+FQ  + + +S      S     ++    A D D   NGDV Y++   T + F +N ++G +     +D E + +QY  ++TA+D  T    R + TV V ++++D NDN P F    +S Y   +   +  G  V  V A D DSG N +I + +     N+ F+++  +GE+ T   L        +L I A D    R  A   + I I +       F  P  + FN +E+S
Sbjct:  137 SYTMRISAFDGKHTTFVPLITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQL-TAVDLDVGINARLSYSLVSGDTSYFTVDSQG-------VIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAM-VTVTASDKDNGNNADLRYSF-TSGNTNHAFTLDAVTGVVTVSRSLDFEQRSS-YALGLSVTDRGSPPLTDTSHLLINVNDINDNPP-VFSPSAYQS-RVKENTPAGTQV---SATDRDSSTNGALVFGIIK-GNDDGVFTIDGS----TGIISIA--KSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISG----NVKGAFNIDANSGSIRVSSELDRETTPS-----YSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGPYVFRVSE-----SSSPGHQIGQVAATDADDSSNGDVRYALSDNTDV-FSINTSTGLITLKTQLDYE-KKTQYMVTVTAKDGGT--PSRSSLTV-VKVMVDDVNDNPPQFA---KSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGP--SRFNISEDS 802          

HSP 3 Score: 202.601 bits (514), Expect = 1.545e-52
Identity = 201/677 (29.69%), Postives = 314/677 (46.38%), Query Frame = 1
Query:  376 LEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNN-ISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGK--FNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQ--VIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFIL---EEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEI 2382
            + + +LD NDN P++ ++    E+ E+  + S  L++ K  D DE  N  I+       S  F I S         F+  +  +D E  + + +T+ A DGG+PSK+ + Q+ I II+VNDN P F S     SI  ++ IN+ + +K++ATD D        F + V       F ++  + ++ V K L  E  A+ Y   + A + G   E      T+ + + N   P +  PG+ A   + EN  IG  +      D D G + K  +  S+ +   +++          N A   + T +  DRE +    L +   D GKP+ +  A I++ I D+NDNSPQF +  Y  T+ E       I ++ A D D G N ++ Y I    S    N      +  +I  +  +DRE        +  Y   + A DSG P    +  V+I + D NDN P+F  A    S+  D G    SR VAV  A D D G N  V YSIVR     F +N  +G L     ++RET P+ YT +I A D  + ++   T+   +++V+ D NDN P+F   N  +Y   +       + V  V A D D G N+ +++ +    +EKR   F IN TSG ++T+T L    K +  L + A D    + TA   +TI +
Sbjct:  880 IHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQV-KVEDKDEGSNGAITLSLSGEGSDNFTIDSTG-------FVLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHV-VKLNATDSD---GTPLTFDI-VEGNAGSSFKIDQSSGLISVAKRLDRETTAN-YTLVVRATETGSQGESVYNNATIRVLDVNDNAP-VFNPGSYAK-SLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSKFEV----------NPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSI---ISGNHGNAFRIDSTTGRITVVGVVDREA-------LASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIF--ASNETSYGIDEGVSIGSR-VAVVTATDRDEGSNAQVFYSIVRGDTSAFAINAMNGVLTVKKEINRETVPT-YTLTIRASDRGSPMM---TSDKELTVVVNDVNDNPPVF---NSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKR---FKINSTSGVIMTTTPLDFEEKSQYGLEVTATDS---KYTAKTNVTIRV 1504          

HSP 4 Score: 179.104 bits (453), Expect = 2.603e-45
Identity = 203/771 (26.33%), Postives = 350/771 (45.40%), Query Frame = 1
Query:  127 IFENLPVGSVICKLSNVIIPRPSDTTKFKLIKNRFFQIENGDNLK-----VSGLI------DRDDNLELCAYRNVNFSCIWRGILFCGTNNLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNK----GIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQD--CFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPY--QVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEI 2382
            + ENLP+G  + K++       +D  + +  K   +++  GD  K      +GL+      DR+D     A  ++  + +  G      + +  + + I D NDN PQ+SQ+   + V ENT   S  L +  A D D   N    Y I        IS    N          + +   +DRE ++ +N+T+ A D G P    +  + I + D NDN PIF S+  +  ID  + I S + + + ATD D  +N    +S+    +  D   F +N  N +L VKK +  E   + Y  +I A D G P+  S   +T+ + + N  PP  +    + +  + EN      +LT    D+D G +     SI+   N +    +N T         ++T    D E K++  L +   D     +     ++I +I++ND +P F ++ Y  ++ E +  + ++ +++A D D      L Y I       D +K    + +  I     LDRE        V  Y  QV  TD+G P  S  T V+I+++D NDN P F  + Y+ S LE+      S K+A   A D D G N  +TY++ R     F +  +SG +     +DRE + S Y  +I ARD  T     + +++++ + + D ND+ P+    N S+ +  +    P  + V  + A D D+G+N+++ F L   +   +F+++ T+G++ T   L    +   TL I   D G+P L+++  + I++
Sbjct: 1108 LHENLPIGQTVAKVT------ATDRDEGENAK-VTYELSVGDTSKFEVNPATGLVTTKRPLDREDQ----ASYSLRVTAMDHG--KPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRV-LASDPDAGANGRVTYSI--------ISGNHGNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAV-VTATDRDEGSNAQVFYSI----VRGDTSAFAINAMNGVLTVKKEINRETVPT-YTLTIRASDRGSPMMTSDKELTVVVNDVNDNPP--VFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIIS-GNDEKRFKINSTSG------VIMTTTPLDFEEKSQYGLEVTATD---SKYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDS--FGSLSYSI---VGGKDSDKFSIDQRSGIISTADVLDRE-------LVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLA---ATDADEGTNARITYNLSRNDA--FMIGASSGVITLAQPLDRENK-STYDLAIQARDHGT---PPQASSITIRVTVIDINDHRPLI---NSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSLLSNEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDV 1814          

HSP 5 Score: 174.866 bits (442), Expect = 4.992e-44
Identity = 196/786 (24.94%), Postives = 338/786 (43.00%), Query Frame = 1
Query:  124 QIFENLPVGSVICKLSNVIIPR-PSDTTKFKLI----KNRFFQIENGDNLKVSGLIDRDDNLELCAYRNVNFSCIWRGILFCGTNNLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSI----------LEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQ--VIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETL-LPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGEFRNPDSTPFNETE 2427
            QI E+  +GS +  ++   +   P    +++LI    K  F    N  +++VS  +DR+                 R       ++   + I + D NDN P + Q   V  V E++      +    A D+D+  N    Y +   +  F I++          + L+  +D E  + + VT+ A DGGTPS++    + + + DVNDN P F  S YT ++  NL     +   + ATD D  AN    +S+ +       F ++ F   +  +  L  E  AS Y  +I+A D       + TTV + + ++N   P+   P       I E+   G  +      D D G +G    +I          L+P++   IL++  T                DRE      L++   D G P  + +A I + ++DVNDN+P+FEK  +   I E+   + T+ Q+   D D+G N  +   +  + S         ++S   +++   LD E           YQ  V A D G P +S +  V I ++++NDN+P F       S  ED     +   V    A D D      +T+ IV       FK++ +SG +     +DRET  + YT  + A ++ +     ++   + +I + D NDN P+F   N  +Y   L   +P+G  V  V A D+D G N+++ + L     +  F +N  +G + T   L    +   +L + A+D G P  +A+  +T+ I +  N +S  F++++
Sbjct:  486 QIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSELDRETTPSYS------LQVEARDGGSTSRSSSTRVTIALQDINDNSPIF-QGPYVFRVSESSS-PGHQIGQVAATDADDSSNGDVRYALSDNTDVFSINTSTG------LITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAV-CYVTATDADSGANGKISYSI-LSGNENMAFAMDRFTGEITTRVPLDRETIAS-YSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGPSR---FNISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGNSFQLDPRSG--ILSVRST---------------LDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSGEGS-----DNFTIDSTGFVLSKTPLDYET-------TAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTH---VVKLNATDSD---GTPLTFDIVEGNAGSSFKIDQSSGLISVAKRLDRETT-ANYTLVVRATETGSQ---GESVYNNATIRVLDVNDNAPVF---NPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTS-KFEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDL-NDNSPQFSQSK 1207          

HSP 6 Score: 168.318 bits (425), Expect = 5.918e-42
Identity = 172/675 (25.48%), Postives = 294/675 (43.56%), Query Frame = 1
Query:  373 ILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSL---NVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLIT-NKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLL-PFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEI 2382
            ++ I + DENDN P++  NS V  + ENT      +     RDS  +   I+Y      +K+   S     + + P       +D E    + + + A DG    K  +   LI + DVNDN P F  S Y   +  ++ + S +  ++ A DLD+  N    +SL   +  +   D         ++R K +   E  AS Y+ ++ A D G P    + TV + + + N   P  +         + E+  IG  ++T    D D+G +     S     N +   T++       A+  ++T ++  D E ++   L +   D G P    ++ + I + D+NDN P F    Y   + +EN P  T  Q++A D D   N  L + I       + + +  ++ +  II+I       Y N  R+    Q  A D G P +  +  V+I + D+ND+ PVF  + Y+    E   S      V    A D D G  G + Y ++   +   F ++ NSG +     +DRET PS Y+  + ARD        ++++  V+I ++D NDN PIF  P    Y  ++S     G  +  V A D D   N  +++ L +     +FSIN ++G +   T L    K +  + + A D G+P  +++  + + +
Sbjct:   55 VVVIDVKDENDNAPEFPLNSYVFNIRENTPAAQVAIVTATDRDSGTNA-AITYSLFSGENKFMMNSKTGEIRTVTP-------LDHETKDSYTMRISAFDG----KHTTFVPLITVDDVNDNAPFFALSVYKTGVYEDVAVGSIV-RQLTAVDLDVGINARLSYSLVSGDTSYFTVDS------QGVIRTKGAFDRETKAS-YQVALRAQDGGSPSRSGQATVEIEILDVNDNRP--VFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTS-GNTNHAFTLD-------AVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRV-KENTPAGT--QVSATDRDSSTNGALVFGIIKG----NDDGVFTIDGSTGIISIAK--SPDYENKTRYDLTVQ--ARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPE---STVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSELDRETTPS-YSLQVEARDG---GSTSRSSSTRVTIALQDINDNSPIFQGP----YVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNTD--VFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMV 675          

HSP 7 Score: 167.933 bits (424), Expect = 6.335e-42
Identity = 189/714 (26.47%), Postives = 317/714 (44.40%), Query Frame = 1
Query:  361 NNLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNN-ISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFES-SFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSI---LLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIIS---LITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAI-QSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARD--SPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHK---GEETLFIKAIDCGSPRLTAIQQLTIEIGEFRNPDSTPFNETEESFLSDQATFI 2460
            ++L ++++ + D NDN PQ++++     V EN       +    A D+D   N  ISY  +       F     + +     +  R  +DRE I+ +++T+ A DG       +  + I I D NDN+P F   S +  S D       T   ++ ATD DI  N    +++ +     + F L+P + IL V+ +L  E   S Y   + A D G P +    ++ + + + N   P     L  G      I E+  +   +L   V+D D G +G             I L+++   S+N  I S   +++    D E     QL +  +D G P+ + +A++ I II+VNDN P F       +I E+   N  + +L A D D          + +D    +     K++ +  +I++ + LDRE   N +  V    V AT++G    S     +I ++D+NDN PVF    Y  S  E+       + VA   A D D G N  VTY +       F++NP +G + +   +DRE Q S Y+  +TA D   P+     ++A  ++++ I D NDN P F   ++S Y + ++     GS +  V A D D+G N ++ + +        F I+ T+G +   TV+ V+ +       L I A D G P   +   + I + +  N +S  F   E S+  D+   I
Sbjct:  666 SSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAA-GVAVCYVTATDADSGANGKISYSILSGNENMAFAMDRFTGE-----ITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGPSRFNISEDSP---TGTRVGQLTATDRDIGPNGAVTYAI-ISGNQGNSFQLDPRSGILSVRSTLDRETIPS-YTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSG-----EIREDASVHSTVLQVKVEDKDEGSNGA------------ITLSLSGEGSDNFTIDSTGFVLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSDG-------TPLTFDIVEGNAGSSFKIDQSSGLISVAKRLDRETTAN-YTLV----VRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENL---PIGQTVAKVTATDRDEGENAKVTYELSVGDTSKFEVNPATGLVTTKRPLDREDQAS-YSLRVTAMDHGKPS-----QSAVAAITLTINDLNDNSPQF---SQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRIDSTTGRI---TVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVAD-ENDNSPIFASNETSYGIDEGVSI 1323          

HSP 8 Score: 162.54 bits (410), Expect = 3.355e-40
Identity = 179/645 (27.75%), Postives = 294/645 (45.58%), Query Frame = 1
Query:  256 LKVSGLIDRDDNLELCAYRNVNFSCIWRGIL-FCGTNNLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKI-EPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVR-ETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKD 2181
            + V G++DR    E  A  N+  S    G+  +  T     + I + DENDN P ++ N     + E   + S  + +  A D DE  N   +Y I    +  F I++      +   L +++ I+RE +  + +T+ A D G+P  T   +L + + DVNDN P+F S  Y  S+  N    ST  L + A D D+ AN   R+S+ +    +  F +N  + ++     L  E   S+Y   + A D       +KT VT+ + N N   P+       A +R  EN      ++     D DS   G  + SI+  K+ D      ++      IIS  T  + DRE+ +   + +   D G P  +    ++I I+D NDNSP+F+   Y  +I E + P+    +L A D D+G NA++ Y +  + +      +I   S    +A Q LDRE      +      + A D G P ++ S T+ + ++DIND+ P+   +    S  E+   +     V   +A D D G+N ++T+S++  E    F L+  +G++ +   +DRE Q + YT  I   D   N      A V + ++ ED  DN P F  P E  Y + +S  +P G+ +  V A D D
Sbjct: 1260 ITVVGVVDR----EALASYNLTISAKDSGVPPWVST---AFVAITVADENDNSPIFASNETSYGIDEGVSIGS-RVAVVTATDRDEGSNAQVFYSIVRGDTSAFAINA------MNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVREN-SAQSTSVLTVAADDSDVGANAVLRYSI-ISGNDEKRFKINSTSGVIMTTTPLDFEE-KSQYGLEVTATDSKY---TAKTNVTIRVINLNDITPAFTQQNYTASVR--ENSPTSTSVVKVSASDRDSF--GSLSYSIVGGKDSDKFSIDQRS-----GIIS--TADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSRNDAF-----MIGASSGVITLA-QPLDREN-----KSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVREN---QPKETHVMRILASDADTGLNAELTFSLLSNEHKSVFTLDNTTGDISTKVPLDRE-QQAVYTLRIGVADKG-NPSLSSVADVIIDVIDED--DNCPRF-QPTE--YNVTISESLPRGASIVQVTARDID 1852          

HSP 9 Score: 138.272 bits (347), Expect = 8.458e-33
Identity = 150/559 (26.83%), Postives = 241/559 (43.11%), Query Frame = 1
Query:  616 RGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAI-QSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLP-FKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVL 2286
            R  DRE  S + +T+LA D       G   ++I + D NDN P F  + Y  +I  N          + ATD D   N    +SL   F  ++ F +N     +R    L HE   S Y   I A D          TV     N   +  S+   G      + E+  +G ++      D D G++ + + S++        +      S+ +    + T   FDRE K   Q+ +  +D G P+ +  A + I I+DVNDN P F    Y  ++ E+      +  +TA D D+G NA LRY      +    N    +++   ++ + +SLD E+     R      +  TD G P  + ++ + I + DINDN PVF  + Y          K+N+       A D D   NG + + I++      F ++ ++G +      D E + ++Y  ++ ARD    + Y    T  V+I IED ND+ P+F   + SNY  Q+     +GS V  V A D DSG   ++++ L        F+I+  SG +  S+ L
Sbjct:   26 RKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRENTPAAQV--AIVTATDRDSGTNAAITYSL---FSGENKFMMNSKTGEIRTVTPLDHETKDS-YTMRISAFDGKHTTFVPLITVDDVNDNAPFFALSVYKTG------VYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTSYFTV-----DSQGV----IRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNT----NHAFTLDAVTGVVTVSRSLDFEQ-----RSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRV------KENTPAGTQVSATDRDSSTNGALVFGIIKGNDDGVFTIDGSTGIISIAKSPDYENK-TRYDLTVQARDRGVPVKYD---TAQVTIFIEDVNDHSPVF---SPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSEL 541          
BLAST of Protocadherin alpha-11 vs. Ensembl Nematostella
Match: EDO40470 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S751])

HSP 1 Score: 200.29 bits (508), Expect = 8.982e-52
Identity = 190/667 (28.49%), Postives = 311/667 (46.63%), Query Frame = 1
Query:  382 IQILDENDNVPQWSQN-SIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKI---EPTSKYFFISSEKSNKGIKPFLKLRR---GIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTV----TLHLKNQN-LYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVE-SNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGS 2343
            + + D NDN P + +  S  + V EN K   F  +L  A DSD   N+   Y I      + +  IS   ++  +   L +     G+DRE +  + + + A DGG P+  G L+L I + D NDNKP F +  Y+ +I  N+++ +++ L++ A+D DI  N   ++S+      Q  F ++P   ++     L +E   S Y   + A D G   + S + +     L + + N +   S  L G+    ++ EN  IG  +    V D DSG +G+ N ++     Y    +M      + +II++   +  DRE      L   C D G P   T     I + DVND +P+F++  Y   ++E    N  +A + A D D G N++L Y I   T          ++ S+  I     LDRE+ P          V+  D G P  S + +V + L D NDN P F Q+ YN S  E+     +   V   +A DPD G N  + YSI+     PF L+P  G + +   +D E Q S YTF + A D        ++   +V + + D NDN+P+F   + S+Y ++      +G  +  +KAID+DS   +  +FI+E+   + +FS+ + SG +  + +L    +    L +KA+D G 
Sbjct:   46 VYVQDLNDNSPSFVRGTSAKLVVFENDK--DFRQKL-IAVDSDFGSNSTQSYTIVSGNVGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSI-LQVSASDKDIGTNAEIQYSIETHSDPQAIFGIHPTTGVIVNNVRLDYEAKRS-YLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGS---YQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGY---FSMKFDVLNDESIIAV--GQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQ-----VVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFEN---SPSGSPVVQLLAQDPDIGENSLILYSILTPN-TPFFLDPRKGLVTNSRTLDHEVQ-SSYTFQVAATDGGG-----RSCNATVHVSLTDLNDNQPVF---DPSSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNADEVFSV-DGSGLITLAKLLDRETQDNYLLTVKAVDGGG 680          

HSP 2 Score: 181.415 bits (459), Expect = 5.336e-46
Identity = 205/769 (26.66%), Postives = 342/769 (44.47%), Query Frame = 1
Query:  124 QIFENLPVGSVICKLSNVIIPRPSDTTKFKLIK--------NRFFQIENGDNLKVSGLIDRDDNLELCAYRNVNFSCIWRGILFCGTN--NLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEP--TSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDL-DINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGN-NAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFT-IAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRL-TAIQQLTIEI 2382
            + FEN  +G  IC+L  +      D+ KF + +        +  F ++    + ++ L+DR+           N+    + +   G +  N  I+ I +LD ND  P +S+      + E+++  S    +  A   D+  N    Y I    T     I+S  +       L L+  +D E I    +T+ A D GTP   G   + I +ID+NDN P F SS    SI   L  ++ +    +   + D ++ V  R S ++       F+L+     L + K + +   A  Y   + A D G P   S   + L + + N Y P     GN +    ++E       I+  V  D DSG +G+ + +      +D  +  +K    N   I  I +K+ DRE      L +   D G P  ++SA++ +I+ DVNDN+P F++  Y + + +EN+P  T +  ++A D D+G N  + YR  +DT +    + I  +   +I   Q LDRE      +    + ++ATD G   R   T V++ + D+ND  P F +  Y+++  ED      S  + +    D   G N D+TY IV      F LN  +G L     +DRE    ++   + A D   N        + ++++  D NDN P+FI  NE+ +K     L P+GS+V  V A+D D G N ++++ +     +  F INET+G + T   L         L + A D G  +  T+ Q +TI +
Sbjct:  607 EYFENTRIGQSICQLKAI----DRDSPKFAITRFIIEQGNADEVFSVDGSGLITLAKLLDRE--------TQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHV-HAISRDKGTNAEVVYSISKGNTDNIVLINSTGT-------LYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQFNSS----SILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSNPGTLFNLDSNTGALSLTKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVF---GNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYA------FDSKVDTSKFGLRNGGKI-FIKSKL-DREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFV-KENEPVATYLGAVSASDSDEGSNGHVTYR--FDTQVA---QFIVDKQTGKITTSQVLDREA-----KASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNKYSVTVNEDL--PVGSSLLTLIATDDDQQGPNSDITYMIVAGPKA-FSLNQVTGVLTLVSPLDREVT-HRHILHVVASDKGGNQSLETITYIEINVL--DVNDNYPVFI--NETTFKTVPEKL-PIGSVVAAVLAVDSDQGDNGKVRYKIVNGNTDGTFKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYV 1320          

HSP 3 Score: 175.252 bits (443), Expect = 4.255e-44
Identity = 192/668 (28.74%), Postives = 309/668 (46.26%), Query Frame = 1
Query:  376 LEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLD--INANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTR-IQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRI--QWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFI----AHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVG-SLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVL--SVIHKGEETLFIKAIDCGS 2343
            + + + D NDN P +  +S  +E  ENT++     +L KA D D     I+ + IE  +     S + S       + L + +DRE    + +T+ AVDGG         + I ++DVND  PIF  + Y  +I  + +  S +   +HA   D   NA V Y  S        D   L      L ++  + HE   S Y  ++ A D G P       VT+ + + N   P      ++ ++R+ E+  IG    T  V D DSG+ G+ + S+L   N   +  ++     N   +SL   K+ D     R   L +  +D G P  +++A + + ++DVND SP F    Y   + E   P+  I ++ A D+D G N ++ Y    + DTS +       + +  +I     LDRE            +VIA D G P+RS S  V + + D+NDN P FQQA Y  +F       K +  VA ++    A D D G NG VTY    + +  F ++  +G++ +  ++DRE + S Y FSI A D  ++    KT    V++++ D ND  P F   +++ Y + ++  +PVG SL+TL+   D   G NS I +++    +   FS+N+ +G L   + L   V H+    L + A D G 
Sbjct:  585 VHVSLTDLNDNQPVFDPSSYSVEYFENTRIGQSICQL-KAIDRDSPKFAITRFIIEQGNADEVFSVDGSG-----LITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIG-HVHAISRDKGTNAEVVYSISKG----NTDNIVLINSTGTLYLQSEVDHEKIPSLY-LTVQAKDKGTPPLFGYANVTIAVIDINDNSPQ--FNSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLL--SNPGTLFNLDS----NTGALSL--TKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKF------GLRNGGKIFIKSKLDREDIEE-----YNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASY--AFF-----VKENEPVATYLGAVSASDSDEGSNGHVTYRFDTQ-VAQFIVDKQTGKITTSQVLDREAKAS-YVFSIVATDGGSSPRVDKT---QVTVIVRDVNDCSPKF---SKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAGPK--AFSLNQVTGVLTLVSPLDREVTHR--HILHVVASDKGG 1200          

HSP 4 Score: 170.244 bits (430), Expect = 1.799e-42
Identity = 201/680 (29.56%), Postives = 319/680 (46.91%), Query Frame = 1
Query:  373 ILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNN-ISYY---KIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLD--INANVTYRFSLNVP-FIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDS-GMDGKFNCSILE-PKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKD-FGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIA-IQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGS-TTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRET-LLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLV---PVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQ 2364
            +LE++++D ND  P +   S    V+E T  DS  +E+  A D D   N  ISY    K++ TSK+          G K F+K +  +DRE I  +N+ ++A+D GTP ++ S  + + + DVNDN P F+ + Y   +  N  + + L   + A+D D   N +VTYRF   V  FIV            +   + L  E  AS Y FSI A D G      KT VT+ +++ N   P      N   + + E+  +G  +LT +  D+D  G +      I+  PK + +        ++   +++L++    DREV  R  L +   D  G  +  T   I I ++DVNDN P F  E    T+ E+      +A + A D D G N ++RY+I    +    +   K+     +I+ +++LD E      R+V   +V ATD G+ Q+  S   V+I + D NDN P F +        E+     N   V    AHD D G+N  + Y+I  ++    FK+N  +G + +   +DRE + S+Y+  + A D       R   T ++ I+I+D NDN P F+  N       L+Y++   P    VT + A+D D+G    +++ +        FS++  +G L     L      + TL I A D GSP LT+ Q
Sbjct:  897 MLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEV-VATDVDSGENGRISYAFDSKVD-TSKFGL------RNGGKIFIKSK--LDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLG-AVSASDSDEGSNGHVTYRFDTQVAQFIVDKQ------TGKITTSQVLDREAKAS-YVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPK--FSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAGPKAFSL--------NQVTGVLTLVSP--LDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNT----DGTFKINETTGVISTLRALDFEVTN---RYVL--RVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENVPINTN---VTTIKAHDDDSGLNSRIWYTIDSQSPRAHFKINSETGLIQTTHPIDRE-EISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRN-------LTYVMEDEPFNFQVTSITALDPDTGQGGNVEYRIVSPDTG-KFSLDLKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPLTSYQ 1525          

HSP 5 Score: 160.614 bits (405), Expect = 1.600e-39
Identity = 181/667 (27.14%), Postives = 303/667 (45.43%), Query Frame = 1
Query:  376 LEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHP-NNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGID-RELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDI--NANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDG----KFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDD-GLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTT-VSIELMDINDNIPVF--QQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVR-ETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYL-VPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAID 2334
            + I ++D NDN PQ++ +SI++ + E+T +   +  +    D+D      +S+  +      F +    SN G    L L + ID       + + + A DGG+P ++ +  L +K++DVND  P+F +  YT  +      +S + +++ ATD+D   N  ++Y F   V       F L     I  +K  L  E    EY   + A+DHG P   S   V + + + N   P          ++  EN+ +   +      D+D G +G    +F+  + +         ++K   +      + T+++ DRE K      I   D G        ++++I+ DVND SP+F K  Y  T+ E+     ++  L A D D  G N+ + Y I      +  N++  V     +  +  LDRE      R +    V+A+D G  Q   + T + I ++D+NDN PVF  +  F  +      GS      VA  +A D D G NG V Y IV   T   FK+N  +G + +   +D E   ++Y   ++A D       +KT+   V+I +ED NDN P F    + N  I   Y  VP+ + VT +KA D DSG+NS+I + ++ +     F IN  +G + T+  +      E +L ++A D
Sbjct:  793 VTIAVIDINDNSPQFNSSSILVRLPEDTPIGHTFYTV-SVFDADSGVLGRVSFSLLSNPGTLFNL---DSNTGA---LSLTKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNI-IEVVATDVDSGENGRISYAFDSKVD---TSKFGLRNGGKIF-IKSKLDREDI-EEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVK--ENEPVATYLGAVSASDSDEGSNGHVTYRFDTQVAQ-------FIVDKQTGK------ITTSQVLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAGPKAFSLNQVTGV-----LTLVSPLDREVT---HRHIL--HVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSV-----VAAVLAVDSDQGDNGKVRYKIVNGNTDGTFKINETTGVISTLRALDFEVT-NRYVLRVSATD--MGKKQQKTSYQLVTIYVEDANDNRPTF----DKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQSPRAHFKINSETGLIQTTHPIDREEISEYSLKVRATD 1409          

HSP 6 Score: 143.665 bits (361), Expect = 2.381e-34
Identity = 174/682 (25.51%), Postives = 291/682 (42.67%), Query Frame = 1
Query:  373 ILEIQILDENDNVPQWSQNSIV---IEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQD---CFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITN-KIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAH----DPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEE-TLFIKAIDCGSPRLTAIQQLTIEI 2382
            I+ I++LD NDN P    +  +    +V EN  + +    +    D+D   N      +E    YF +  +  N   +  + + + +DRE      +  + +D G P +T      I + DVND  P F+   Y   +  N  +N TL   ++A D D  +N    +++      +     F ++P + ++     L  E    +   ++   D G P      +V ++L + N   P       NA   + EN   G  ++  + +D D G +     SIL P N    L   K          L+TN +  D EV++     +   D G  + N  A + + + D+NDN P F+   Y    FE  +   +I QL A D D    A  R+ I+   +    +++  V+ +  I   + LDRE   N         V A D G         V+I ++D+ND  P+F +A YN +  E      +S+ ++V I H      D G N +V YSI +       L  ++G LY    VD E  PS Y  ++ A+D  T  L+      +V+I + D NDN P F   N S+  ++L    P+G     V   D DSG+  ++ F L       LF+++  +G L  + ++   +     TL ++A D GSP  ++   L +++
Sbjct:  264 IVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARV-SVSDADSGKNGEVNVTLEGGDGYFSMKFDVLND--ESIIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVN-TLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIP-QVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNA--SLFENSPSGSPVVQLLAQDPDIGENSLILYSILTP-NTPFFLDPRK---------GLVTNSRTLDHEVQSSYTFQVAATDGGGRSCN--ATVHVSLTDLNDNQPVFDPSSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNA----DEVFSVDGSGLITLAKLLDRETQDNYL-----LTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQE------HSQALSV-IGHVHAISRDKGTNAEVVYSISKGNTDNIVLINSTGTLYLQSEVDHEKIPSLY-LTVQAKDKGTPPLF---GYANVTIAVIDINDNSPQF---NSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSNP-GTLFNLDSNTGALSLTKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKV 902          

HSP 7 Score: 137.117 bits (344), Expect = 2.492e-32
Identity = 167/691 (24.17%), Postives = 297/691 (42.98%), Query Frame = 1
Query:  286 DNLELCAYRNVNFSCIWRGILFCGTNNLKILEIQILDENDNVPQWSQNSIVIEVVENT-KLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFE-------------SSFYTQSIDCNLEINSTLD-------------LKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMD-GKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQ-SLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYN-ISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLP-FKLNPNSGELYSYDLVDRE-TQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSG 2262
            D L+  + +N     +     +   N   IL+I ++D NDN P +  ++++ ++ E+T      ++    A D D   N    Y I  T     + +  S  G     KL   +DRE  +  ++ +   D G P K+ + Q+ + + D+NDN P+F+              +  T  +  + +  S L              L++ ATD D  +N   ++S  +    Q  + ++    ++  ++++      S  +  + A+D G P +++   V + +  +    P   LP  +   ++ EN  +G  +LT  V DN +G+  G+ + +I E  NY  I        +   +IS+  NK  D E K R  L++   D   P+      + I + DVND  P F +  Y     E       +  ++A D D G N ++ + IQ      D      ++    +I  Q +LD E             V ATD G P      +V+I ++D+NDN PVF+    N +  LE+     NSR   +  A D D G N  ++++++  T    F ++  SG L +    D E T   QY+ +I A D+    L   ++ +++ + + D ++ +P F   N  +YK  +     +G  V  V A D+DSG   ++ F+      N L  +N T+G
Sbjct: 2023 DALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIW-TGNEAGVFTIDSTTGEITTAKL---LDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIIITRE----PKFELP--SYFGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNI-ENSNYFRI-------GQRSGVISV--NKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSG----DDKGSFAIDRKTGVIRTQRALDHETIKTHH-----VSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLENL--PLNSRLYEIN-ATDRDSGANARLSFTVIGGTGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPL---SSNITIIVNVADEDEYDPSF---NRMDYKFDVPGNAKIGDFVGQVTATDRDSGDQGRVFFVFYNPTSNAL-KMNATTG 2674          

HSP 8 Score: 121.324 bits (303), Expect = 1.640e-27
Identity = 161/606 (26.57%), Postives = 262/606 (43.23%), Query Frame = 1
Query:  622 IDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDL-------NPFNAILRVKKS---LKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKP-AFNTSAEXXXXXXDVNDNSPQFEKEFY---HYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAI-QSLDREKYPNGF-RFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIV-----RETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTI 2376
            +DRE +S +N+T+  V+  TP K  S  +L+ + D+NDN P F     T +     E +     K+ A D D  +N T  +++ V   V + F L           A L V  S   +  E   S Y  +I A D G P       +++ +++ N   P       +  I   EN D+G  IL     D D G + +   SI    +   I  ++ T         ++ N   D E K    +++  +D G     ++SA + I ++DVNDN+P     +     Y + E       +A+++  D D G N ++   ++     +  +    V ++  IIA+ QSLDRE + + F + VC       D G+P R+   +  I + D+ND  P F +  Y     E+      +  VA+  A D DFG N ++ Y+I      R  L  F ++P+SG + +   +DRE  P Q   ++   D  +  L   +   SV + + D NDN+P F   N+S+Y   L    P GS V  + A D D G NS I + +     N  F ++   G +  S  L    +   T  + A D G     A   +++
Sbjct:   20 LDREKVSAYNLTI--VEFSTPPK--SYTVLVYVQDLNDNSPSFVRG--TSAKLVVFENDKDFRQKLIAVDSDFGSNSTQSYTI-VSGNVGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDS-YVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIP--ENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQAIFGIHPTTG------VIVNNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYF--SMKFDVLNDESIIAVGQSLDRETHDHFFLKAVC------IDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWEN---ATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIP-QVVLTVLVHDRGSPPL---SDNCSVIVNLTDSNDNDPYF---NQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSILTP--NTPFFLDPRKGLVTNSRTLDHEVQSSYTFQVAATDGGGRSCNATVHVSL 589          

HSP 9 Score: 119.013 bits (297), Expect = 8.678e-27
Identity = 159/608 (26.15%), Postives = 262/608 (43.09%), Query Frame = 1
Query:  364 NLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDE-HPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQ-DCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDF--GVNGDVTYSI--VRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKA 2169
            N   L+I I D NDN P++   ++   V+E+   + F +    A D D     N+ Y  + P +  F +  +         LKL   +D E +  + + + A D G+P  T      + ++DVNDN P F    +  ++  N    +++ +K+ A D D  +N    +S  +P  V+ D F ++  + ++     L  E     Y  ++ A     P   S T+V +++ ++N  PP  + P     +++ EN     +I T  V+D D G + K   SI+   N D   T+ ++  E      L T    DRE K   QL +  KD   P +   A I+I I D NDN P F++  Y  TI E   P  +I  LTA D D G N  + Y +  DT       +  ++S   I+   +         + F C    IA D G+  +     V I++ D N++ P F +  Y +     F +   S  V +  A D D     NG VTY +   + +   F +  N+G + +        Q  ++   I A D  +  L        V IVI +  D+ P F+  N++  ++ +     VGS +T V+A
Sbjct: 1420 NTATLKIIIQDLNDNAPKFVSRNLTY-VMEDEPFN-FQVTSITALDPDTGQGGNVEYRIVSPDTGKFSLDLKTG------VLKLIGSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSV-VKVTAYDRDSGSNAELTYS--IPSGVEMDKFSIDKHSGLIVTNSILDREK-KDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFISP--VVTLKVPENSP-ARLIYTLTVQDLDYGNNTKVLYSIMS-GNTDGAFTIGRSTGE------LSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSNDTY-----GVYSIDSRTGIVYSAARFETSIKQEYNFFC----IAKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHI---FPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSKNSTSLFVVESNTGSVRTSAGFSNPPQ-GRHALYIIAEDHGSPPLRGYGI---VQIVIGNIQDDPPRFL--NQTPARVSIPENSKVGSYITTVRA 1987          

HSP 10 Score: 110.923 bits (276), Expect = 2.112e-24
Identity = 174/756 (23.02%), Postives = 311/756 (41.14%), Query Frame = 1
Query:  265 SGLIDRDDNLELCAYRNVNFSCIWRGILFCGTNNLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKA-RDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQ-SIDCNLEINSTLD-LKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKS--LKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVK----DNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFE---------------------------KEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRY------------RIQWDTSLYDPNKLIKVESNCQIIAI--QSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEI 2382
            +G++      E    +  NF CI +         +  + I+I D+N++ PQ+++    + +  NT   +    +     D+D+  N    Y+++ +     +   +SN G    ++   G        H + ++A D G+P   G   + I I ++ D+ P F +    + SI  N ++ S +  ++  A+    +A VTY     +       F ++PF  ++ V  +  L +E     +R  + A   G         + +++ ++N   P+     +N + ++ E  D G      VVK    D DSG +GK   SI    N   + T++ T  E      + T K+ DRE      L+I   D G P  +T+ ++ +++ D+NDN P F+                           +    Y +   + P   I +++A D D G NAQ++Y            +I  DT +    + I V      I I  Q++D+   P   R +   ++I T   EP+         EL      +P  + A    S L        + +V    A  P     G ++Y+I  E    F++   SG +     +D ET+  ++   ++A D   +    K   V V I + D ND +P+F    +S Y  Q S  +PVG++V  V A DKDSG N ++ F ++       F+I+  +G + T   L         + ++A D GSP +     +TI +
Sbjct: 1803 TGIVYSAARFETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSKNSTSLFVVESNTG---SVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPARVSIPENSKVGSYITTVRARASS---DAQVTYSI---ISGNKGRAFYVDPFTGVISVASADALDYES-TKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPA--FHPSNMLAQLAE--DTGAFKPRFVVKVTATDVDSGTNGKVTYSIWT-GNEAGVFTIDSTTGE------ITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQ--RALVYVRIIITR--EPK--------FELPSYFGKVP--ENAMMGTSVL--------TVRVTDNAAGLP----LGRISYNI--ENSNYFRIGQRSGVISVNKPLDYETK-RRFLLVVSAID---DTAPSKPVRVPVYINVSDVNDEKPVF---GQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRV 2502          

HSP 11 Score: 94.3597 bits (233), Expect = 2.765e-19
Identity = 175/703 (24.89%), Postives = 290/703 (41.25%), Query Frame = 1
Query:  373 ILEIQILDENDNVPQW-SQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKG----IKPFLKL-----RRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFE-SSFYTQSIDCNLEINSTLDLKIHATDLD--INANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNC--------SILE--------PKNYDIILTMNKTKSENIAI-ISLITNKIFDR---EVKTR---IQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLN-AQLRYRIQWDTSLYDPNKLIKVESNCQIIAI-QSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVR-ETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKG--EETLFIKAIDCGSPRLTA 2358
            I++I I +  D+ P++ +Q    + + EN+K+ S Y+   +AR S +    ++Y  I              NKG    + PF  +        +D E      + L+A   G  S  G + L I +ID NDN P F  S+   Q  +          +K+ ATD+D   N  VTY         V   F ++     +   K L  E  AS +   I   D G P + +   V + + + N  PP +  P +   IR  E+   G V+ + V  D D      +N         +IL           N  I  +   T S+ I   I   T  I  R   +V+ R   IQ+ +   D G P         + +  +    P+FE   Y   + E      ++  +   D   GL   ++ Y I+        +   ++     +I++ + LD   Y    RF+    V A D   P +     V I + D+ND  PVF Q+ Y   + E          V+   A D D G NG V ++I   +    F ++  +G + +   +D ET  + +  S+ A D  +  ++     VSV+I + D NDN P+F  P  ++  +Q+   +P+ S +  + A D+DSG N+++ F +       LF I++ SG L T+      +    + +L IKA D G+P L++
Sbjct: 1947 IVQIVIGNIQDDPPRFLNQTPARVSIPENSKVGS-YITTVRARASSDA--QVTYSII------------SGNKGRAFYVDPFTGVISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGV---FTIDSTTGEITTAKLLDRETTAS-FDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPP-LFDPLSEVNIR--EDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPP----QRALVYVRIIITREPKFELPSYFGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNIE-------NSNYFRIGQRSGVISVNKPLD---YETKRRFLL--VVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVS---AADKDSGANGRVWFAIQSGDDKGSFAIDRKTGVIRTQRALDHETIKTHH-VSVRATDEGSPPMHTD---VSVTIRVLDLNDNPPVFRVPGPND--VQVLENLPLNSRLYEINATDRDSGANARLSFTVIGGTGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSS 2602          

HSP 12 Score: 93.9745 bits (232), Expect = 3.060e-19
Identity = 149/583 (25.56%), Postives = 227/583 (38.94%), Query Frame = 1
Query:  622 IDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTA--HDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVF-QQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVR-ETLLPFKLNPNSG--ELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPV--GSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSP 2346
            +DRE    + +T+ A     P +  S  + I ++D NDN P F S   T  +  N        L +   DLD   N    +S+ +       F +      L     L  E  AS Y+ S+ A D   P   +   +T+ +++QN  PP       ++ I   E    G  IL     D DSG +G      L    Y +    ++T         + +   F+  +K         KD G+        + I I D N+++PQF K  Y   IF     +  +  +TA   D D   N ++ YR+       +   L  VESN   +   S      P G   +    +IA D G P   G   V I + +I D+ P F  Q    +S  E+  SK  S    V      D      VTYSI+       F ++P +G   + S D +D E   S   F +    +P   +      + + I + D NDN P F   + SN   QL+          V  V A D DSG N ++ + +       +F+I+ T+GE+ T+ +L         L I+  D G P
Sbjct: 1604 LDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFISPVVTLKVPENSPARLIYTLTVQ--DLDYGNNTKVLYSI-MSGNTDGAFTIGRSTGELSTTTKLDRETKAS-YQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTIS--ELTPPGTSILNLTASDKDSGSNGNI-VYTLSNDTYGVYSIDSRTGI-------VYSAARFETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLD---DSKNSTSLFVVESNTGSVRT-SAGFSNPPQGRHALY---IIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPARVSIPEN--SKVGSYITTVRARASSD----AQVTYSIISGNKGRAFYVDPFTGVISVASADALDYE---STKNFRLHLVATPQGWVSLNGYMI-LDINVIDRNDNSPAF---HPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGVFTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIP 2152          
BLAST of Protocadherin alpha-11 vs. Ensembl Nematostella
Match: EDO34815 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN97])

HSP 1 Score: 191.815 bits (486), Expect = 3.435e-50
Identity = 199/726 (27.41%), Postives = 331/726 (45.59%), Query Frame = 1
Query:  265 SGLIDRDDNLE---LCAYRNVNFSCIWRGI-LFCGTNNLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKY--FFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTP-SKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDL--KIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVK----KSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGK--FNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAI-QSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQP----SQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEI 2382
            +G+I    NLE     +Y N+       G+  F  T  + I+   + D NDN P ++  +    V EN+ + +  L++  A D+D   N    Y +     +  F   ++ SN G    +++   +DRE+  ++N+T+ A DGG P S+T     L++I+D NDN P F  + YT SI  N      + +   I ATD DI +N   R+ LN    +Q  F +NP   ++  +     SL HE   + Y F + A D      +S   V +H+ + N   P  +     + I   E   IG  +      D DSG++G+  F+ +      ++I       +S+ +  +S       DRE K    L +   D           +++ + DVNDN+P+F K  ++  + E       I   TA D D G NA + Y + +            + SN   + I + LDRE      +    + V A D G  + +    V++E+ D NDN P F    Y    ++          V    A D D G NG VTY+I+   +LPF + P++G + +   +DRE Q       Y  +++  D   + + + T+   ++I + D NDN+P F   N+S Y   +   +PVG+ VT+V A D+DSGINSQI + L     + +FSI  ++G++     ++   K    + I A D G+P L++  ++ + +
Sbjct:   63 TGMIKTARNLERQQTFSY-NLTIGAADHGLPSFSATTRVSIV---VGDLNDNNPVFNPTNYSTTVFENSPVGTSLLDV-TATDADSGQNAYVTYSVTAGDSHGLFRAVTKVSNHGT---IEVAGNLDREVNDFYNLTITATDGGVPISRTAIAIALVRILDRNDNVPKFSHARYTGSIQENSGPGVPVQMASSIMATDRDIESNADVRYRLNGSDSIQ--FAVNPRTGVITTRVSPPPSLDHER-TTNYTFHVIAADQAGTGHESLAEVVIHVLDANDNTPRFIPSSIQSTIS--EAASIGQSVARVTANDPDSGLNGRIFFSINSGSEGKFEI------GRSDGVVRVS----GSLDREAKAVYVLNVSAIDGSYSPREGYGTVTVTLQDVNDNTPKFTKPAFNVDVSEGVAVGSVIVNATATDPDQGSNAAITYSMSY--------PGFAINSNTGSVTITRPLDRET-----KQAYSFTVHARDGGGLESN--VAVNVEIGDENDNSPQFPTVQYQTDVID---RTPVGTIVLAVNAEDRDVGNNGHVTYAIL---ILPFIIVPDTGNINTSSKLDREQQSLYTLVHYVLNLSVTD---HGVTQFTSFALLNISVTDFNDNQPQF---NQSEYSATVLENMPVGTKVTMVTARDEDSGINSQIMYSL--TGGDGVFSIEPSTGQIRLQKAINREAKENYHVTITASDRGTPVLSSDAKVHVHV 736          

HSP 2 Score: 161.384 bits (407), Expect = 1.999e-40
Identity = 186/757 (24.57%), Postives = 315/757 (41.61%), Query Frame = 1
Query:  127 IFENLPVGSVICKLS--------NVIIPRPSDTTKFKLIKNRFFQIENGDNLKVSGLIDRDDNLELCAYRNVNFSCIWRGILFCGTNNLKILEIQILDENDNVPQWSQNSIVIEVVENT------KLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVI---ATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYL-VPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGS 2343
            +FEN PVG+ +  ++        N  +           +     ++ N   ++V+G +DR    E+  + N+  +    G+    T  + I  ++ILD NDNVP++S       + EN+      ++ S  +    A D D   N    Y++  +    F  + ++   I   +     +D E  + +   ++A D          +++I ++D NDN P F  S    +I     I  ++  ++ A D D   N    FS+N     +  F++   + ++RV  SL  E  A  Y  ++ A+D      +   TVT+ L++ N   P    P  N  + + E   +G VI+     D D G +     S+  P        +N          S+   +  DRE K      +  +D G     ++  +++ I D NDNSPQF    Y   + +       +  + A D D G N  + Y I     L  P   I V     I     LDRE+      +   + V+    TD G  Q +    ++I + D NDN P F Q+ Y+ + LE+        KV +  A D D G+N  + YS+     + F + P++G++     ++RE +   Y  +ITA D  T +L   ++   V + + D NDN P+F       Y+  +S      G  V  V A D D   N  + + +       +F+INET+G + T  VL+   K   TL + A D G+
Sbjct:  123 VFENSPVGTSLLDVTATDADSGQNAYVTYSVTAGDSHGLFRAVTKVSNHGTIEVAGNLDR----EVNDFYNLTITATDGGVPISRTA-IAIALVRILDRNDNVPKFSHARYTGSIQENSGPGVPVQMASSIM----ATDRDIESNADVRYRLNGSDSIQFAVNPRTGV-ITTRVSPPPSLDHERTTNYTFHVIAADQAGTGHESLAEVVIHVLDANDNTPRFIPSSIQSTISEAASIGQSV-ARVTANDPDSGLNGRIFFSINSG--SEGKFEIGRSDGVVRVSGSLDREAKAV-YVLNVSAIDGSYSPREGYGTVTVTLQDVNDNTPKFTKPAFN--VDVSEGVAVGSVIVNATATDPDQGSNAAITYSMSYPG-----FAINSNTG------SVTITRPLDRETKQAYSFTVHARDGG--GLESNVAVNVEIGDENDNSPQFPTVQYQTDVIDRTPVGTIVLAVNAEDRDVGNNGHVTYAI-----LILP--FIIVPDTGNINTSSKLDREQQS---LYTLVHYVLNLSVTDHGVTQFTSFALLNISVTDFNDNQPQFNQSEYSATVLENM---PVGTKVTMVTARDEDSGINSQIMYSLTGGDGV-FSIEPSTGQIRLQKAINREAK-ENYHVTITASDRGTPVL---SSDAKVHVHVLDVNDNPPVFT---SRVYERTMSEGNAAAGEFVVQVNATDADVERNGHVTYTIMHGALG-MFTINETTGVIRTQGVLNRESKDFYTLIVMARDQGA 828          

HSP 3 Score: 159.458 bits (402), Expect = 8.721e-40
Identity = 187/711 (26.30%), Postives = 305/711 (42.90%), Query Frame = 1
Query:  412 PQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKI------EPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASE-------YRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQD----IGVVILTGVVKDNDS-GMDGKFNCSILEP-----KNYDIILTMNKTKSENIAI---ISLITNKI-----FDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNIL-FSINETSGELLTSTVLSVIHKGEETLF-----IKAIDCGSPRLTAIQQLTIEIGEFRNPDSTPFNETEES 2433
            P ++  S      E +      +   KA DSD+  N    Y I      +P S   F  +   N G+   +K  R ++R+    +N+T+ A D G PS + + ++ I + D+NDN P+F  + Y+ ++  N  + ++L L + ATD D   N    +S+       D   L  F A+ +V      E   +        Y  +I A D G P+ ++   +                    A++RI++  D          TG +++N   G+  +   SI+        N D+   +N + S   A+     +IT ++      D E  T     +   D       + AE+ I ++D NDN+P+F       TI E      ++A++TA+D D GLN ++ + I   +      K     S+  +    SLDRE      + V    V A D     R G  TV++ L D+NDN P F +  +N+   E  G    S  V    A DPD G N  +TYS+   +   F +N N+G +     +DRET+ + Y+F++ ARD          + V+V++ I D NDN P F       Y+  +    PVG++V  V A D+D G N  + + +      IL F I   +G + TS+ L    +   TL      +   D G  + T+   L I + +F N +   FN++E S
Sbjct:    1 PVFTPASYNATFTEGSSTRGVLIATVKATDSDDGANGDVDYSIVDGNVGDPRSNSDF--TLDPNTGM---IKTARNLERQQTFSYNLTIGAADHGLPSFSATTRVSIVVGDLNDNNPVFNPTNYSTTVFENSPVGTSL-LDVTATDADSGQNAYVTYSV----TAGDSHGL--FRAVTKVSNHGTIEVAGNLDREVNDFYNLTITATDGGVPISRTAIAI--------------------ALVRILDRNDNVPKFSHARYTGSIQENSGPGVPVQMASSIMATDRDIESNADVRYRLNGSDSIQFAVNPRTGVITTRVSPPPSLDHERTTNYTFHVIAADQAGTGHESLAEVVIHVLDANDNTPRFIPSSIQSTISEAASIGQSVARVTANDPDSGLNGRIFFSINSGSE----GKFEIGRSDGVVRVSGSLDREA-----KAVYVLNVSAIDGSYSPREGYGTVTVTLQDVNDNTPKFTKPAFNVDVSE--GVAVGSVIVNA-TATDPDQGSNAAITYSM---SYPGFAINSNTGSVTITRPLDRETKQA-YSFTVHARDGG-----GLESNVAVNVEIGDENDNSPQFP---TVQYQTDVIDRTPVGTIVLAVNAEDRDVGNNGHVTYAIL-----ILPFIIVPDTGNINTSSKLDREQQSLYTLVHYVLNLSVTDHGVTQFTSFALLNISVTDF-NDNQPQFNQSEYS 649          

HSP 4 Score: 152.525 bits (384), Expect = 1.403e-37
Identity = 155/599 (25.88%), Postives = 258/599 (43.07%), Query Frame = 1
Query:  313 NVNFSCIWRGILFCGTNNLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFC-----KDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVE-SNCQIIAIQSLDREKYPNGFRFVCPYQV--IATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPI 2085
            N  F  I       G  +L  + I +LD NDN P++  +SI   + E   +      +  A D D   N   ++ I   S+  F             +++   +DRE  + + + + A+DG    + G   + + + DVNDN P F    +   +   + + S + +   ATD D  +N    +S++ P      F +N     + + + L  E     Y F++ A D G    +S   V + + ++N   P    P       +I+   +G ++L    +D D G +G    +IL      I+  +    + NI      T+   DRE ++   L+ +       D G   F + A ++I + D NDN PQF +  Y  T+ E       +  +TA D D G+N+Q+ Y      SL   + +  +E S  QI   ++++RE   N       Y V   A+D G P  S    V + ++D+NDN PVF    Y  +  E  G+      V    A D D   NG VTY+I+   L  F +N  +G + +  +++RE++   YT  + ARD    + Y    T+ V ++  D NDN PI
Sbjct:  299 NYTFHVIAADQAGTGHESLAEVVIHVLDANDNTPRFIPSSIQSTISEAASIGQSVARV-TANDPDSGLNGRIFFSINSGSEGKFEIGRSDG-----VVRVSGSLDREAKAVYVLNVSAIDGSYSPREGYGTVTVTLQDVNDNTPKFTKPAFNVDVSEGVAVGSVI-VNATATDPDQGSNAAITYSMSYP-----GFAINSNTGSVTITRPLDRET-KQAYSFTVHARDGGG--LESNVAVNVEIGDENDNSPQ--FPTVQYQTDVIDRTPVGTIVLAVNAEDRDVGNNGHVTYAIL------ILPFIIVPDTGNIN-----TSSKLDREQQSLYTLVHYVLNLSVTDHGVTQFTSFALLNISVTDFNDNQPQFNQSEYSATVLENMPVGTKVTMVTARDEDSGINSQIMY------SLTGGDGVFSIEPSTGQIRLQKAINREAKEN-------YHVTITASDRGTPVLSSDAKVHVHVLDVNDNPPVFTSRVYERTMSE--GNAAAGEFVVQVNATDADVERNGHVTYTIMHGALGMFTINETTGVIRTQGVLNRESK-DFYTLIVMARDQGA-VPYMDFGTIDVHVI--DKNDNTPI 850          

HSP 5 Score: 83.1889 bits (204), Expect = 4.248e-16
Identity = 70/283 (24.73%), Postives = 127/283 (44.88%), Query Frame = 1
Query:  229 FFQIENGDNLKVSGLIDRDD-NLELCAYRNVNFSCIWRGILFCGTNNLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDI--NANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPP 1068
            F  + +  N+  S  +DR+  +L    +  +N S    G+      +  +L I + D NDN PQ++Q+     V+EN  + +  + +  ARD D   N+   Y +      F I            ++L++ I+RE    ++VT+ A D GTP  +   ++ + ++DVNDN P+F S  Y +++           ++++ATD D+  N +VTY     +       F +N    ++R +  L  E     Y   + A D G        T+ +H+ ++N   P
Sbjct:  581 FIIVPDTGNINTSSKLDREQQSLYTLVHYVLNLSVTDHGVTQF--TSFALLNISVTDFNDNQPQFNQSEYSATVLENMPVGT-KVTMVTARDEDSGINSQIMYSLTGGDGVFSIEPSTGQ------IRLQKAINREAKENYHVTITASDRGTPVLSSDAKVHVHVLDVNDNPPVFTSRVYERTMSEGNAAAGEFVVQVNATDADVERNGHVTY----TIMHGALGMFTINETTGVIRTQGVLNRES-KDFYTLIVMARDQGAVPYMDFGTIDVHVIDKNDNTP 849          
BLAST of Protocadherin alpha-11 vs. Ensembl Nematostella
Match: EDO35412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK9])

HSP 1 Score: 187.193 bits (474), Expect = 6.668e-48
Identity = 194/683 (28.40%), Postives = 318/683 (46.56%), Query Frame = 1
Query:  376 LEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEP--TSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDC-FDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSI---LLPGNNA--VIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAI-QSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLP---FKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEE--TLFIKAIDCGS--PRLTAIQQLTI 2376
            +++Q+ D NDN P++      + + E+  +++    +  A D D   N    Y I     +  F + +     G    +  ++ +DRE   ++ + + A D GTP+  G   + I I+D ND+ P+F  + Y  SI  N +   ++ L++ A D D  +N   +++++   I  +  FDL+    ++R K++L  E   + Y F++ A D G P +    TVT+++ + N   P +    LP +N    IR  EN  I   I   +V D DS  + +    I    +          K E +    +   K  DRE+     L +   D G P+ +T   + I + DVNDNSP F    Y   I E  Q    + QL A D D+G N  + Y I     L       +V+    ++   + LDRE+  +         + A D G   ++GSTTV++ ++D NDN P F ++ Y  +  E         +V+   A D D G NG +TY I          F+LN  +G L++   +DRET+ S Y+F++ A+D     L    ++V V + I D NDN P+F +P E  Y   +    P G L+  V A D D G N+ I + +     N  FSI+ ++G  + ST+ S+ H+ EE  +L I A D G+     TA+  +T+
Sbjct:   81 VQVQVDDINDNEPRFPTLYYTLRIRESMDVNTTN-PINTATDPDAGNNGTVDYTIASGDNTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSI-LRVSAADRDSGSNGDIKYAIDWDAIQSNSIFDLDSSTGVIRTKQNLDFEV-KNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIR-SENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCF------KVEFLGFYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDL----GWFQVDFQSGLVTTAKPLDREQVSS-----VTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVS---ATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETK-SLYSFTVLAKDHGDPQLM---SSVKVELTISDINDNAPVF-YPVE--YFASIMENEPPGKLLQ-VTATDADEGTNAVISYDIIGGNNNGNFSIDSSTG--VISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTV 731          

HSP 2 Score: 181.8 bits (460), Expect = 3.449e-46
Identity = 196/717 (27.34%), Postives = 317/717 (44.21%), Query Frame = 1
Query:  265 SGLIDRDDNLELCAYRNVNFSCIWRGILFCGTNNLKILEIQILDENDNVPQW---------------SQNSIV------IEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIA-IQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDL-VDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSP 2346
            +G+I    NL+     +  F+ I         N+L  + I +LD NDN PQ                S+NS++      I V +     +   EL      DE       +K+E    YF              ++L++ +DREL+ ++N+TL   D G PS++    +LI + DVNDN P F S+ YT +I   L  N +  L+++ATD D   N T  +S+     +   F ++  + ++   K L  E  +S    +I A DHG   +   TTVT+ + + N   P  +       I   E   IG  +L     D DSG +G+    I           +N     N     L T    DRE K+     +  KD G P   +S ++ + I D+NDN+P F    Y  +I  EN+P   + Q+TA D D+G NA + Y I    +    N    ++S+  +I+ + SLD E     F  +    + A D G    + +  V++ +++  DN+PVF    YN +  E+         V    A   D   NG ++Y+IV        L  ++G +   +  +DRE + +QY  ++ AR      L   +A  +V+I + D NDN P F   + S+  + +     VG +V    A+D D+G N  +++ L      +L+ IN TSG +  +  L+   + + T+ + A D GSP
Sbjct:  262 TGVIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNGDDE-----GCFKVEFLGFYF--------------IQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANI-SELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDL-GWFQVDFQSGLVTTAKPLDREQVSS-VTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTIS--EGASIGATVLQVSATDVDSGDNGRITYEISSSD-----AQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIM-ENEPPGKLLQVTATDADEGTNAVISYDIIGGNN----NGNFSIDSSTGVISTLASLDHE-VEEFFSLI----ISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENV---PKGTLVGRVYATTKD--KNGSISYAIVSGDPTNLFLVDSTGGIIKINGDMDRE-EKAQYLLAVIARVGTVKPL---SAQATVNIEVLDRNDNAPQF---STSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSNAEGLLW-INSTSGVIKLARKLTDGDETQYTVQVLASDSGSP 926          

HSP 3 Score: 154.451 bits (389), Expect = 1.018e-37
Identity = 186/625 (29.76%), Postives = 287/625 (45.92%), Query Frame = 1
Query:  580 SNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLN----PFNAILRV--KKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFY-----HYTIFEENQP-NFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVE-SNCQIIAIQS-LDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFY--NISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLP-FKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFIL--EEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGEFRN 2397
            SN G+   +     IDRE  +  ++ L  ++   PS    + + +++ D+NDN+P F + +YT  I  ++++N+T  +   ATD D   N T  +++         F L     P  + L V  KK L  E     Y+ +I A D G P       + + + ++N + P  +   N+ +  I EN   GV IL     D DSG +G    +I    ++D I + N     + +   + T +  D EVK      +   D G P+ N  A ++I ++D NDNSPQ +  +         I  EN   N  IA +   D D   N+Q   +I       D     KVE      I +Q  LDRE  P          +  TD G P RS    V I++ D+NDN P F    Y  NIS L      +N   V    A DPD G NG V+YSI     L  F+++  SG + +   +DRE Q S  T +ITA+D  +     KT + +V++ I D NDN+P F+   +S+YK  +S    +G+ V  V A D DSG N +I + +   + + N LF +N  +G L T + L    K   +  + A D G P+L +  ++ + I +  +
Sbjct:   46 SNTGV---ISTTARIDRETTTQISLQLRTLN---PSNQ-PISVQVQVDDINDNEPRFPTLYYTLRIRESMDVNTTNPINT-ATDPDAGNNGTVDYTI-ASGDNTATFSLGTTACPTGSTLCVITKKPLDRET-TDFYQLNITATDRGTPALMGYCLINITILDENDHAP--VFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAI----DWDAIQS-NSIFDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNG----DDEGCFKVEFLGFYFIQLQKPLDRELVP-----FYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISEL-----AQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQVDFQSGLVTTAKPLDRE-QVSSVTITITAQDHGS---APKTGSTTVTVTIIDGNDNKPRFM---KSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDIND 632          

HSP 4 Score: 150.599 bits (379), Expect = 1.448e-36
Identity = 175/672 (26.04%), Postives = 296/672 (44.05%), Query Frame = 1
Query:  295 ELCAYRNVNFSCIWRG----ILFCGTNNLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKA-RDSDEHPN---NISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFY-----TQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFN-AILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQS-LDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIV-RETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSG 2262
            E   +  +N +   RG    + +C      ++ I ILDEND+ P ++QNS +  + ENTK     L +  A RDS  + +    I +  I+  S +   SS          ++ ++ +D E+ + +   ++A DGG PSK     + I ++D NDN P  + ++       ++I     + +T    I  TD D N N      +      + CF +       ++++K L  E     Y  +++  D G P   +   V + + + N   P+     N     I E    G  +L     D D G +G  + SI    +        ++         + T K  DRE  + + + I  +D G      S  +++ IID NDN P+F K  Y  TI E      T+ Q++A D+D G N ++ Y I   +S    N L ++ +   ++  +S LDRE      + +  + V+A D G+PQ   S  V + + DINDN PVF    Y  S +E+    +   K+    A D D G N  ++Y I+       F ++ ++G + +   +D E +   ++  I+A+D   N    KTA V+V+++  +  DN P+F++     Y   +   VP G+LV  V A  KD   N  I + +       LF ++ T G
Sbjct:  167 ETTDFYQLNITATDRGTPALMGYC------LINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSIFDLDSSTG-------VIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKI-TNGDDEGCFKVEFLGFYFIQLQKPLDRE-LVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPA--FTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLGWFQVDFQSG-------LVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEIS--SSDAQVNGLFELNTQTGVLWTKSQLDRET-----KSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMEN----EPPGKLLQVTATDADEGTNAVISYDIIGGNNNGNFSIDSSTGVISTLASLDHEVE-EFFSLIISAKDG-GNKYAAKTAVVNVTVL--NKADNLPVFLY---EMYNFTVYENVPKGTLVGRVYATTKDK--NGSISYAIVSGDPTNLFLVDSTGG 794          

HSP 5 Score: 147.902 bits (372), Expect = 1.051e-35
Identity = 174/683 (25.48%), Postives = 292/683 (42.75%), Query Frame = 1
Query:  376 LEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELI---SWHNVTLLAVDG---GTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVES-NCQIIAIQSLDREKYPNG---FRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDS--PTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEE-TLFIKAIDCGSPRL-TAIQQLTIEI 2382
            + I I D ND+   +  N+    V EN+   +    L           +I Y  I  +S+  F    +S +     +  R  +DRE +   +  NV ++  +     T  K     +++ + D+NDN P+F  + Y  ++   L +  +   +I A D D   N  + +SL V     D F +N     L + K+L  E   S Y   + A D       S   + + + + N   P  + P ++  + I E+  IG +++     D D G +G    SI        +  M   +S   A   LI  K  D E     +L I  +D G    +++  +++ ++DVNDN+P F  +    T+ E     F + + TA D D G NA + + +   T    P+K   V S  C+I  I ++D E  P G   F+ V    V+ATD G P+ S   ++++++ D NDN P F              +  +S  V    A DPD   NG VTYSI+      F L+P++G+L     +     P+ Y  +I A D   P+    R+T TV VS+  E      P F   + ++Y+  ++     G+ V  V A    S +N  I++ L  +     F + +++G + T+  +     G    L + A+D   P   T+   +TI +
Sbjct: 1036 VTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLI--SSESHFAVDVRSGQ-----ITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITV-SELSLPGSPVFRIKAMDADEGDNAKFFYSL-VSGTGMDKFFINSSTGELHLSKTLDRET-TSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRP--VFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGN----LAAMFDVES---ATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQT----PSKTFSVNSATCEITTIAAIDLETMPAGRDSFQLV----VMATDQGSPKLSTRKSITVQVTDENDNSPGFVS--------PPAAAAGSSLNVMTITAEDPDRNSNGKVTYSIISGNNGYFNLHPSTGQLQMIHQI--PDNPTIYQLTIQASDGGQPS----RQTQTV-VSVFKEGPIGGGPTF---SSADYQGSVTENKVAGTSVVTVLAAYPQSSLNGNIEYYLTSDSSKGGFEVVKSTGVVKTTRGIDREGMGASFNLVVYAVDKQGPSARTSSATVTITV 1673          

HSP 6 Score: 146.362 bits (368), Expect = 2.940e-35
Identity = 171/674 (25.37%), Postives = 289/674 (42.88%), Query Frame = 1
Query:  373 ILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKI--EPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKY-PNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLL-PFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEI 2382
            ++ + +L++ DN+P +        V EN    +    +  A   D++  +ISY  +  +PT+ +       S  GI   +K+   +DRE  + + + ++A  G     +    + I+++D NDN P F +S     ID    +   +     A DLD   N   R+ L      +    +N  + ++++ + L  +   ++Y   + A D G P + S  T+T+H+     +PP   L  ++ V  ++ +Q +       V  D DSG +G+   SI +     +       K        L   K   + +K    LI+   D G P+F+ S  ++I I D ND+   F    + + + E + P   +  L AH LD      + Y +    S +     + V S  QI     LDRE+   N    V   Q  A  +    +     V + + D+NDN PVF +A Y I+  E          V    A D D G N    YS+V  T +  F +N ++GEL+    +DRET  S Y   + A D+    LY   +T  + I + D ND  P+F    ES+Y + ++    +GSLV  + A DKD G N  I++ +       +F +   +G L+ +  L         L I A D G   L++   +T+ +
Sbjct:  726 VVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRV-YATTKDKN-GSISYAIVSGDPTNLFLV----DSTGGI---IKINGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVV-YNAAAVDLDAGKNGLVRYQLTSN--AEGLLWINSTSGVIKLARKLT-DGDETQYTVQVLASDSGSPPQHS--TMTIHITLSINHPPKFTL--SSYVTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYSIPQGNEEGLFGIFPGGK--------LYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISSESHF----AVDVRSG-QITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSE---LSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFFINSSTGELHLSKTLDRETT-SSYNLVVKATDASNANLY---STAKIEITVGDSNDQRPVF---PESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISNGNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNV 1359          

HSP 7 Score: 107.842 bits (268), Expect = 1.717e-23
Identity = 157/693 (22.66%), Postives = 278/693 (40.12%), Query Frame = 1
Query:  376 LEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAH-----------------DLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRE-----TQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGE 2388
            +E+ I D NDN P +        ++EN       L++  A D+DE  N +  Y I   +     S + S   I     L    D E+  + ++ + A DGG      +  + + +++  DN P+F    Y  ++  N+    TL  +++AT  D N +++Y      P    + F ++    I+++   +  E  A      I  +   +P+  ++ TV + + ++N   P      ++ ++ I     +G V+      D D+G +G     +    N + +L +N T      +I L   K+ D + +T+  + +   D G P                   PQ      H T+   + P FT++    H                 D D G N QL Y I       +   L  +    ++   +SL  +     +  +    V ATD G P  S S  V+I + D ND+  +F    +  +  E+         V   +AH  D     D+ YS++  +   F ++  SG++ +   +DRE     T  + Y     A  + T +   K   +   + + D NDN P+F   + + Y I +S L   GS V  +KA+D D G N++  + L        F IN ++GEL  S  L         L +KA D  +  L +  ++ I +G+
Sbjct:  623 VELTISDINDNAPVFYPVEYFASIMENEPPGKL-LQV-TATDADEGTNAVISYDIIGGNNNGNFSIDSSTGVISTLASL----DHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVP-KGTLVGRVYATTKDKNGSISYAIVSGDP---TNLFLVDSTGGIIKINGDMDREEKAQYLLAVIARVGTVKPL-SAQATVNIEVLDRNDNAPQ--FSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLT--SNAEGLLWINSTS----GVIKL-ARKLTDGD-ETQYTVQVLASDSGSP-------------------PQHSTMTIHITLSINHPPKFTLSSYVTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYSIPQG----NEEGLFGIFPGGKLYIRKSL-LQALKGSYDLI----VRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAEN---SSPGTLVGTLVAHALDHSRTKDIVYSLI-SSESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVI---VTVTDLNDNAPVF---SRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFFINSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGD 1256          
BLAST of Protocadherin alpha-11 vs. Ensembl Nematostella
Match: EDO48237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKF4])

HSP 1 Score: 177.563 bits (449), Expect = 8.909e-45
Identity = 180/674 (26.71%), Postives = 294/674 (43.62%), Query Frame = 1
Query:  403 DNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPT-----SKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETL--LPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGEFRNPD 2403
            +N PQ+S+      V E+ ++ +    +  A D D   N +  Y + P+     + YF I        I   +  +RG+DRE +  H   + A DGG PS  G + L I ++DVNDN PIFE + Y   I  +  I   + L + A+D D  +N   ++ +         F +   +  + V K L  E   + Y   + A D G P   +  TV + L + N   P       +A IR  E+  +  ++ T    D D G +G+    I+   + +   ++N+   E      +   +  D E+     L++  +D G+P       + I +IDVNDN+PQF    +   I E         ++ A+D D G N ++ +    +   +  N     E+   I   + LDREK P   +F   + + A D G P + G+  ++I L+DINDN P F Q  Y+ S  E+    +    V    A DPD G   +V YSIV  +     F++NP    L +            Y FS++A D     +   TA V V++   D N + P F      +Y  ++     +G+ V  V A D+D+G N++I + +        FS++ET+G + T+  L           + A D G P+L A   + I I +  + D
Sbjct:   15 NNPPQFSRLQEDASVSEDAEVGTVVATV-SASDPDSGSNGMIRYSMSPSQNLMSATYFSIDQ------ITGVITTKRGLDREFLDRHFFRVKAEDGGEPSLEGYMDLTINVLDVNDNGPIFERNIYAADIPEDKSIGDFV-LAVRASDADSGSNGEVKYCILNSDGDNSAFSIGEVSGAVTVMKKLDREKVPT-YTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIR--EDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDMN-FFSINRINGE------VRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSFMQNDLPFSIN-----ENTGGISIKEELDREKVP---KFT--FGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAEN---SRWGTSVLQVKAIDPDSGPT-NVVYSIVSSSGHDRCFRINPQG--LITLSCTLNYNTKHVYVFSVSASDG----MLSSTALVYVNVT--DSNTHAPEF---KRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSIATLVPE--FSVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDND 643          

HSP 2 Score: 166.777 bits (421), Expect = 2.076e-41
Identity = 184/689 (26.71%), Postives = 313/689 (45.43%), Query Frame = 1
Query:  376 LEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKG-----IKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLP-FKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNI-LFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGEFRNPDSTPFNE 2421
            L I +LD NDN P + +N    ++ E+  +  F L + +A D+D   N           KY  ++S+  N       +   + + + +DRE +  + + + A D G P ++ ++ + I ++DVND  P F    Y+ +I  ++ +N  L   + ATD D  +N    F + V     + F +N  N  +RVK+ L +E     +   + A D G+P   ++TTV + L + N   P  +   ++    I EN  +G         D D G +G+   S ++    D+  ++N    EN   IS+   +  DRE   +    I  +D G P    +A+I+I ++D+NDN P+F +E YH +I E ++   ++ Q+ A D D G    + Y I    S    ++  ++     I    +L+        + V  + V A+D      S +  V + + D N + P F++  Y+    ED         V   +A D D G N  ++YSI   TL+P F ++  +G + +   +DRE +   Y F +TA D     L  K+    V I I D NDN+P+F+ P   +Y+ ++   +  G  V  V A D D G N+QI +           F+I+ T G + T   L      E  L + A D G+P   A  ++ + + + +  DS P  E
Sbjct:  114 LTINVLDVNDNGPIFERNIYAADIPEDKSIGDFVLAV-RASDADSGSNG--------EVKYCILNSDGDNSAFSIGEVSGAVTVMKKLDREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQ-LVTTVRATDCDQGSNGEVFFEI-VSGNDMNFFSINRINGEVRVKQKLDYEMIGV-FNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFV--SSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSFMQ---NDLPFSIN----ENTGGISI--KEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSG-PTNVVYSI---VSSSGHDRCFRINPQGLITLSCTLNYNT-----KHVYVFSVSASDG---MLSSTALVYVNVTDSNTHAPEFKRRSYSAEVKED---ASLGTSVLTVLATDRDTGSNAKISYSIA--TLVPEFSVDETTGVIKTAGSLDRE-KVDTYRFEVTATDHGIPQLKAKSF---VYIHIADVNDNDPVFLKP---SYEAKVREDIRPGGRVIEVSASDADIGKNAQIIYSFASNGDGQGTFTIDSTQGIIRTLKPLDRETIPEYELTVVATDQGTPPGQASVKVKVILEDVK--DSPPLFE 753          

HSP 3 Score: 160.999 bits (406), Expect = 1.010e-39
Identity = 174/640 (27.19%), Postives = 280/640 (43.75%), Query Frame = 1
Query:  364 NLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDIN-ANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQII-AIQSLDREKYPNGFRFVCPYQ--VIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVR-ETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGEL 2268
            N   ++I ++D NDN PQ+  +     + EN  +   +  + +A D D   N    +        F I+       IK  L      DRE +      + A D G P K G+ Q+ I ++D+NDN P F    Y  SI  N    +++ L++ A D D    NV Y  S+        CF +NP   ++ +  +L +      Y FS+ A D    +  S   V +++ + N + P       +A ++  E+  +G  +LT +  D D+G + K + SI         L    +  E   +I   T    DRE     +  +   D G P     + + I I DVNDN P F K  Y   + E+ +P   + +++A D D G NAQ+ Y      S  D      ++S   II  ++ LDRE  P        Y+  V+ATD G P    S  V + L D+ D+ P+F++  Y ++  ED   +     V    A   D      + YSIVR  +   F +NPN+G + +   +D ETQ S+Y  ++ A  SP    + +T   +V + ++D NDN P+ +     N  +Q   + P       + A D D  ++ ++ F + E       ++N TSGEL
Sbjct:  321 NQTTVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRV-QAYDKDHGTNGEITFSFMQNDLPFSINENTGGISIKEEL------DREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSV-LQVKAIDPDSGPTNVVY--SIVSSSGHDRCFRINP-QGLITLSCTLNYNT-KHVYVFSVSASDG---MLSSTALVYVNVTDSNTHAPEFKRRSYSAEVK--EDASLGTSVLTVLATDRDTGSNAKISYSI-------ATLVPEFSVDETTGVIK--TAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIEVSASDADIGKNAQIIYSF---ASNGDGQGTFTIDSTQGIIRTLKPLDRETIPE-------YELTVVATDQGTPPGQASVKVKVILEDVKDSPPLFEKPLYEVTVPEDTPPRS---PVITVKAKSQDLSPETGMMYSIVRGNSPQVFDINPNTGAIQTLMKLDYETQ-SEYRLTVRATLSP---FFTET---TVMVYLKDINDNTPV-LEAFHMNINVQEGKVPPEARY--KIPAYDPD--VSDKLTFKVMEGNAKEWVTLNATSGEL 909          
BLAST of Protocadherin alpha-11 vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 235.728 bits (600), Expect = 1.969e-63
Identity = 221/771 (28.66%), Postives = 351/771 (45.53%), Query Frame = 1
Query:  382 IQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIE--PTSKYFFISSEKSNKGIK-PFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPF-IVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPG------NNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNC-QIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGEFRNPDS-----------TPFN-----ETEESFLSDQATFIIVGIILGTFFICCGLVTGICTMAYRRWHSSNNRSPPNQLYQAGEELTNLQY 2613
            I++ D NDN PQ+  + + I V ENT + + +  +P A D D   N ++ Y +   P +   F      ++G K P L +   +DREL   +++T+ AVDGG P +     L + + D NDN P FE   Y   +  N  +  ++ L++ A D D+  N    +SL+     V     ++    I+ VK  L  E   S   F + A D G   + SKT VT+ + +QN   P++ + G      +  +  I E+  +G  +    V D D G +    C +     + +    + T S+N     L T    D E     ++ I   D G PA +++  + + + DVNDNSP F    +     EENQP  TI  +TA D D G NA+L Y I  D+ +     L +++ N  ++ A   LDRE +   + F    +V A D G P   G+ TV I+++D NDN P F  + Y+ S LE+         V V    D D G N  V  S+  +    F +   +G + S    DRE + S YTF + A D        +++ V V+I + D NDN+P+   P+ S+++ QLS +    S V +V+A D DSG N+ + F +       LF I+ +SGE+  +  ++  H G   L ++  D G P   A   + I + E  +  S           TP +     + E SF + ++      I+ G+     G+V  I  + + R             YQAG++ T   Y
Sbjct:  120 IEVQDINDNTPQFPLSVLTISVPENTIMGALF-SIPLATDRDSERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSV-LQVKADDSDMGPNGEIEYSLHQAVDPVPKLLRIDRTTGIIYVKGPLDREEINS-LSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDST-SDNKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGDSYI---KGLFEIDPNTGEVKARTPLDRE-HKERYEF----RVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVL---DMDKGENAHVHLSVEPDGGK-FVVQNGTGTILSSISFDREKE-SSYTFRLKAVDGGEP---PRSSYVGVTINVLDENDNDPVVTKPSNSSFR-QLSPVASPDSHVDVVEAEDLDSGPNADLVFSIAGGNPYQLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYVNETISNVSLVEALVGHSLYTPLDRDIAGDPESSFAAQRSN-----ILFGSLAGVAGVVILILAVVFIRHRIQRET---KSGYQAGKKETKDLY 861          

HSP 2 Score: 140.198 bits (352), Expect = 3.344e-33
Identity = 147/541 (27.17%), Postives = 236/541 (43.62%), Query Frame = 1
Query:  373 ILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYK----IEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFE--------SSFYTQSIDCNLEINSTLDL-KIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNA---ILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQN----LYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLP-FKLNPNSGEL 1932
            +L + + D NDN P++   S   EV EN+ +    L++ KA DSD  PN    Y     ++P  K   I       GI   + ++  +DRE I+  +  ++A D G   K+    + I++ D NDN P  E         S    +I  ++ + + + L ++   D   NA VT   + +VPF ++   D    N     L+    L +E    EYR  I A+D G P   S  ++ + + + N    ++ P+I        +   E    G  IL     D DSG + +   +I+       +  ++    E  A   L      DRE K R +  +   D G P    +A + I ++D NDN P+F    Y +++ E   P   +  +T  D+D G NA +   ++ D       K +       I++  S DREK  + + F    ++ A D GEP RS    V+I ++D NDN PV  +   N SF +          V V  A D D G N D+ +SI        F+++P+SGE+
Sbjct:  229 LLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQV-KADDSDMGPNGEIEYSLHQAVDPVPKLLRID---RTTGI---IYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSTSDNKRKYFLQTTTPLDYERV-KEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIF------EVDFAEENQPGETILDVTATDADSGTNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPL------DREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVHLSVEPDG-----GKFVVQNGTGTILSSISFDREKE-SSYTF----RLKAVDGGEPPRSSYVGVTINVLDENDNDPVVTKP-SNSSFRQLSPVASPDSHVDVVEAEDLDSGPNADLVFSIAGGNPYQLFRISPSSGEI 738          
BLAST of Protocadherin alpha-11 vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 235.728 bits (600), Expect = 8.208e-63
Identity = 203/680 (29.85%), Postives = 320/680 (47.06%), Query Frame = 1
Query:  382 IQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIE--PTSKYFFISSEKSNKGIK-PFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPF-IVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPG------NNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNC-QIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGE 2388
            I++ D NDN PQ+  + + I V ENT + + +  +P A D D   N ++ Y +   P +   F      ++G K P L +   +DREL   +++T+ AVDGG P +     L + + D NDN P FE   Y   +  N  +  ++ L++ A D D+  N    +SL+     V     ++    I+ VK  L  E   S   F + A D G   + SKT VT+ + +QN   P++ + G      +  +  I E+  +G  +    V D D G +    C +     + +    + T S+N     L T    D E     ++ I   D G PA +++  + + + DVNDNSP F    +     EENQP  TI  +TA D D G NA+L Y I  D+ +     L +++ N  ++ A   LDRE +   + F    +V A D G P   G+ TV I+++D NDN P F  + Y+ S LE+         V V    D D G N  V  S+  +    F +   +G + S    DRE + S YTF + A D        +++ V V+I + D NDN+P+   P+ S+++ QLS +    S V +V+A D DSG N+ + F +       LF I+ +SGE+  +  ++  H G   L ++  D G P   A   + I + E
Sbjct:  197 IEVQDINDNTPQFPLSVLTISVPENTIMGALF-SIPLATDRDSERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSV-LQVKADDSDMGPNGEIEYSLHQAVDPVPKLLRIDRTTGIIYVKGPLDREEINS-LSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDST-SDNKRKYFLQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGDSYI---KGLFEIDPNTGEVKARTPLDRE-HKERYEF----RVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVL---DMDKGENAHVHLSVEPDGGK-FVVQNGTGTILSSISFDREKE-SSYTFRLKAVDGGEP---PRSSYVGVTINVLDENDNDPVVTKPSNSSFR-QLSPVASPDSHVDVVEAEDLDSGPNADLVFSIAGGNPYQLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYVNE 855          

HSP 2 Score: 140.584 bits (353), Expect = 3.377e-33
Identity = 147/541 (27.17%), Postives = 236/541 (43.62%), Query Frame = 1
Query:  373 ILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYK----IEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFE--------SSFYTQSIDCNLEINSTLDL-KIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNA---ILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQN----LYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLP-FKLNPNSGEL 1932
            +L + + D NDN P++   S   EV EN+ +    L++ KA DSD  PN    Y     ++P  K   I       GI   + ++  +DRE I+  +  ++A D G   K+    + I++ D NDN P  E         S    +I  ++ + + + L ++   D   NA VT   + +VPF ++   D    N     L+    L +E    EYR  I A+D G P   S  ++ + + + N    ++ P+I        +   E    G  IL     D DSG + +   +I+       +  ++    E  A   L      DRE K R +  +   D G P    +A + I ++D NDN P+F    Y +++ E   P   +  +T  D+D G NA +   ++ D       K +       I++  S DREK  + + F    ++ A D GEP RS    V+I ++D NDN PV  +   N SF +          V V  A D D G N D+ +SI        F+++P+SGE+
Sbjct:  306 LLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQV-KADDSDMGPNGEIEYSLHQAVDPVPKLLRI---DRTTGI---IYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSTSDNKRKYFLQTTTPLDYE-RVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIF------EVDFAEENQPGETILDVTATDADSGTNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPL------DREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVHLSVEPDG-----GKFVVQNGTGTILSSISFDREKE-SSYTF----RLKAVDGGEPPRSSYVGVTINVLDENDNDPVVTKP-SNSSFRQLSPVASPDSHVDVVEAEDLDSGPNADLVFSIAGGNPYQLFRISPSSGEI 815          
BLAST of Protocadherin alpha-11 vs. Ensembl Medaka
Match: si:ch73-379j16.2 (si:ch73-379j16.2 [Source:ZFIN;Acc:ZDB-GENE-141215-68])

HSP 1 Score: 211.46 bits (537), Expect = 1.861e-56
Identity = 188/661 (28.44%), Postives = 322/661 (48.71%), Query Frame = 1
Query:  133 ENLPVGSVICKLSNVIIPRPSDTTKFKLIKNRF--------FQI-ENGDNLKVSGLIDRDDNLELCAYRNVNFSCIWRGILFCGTNNLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLD--INANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVE-SNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISF------LEDFGSKKNSRKVAVFI-AHDPDFGVNGDVTYSIVRETLLP-FKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIV 2055
            E + VGSV+    NV      D +  K  + R         F++ EN   L V   IDR++  E  +   +N   +    +      +  + ++I+D NDN P +      +++ E+T     + ++P ARD D   N +  YK+   ++YF +   +  +   PFL L++ +DRE  + H + L AVDGG+P K+G+L + + ++D NDN PIF    Y+  I+ N+++ S + + ++ATDLD  +NA+V Y F   +   + + F +N  +  + VK  +  E  A  Y+  + A D G+P   +   V + + +QN   P I +   +  +   E+   G V+    + D DSG++GK  CS+ +   +D    +  +  EN  + SL+  +  DRE  +   ++I   D G+P  +T   +SI + DVNDN P+F +      + E N P   I  ++A D D   NA L Y ++ DT        + +     +I A++S D E     F+F     V+ATDSG P  S + TV++ ++D NDN PV     Y +S       +E+     N+  +   + A+D D G NG + +S+ + T    F L+  +G++ +      ET  +++   I  +D+  N+    TATV V +V
Sbjct:   38 EEVKVGSVV---GNVARDLGLDISSLKDRRARVVSGNEDAQFEVNENNGVLYVRKNIDREEICESISPCLINLKIVAEKPM-----EIHYVAVEIMDVNDNSPSFQDGEKTLDISESTPAGKRF-QMPTARDPDVALNTVRMYKLN-QNEYFNVKVREGEEDKIPFLVLQKPLDREKHAEHKLILTAVDGGSPPKSGTLNVTVTVLDTNDNSPIFTQEIYSAIINENIKVGSNV-ITVNATDLDEGVNADVEYSFGGELDPQIYEIFSINKHSGEISVKGEIDFEK-AEVYKLDVHASDKGQPPMNADCRVIIKVLDQNDNLPEIEVTSLSKSVS--EDSKPGTVVSLISITDRDSGLNGKVICSLQDSVPFD----LKPSFQEN--MYSLVVKQPLDRESVSHYDILITATDCGQPTLSTFKTVSIDVADVNDNKPEFTQNPVELYLTENNTPGNVICSVSALDKDLNENAILTYVVRGDTGQLISAAFLNINPETGEISALKSFDFESVKT-FQF----HVVATDSGSPPLSSNVTVNVFILDQNDNAPVI---LYPVSSNGSAEGVEEIPRNVNAGHLVTKVRAYDADIGYNGWLLFSLQQVTDHSLFALDRYTGQIRTLRSF-TETDEAEHKLLILVKDN-GNVSLSATATVIVKLV 668          

HSP 2 Score: 147.132 bits (370), Expect = 1.380e-35
Identity = 169/622 (27.17%), Postives = 285/622 (45.82%), Query Frame = 1
Query:  583 NKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQ-LLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVT--YRFSLNVPF---IVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSI---LEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVI--ATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRET--LLP---FKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVP----VGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGE 2388
            N G+   L +R+ IDRE I       L        K   +  + ++I+DVNDN P F+    T  I  +        +   A D D+  N    Y+ + N  F   + +   D  PF   L ++K L  E  A E++  + A+D G P +     VT+ + + N   P       +A+I   EN  +G  ++T    D D G++     S    L+P+ Y+I  ++NK   E I++   I     D E     +L +   D G+P  N    + I ++D NDN P+ E      ++ E+++P   ++ ++  D D GLN ++   +Q D+  +D     + E+   ++  Q LDRE        V  Y ++  ATD G+P  S   TVSI++ D+NDN P F Q    +   E+         +    A D D   N  +TY +  +T  L+      +NP +GE+ +    D E+  + + F + A DS +  L   ++ V+V++ I D NDN P+ ++P  SN   +    +P     G LVT V+A D D G N  + F L++   + LF+++  +G++ T    +   + E  L I   D G+  L+A   + +++ E
Sbjct:   81 NNGV---LYVRKNIDREEICESISPCLINLKIVAEKPMEIHYVAVEIMDVNDNSPSFQDGEKTLDISESTPAGKRFQMPT-ARDPDVALNTVRMYKLNQNEYFNVKVREGEEDKIPF---LVLQKPLDREKHA-EHKLILTAVDGGSPPKSGTLNVTVTVLDTNDNSPIFTQEIYSAIIN--ENIKVGSNVITVNATDLDEGVNADVEYSFGGELDPQIYEI-FSINKHSGE-ISVKGEI-----DFEKAEVYKLDVHASDKGQPPMNADCRVIIKVLDQNDNLPEIEVTSLSKSVSEDSKPGTVVSLISITDRDSGLNGKVICSLQ-DSVPFDLKPSFQ-ENMYSLVVKQPLDRES-------VSHYDILITATDCGQPTLSTFKTVSIDVADVNDNKPEFTQNPVELYLTEN---NTPGNVICSVSALDKDLNENAILTYVVRGDTGQLISAAFLNINPETGEISALKSFDFESVKT-FQFHVVATDSGSPPL---SSNVTVNVFILDQNDNAPVILYPVSSNGSAEGVEEIPRNVNAGHLVTKVRAYDADIGYNGWLLFSLQQVTDHSLFALDRYTGQIRTLRSFTETDEAEHKLLILVKDNGNVSLSATATVIVKLVE 669          
BLAST of Protocadherin alpha-11 vs. Ensembl Medaka
Match: pcdh19 (protocadherin 19 [Source:NCBI gene;Acc:101169296])

HSP 1 Score: 213.772 bits (543), Expect = 4.296e-56
Identity = 202/730 (27.67%), Postives = 332/730 (45.48%), Query Frame = 1
Query:   34 KRIHFITIDLIFLLIPMVXXXXXXXXXXXXQIFENLPVGSVICKLSN-------VIIPRPSDTTKFKLIKN---RFFQIENGDNLKVSGLIDRDDNLELCAYRNVNFSCIWRGILFCGTNNLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLD--INANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSI-LLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRI-QWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQ-----QAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIE-DCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLV 2163
            K +  I I  +FLL  +V+  + +       I E +  GSVI  ++         I P+P      ++I N   R+ ++     L     IDRD    +C     N  CI    +   +  + +++++I D NDN P++  + I IE+ EN    + +  L  A D D     +  Y I P   +      + +      L +++ +DRE  S +   + A DGG P K G++QL IK+ID NDN P+F+ S YT ++  N  IN TL + ++ATD D   N  V Y F+  V    ++ F ++P   I+ V   L +E  +  Y   + A D G     +   VT+++ + N  PP I LL  N  ++ + EN   G VI    V D DSG +GK  C +      ++   + + +S      +++ +   DRE K    L I  +D G P    +  + + + D NDN P F K  Y   + E N P   +  ++A D D G+N  + Y I   +    D N  + +  + +I +++S D E Y   F F    +V+A D+G P  S + TV I ++D+NDN PV            +S   + G       V    A D D G NG +TY+I       F+++  +GE+ S  +   E   S Y  ++ ARD     L   +A+  + + +  D N  EPI       +  + L +++ +GS+  ++
Sbjct:    4 KEMELIQITTVFLLSWVVTEAVINLKYG---INEEMKPGSVIGNVTKDALKQGFQIAPQPP---YLRVISNSEPRWVELSPAGILTTQMKIDRD---VVCRQ---NPKCIISLEVMSNSMEICVIKVEIEDLNDNAPKFPTSHIDIEISENASPGTRF-PLEGASDPDSGIFGVQSYSITPNELFGLEIKTRGDGSKIAELVVQKSLDRETQSHYTYEISAEDGGDPPKIGAVQLNIKVIDSNDNNPVFDESVYTVNVMENSPIN-TLVIDLNATDPDEGTNGEVVYSFNSYVTEKTREAFKIDPRTGIITVNGVLDYET-SQIYEIDVQAKDLGPNSIPAHCKVTVNVMDTNDNPPVISLLSLNTEMVEVSENAQRGYVIALVRVSDKDSGANGKVQCRL----QGNVPFRLQEYES----FSTILVDGKLDREQKDTFNLTIQAEDSGTPPLRATKSLVVKVTDENDNPPHFLKPHYQEMVMENNLPGSCLLAVSAEDPDLGMNGTVSYSIVPGEIKHMDVNTYVSINPSGRIYSMRSFDHE-YTRTFDF----KVLARDNGNPSLSSNATVRIVVLDVNDNTPVMTNPPLVNGTAEVSIPRNAGV---GYMVTQVKADDYDEGENGRLTYTISEGDRAFFEIDQVNGEVRSTRMFG-ENAKSSYEITVVARDHGKPSL---SASAYIMVYLSPDLNAQEPI------GSVNLSLIFIIALGSIAAIL 692          

HSP 2 Score: 134.42 bits (337), Expect = 2.674e-31
Identity = 181/709 (25.53%), Postives = 304/709 (42.88%), Query Frame = 1
Query:  532 YKIEPTSKYFFISSEKSNKGIK----PFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLD--INANVTYRFSLNVPFIVQ-----DCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGK----FNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSP-----QFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNP-----NSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVP----VGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGEFRNPD---STPFNETEESFLSDQATFII-VGIILGTFFICCGLVTGICTMAYRRWHSSNNR 2559
            ++I P   Y  + S    + ++      L  +  IDR+++   N   +       +      + ++I D+NDN P F +S     I  N    +   L+  A+D D  I    +Y  + N  F ++     D   +    A L V+KSL  E   S Y + I A D G P +     + + + + N   P  +   +   + ++EN  I  +++     D D G +G+    FN  + E K  +      +T      II++  N + D E     ++ +  KD G  +     ++++ ++D NDN P         E     + E  Q  + IA +   D D G N +++ R+Q +     P +L + ES   I+    LDRE+  + F       + A DSG P    + ++ +++ D NDN P F +  Y    +E+  +   S  +AV  A DPD G+NG V+YSIV   +    +N       SG +YS    D E   + + F + ARD+    L   ++  +V IV+ D NDN P+   P   N   ++S  +P    VG +VT VKA D D G N ++ + + E  R   F I++ +GE+ ++ +     K    + + A D G P L+A   + +    + +PD     P      S +     FII +G I    FI    V   C    +   + N R
Sbjct:   54 FQIAPQPPYLRVISNSEPRWVELSPAGILTTQMKIDRDVVCRQNPKCIISLEVMSNSMEICVIKVEIEDLNDNAPKFPTSHIDIEISENASPGTRFPLE-GASDPDSGIFGVQSYSITPNELFGLEIKTRGDGSKI----AELVVQKSLDRET-QSHYTYEISAEDGGDPPKIGAVQLNIKVIDSNDNNP--VFDESVYTVNVMENSPINTLVIDLNATDPDEGTNGEVVYSFNSYVTE-KTREAFKIDPRT-----GIITV--NGVLDYETSQIYEIDVQAKDLGPNSIPAHCKVTVNVMDTNDNPPVISLLSLNTEMVE--VSENAQRGYVIALVRVSDKDSGANGKVQCRLQGNV----PFRLQEYESFSTILVDGKLDREQK-DTFNLT----IQAEDSGTPPLRATKSLVVKVTDENDNPPHFLKPHYQEMVMEN--NLPGSCLLAVS-AEDPDLGMNGTVSYSIVPGEIKHMDVNTYVSINPSGRIYSMRSFDHEYTRT-FDFKVLARDNGNPSL---SSNATVRIVVLDVNDNTPVMTNPPLVNGTAEVS--IPRNAGVGYMVTQVKADDYDEGENGRLTYTISEGDR-AFFEIDQVNGEVRSTRMFGENAKSSYEITVVARDHGKPSLSASAYIMV----YLSPDLNAQEPIGSVNLSLI-----FIIALGSIAAILFITMIFVAVKCKRDNKEIRTYNCR 716          
BLAST of Protocadherin alpha-11 vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 211.075 bits (536), Expect = 2.054e-55
Identity = 189/671 (28.17%), Postives = 321/671 (47.84%), Query Frame = 1
Query:  367 LKILEIQIL--DENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIK-PFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDI--NANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSI----LLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPV-GSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPR 2349
             ++++I+I+  D NDN P +    I I + ENT ++S +  +P A D D  PN++  Y++      F +   ++ +G K P L +++ +DRE    + + +   DGG+P K+ +  L + + DVNDNKP+F  +     I  N  I +++ +++ ATD DI  NA + Y F   V    +  F LN  + ++ V++ L  E  A  ++ S+ A D       ++ TV +++ + N  PP+I    ++   N  + + E   I   I    V D D+ ++GK  C I +   + +     K   +N  ++   T+ + D E        I   D GKP+ N +A + + + D NDN P F +      + E N+ +  +  L+A D D G NA++ Y++  + S +D ++   V     + A +  DRE   +  RF+  + V A D+G P       V + ++D NDN P F    +     E+         V V    D D G N  ++ SI+ +    F L+P SG + S    DRE Q S YTF + A DS        ++   V+I + D NDN PI I+P  SN   +L  L  + GS+V  V A+D D+G+N+++++ +       LF I+  +G +      +    G   L +   D G P+
Sbjct:  122 FRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRF-AIPSATDPDTGPNSVHKYELINGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSV-VQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPLDREETAI-HKLSVLASDGSS--SPARATVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIEKDVPFHL-----KAVYDNQYLLE--TSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLGPNASFFDLDRKTGV-----LTASRVFDRE---DQDRFL--FTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFTHNHFQFFVSENL---PKYSTVGVITVTDSDAGENAAISLSILNDN-ENFILDPFSGVIKSNVSFDREQQ-SSYTFDVRAIDSGRPPC---SSAAKVTINVIDVNDNTPIVIYP-PSNTSFKLVPLSSIPGSVVAEVFAVDSDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDIGLHRLVVNISDLGYPK 761          

HSP 2 Score: 120.553 bits (301), Expect = 4.820e-27
Identity = 154/587 (26.24%), Postives = 257/587 (43.78%), Query Frame = 1
Query:  712 IKII--DVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAI-------LRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFN---CSILEPKNYDIILTMNKTKSENIAIISLIT-NKIFDREVKTRIQLIIFCKD-FGKPAFNTSAEXXXXXXDVNDNSPQFEKEF----YHYTIF--EENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGEFRNPDSTP 2412
            IKII  D NDN P+F S     SI  N  INS   +   ATD D   N  +++ L      Q  F L+            L V+++L  E     Y   I   D G P + S   + + + + N   P  +   N   + I EN  IG  ++     D D G + + +    + + P     +  +N T         LIT  +  DRE     +L +   D    PA    A + I + DVNDN P  +  +     + T+F  E++  N  IA +T  D D  +N ++   I+ D     P  L  V  N  ++   +L   +    + F    +++A+DSG+P  + +  V + L D NDN P+F Q    ++ +E+    K    +    A D D G N ++ Y +       F L+  +G L +  + DRE Q  ++ F++TARD+ T  L  + A +   + + D NDN P F     ++++  +S  +P  S V ++   D D+G N+ I   +  +  N  F ++  SG + ++       +   T  ++AID G P  ++  ++TI + +    D+TP
Sbjct:  127 IKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIP-SATDPDTGPNSVHKYEL---INGQSAFGLDIVETPEGEKWPQLIVQQNLDREQ-KDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKP--VFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKR-LFALNSTS-------GLITVQRPLDREETAIHKLSVLASDGSSSPA---RATVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIEKDV----PFHLKAVYDNQYLLETSALLDYEGTKEYNF----KIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMEN---NKRDLFLTTLSATDEDSGKNAEIVYQLGPNASF-FDLDRKTGVLTASRVFDREDQ-DRFLFTVTARDNGTPPLQAQAAVI---VTVLDENDNNPKF---THNHFQFFVSENLPKYSTVGVITVTDSDAGENAAISLSILNDNEN--FILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAKVTINVIDVN--DNTP 672          

HSP 3 Score: 101.679 bits (252), Expect = 2.403e-21
Identity = 87/320 (27.19%), Postives = 143/320 (44.69%), Query Frame = 1
Query:  256 LKVSGLIDRDDNLELCAYRNVNFSCIWRGILFCGTNNLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDI-GVVILTGVVKDNDSGMDGKFNCSILEPKN 1212
            L+ S L+D +   E       NF  +         N   ++ +++ DENDN P ++Q  I + V+EN K D F   L  A D D   N    Y++ P + +F +  +         L   R  DRE       T+ A D GTP       +++ ++D NDN P F  + +   +  NL   ST+ + I  TD D   N     S+       + F L+PF+ +++   S   E   S Y F + A+D GRP   S   VT+++ + N   P ++ P +N   +++    I G V+      D+D+GM+ +   +I+   N
Sbjct:  420 LETSALLDYEGTKEY------NFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTL-SATDEDSGKNAEIVYQLGPNASFFDLDRKTG------VLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFTHNHFQFFVSENLPKYSTVGV-ITVTDSDAGENAAISLSI---LNDNENFILDPFSGVIKSNVSFDREQ-QSSYTFDVRAIDSGRPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSSIPGSVVAEVFAVDSDTGMNAELKYTIVSGNN 721          
BLAST of Protocadherin alpha-11 vs. Planmine SMEST
Match: SMESG000012176.1 (SMESG000012176.1)

HSP 1 Score: 1715.28 bits (4441), Expect = 0.000e+0
Identity = 868/876 (99.09%), Postives = 868/876 (99.09%), Query Frame = 1
Query:   19 MSIIFKRIHFITIDLIFLLIPMVXXXXXXXXXXXXQIFENLPVGSVICKLSNVIIPRPSDTTKFKLIKNRFFQIENGDNLKVSGLIDRDDNLELCAYRNVNFSCIWRGILFCGTNNLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGEFRNPDSTPFNETEESFLSDQATFIIVGIILGTFFICCGLVTGICTMAYRRWHSSNNRSPPNQLYQAGEELTNLQYIDNYLIMKEMS 2646
            MSIIFKRIHFITIDLIFLLIPMVSSLLSSESPISIQIFENLPVGSVICKLSNVIIPRPSDTTKFKLIKNRFFQIENGDNLKVSGLIDRDDNLELCAYRNVNFSCIWRGILFCGTNNLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKN DIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEISIIIIDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFV    VIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKN RKVAVFIAHDPDFGVNGDVTYSIV ETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATV VSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGEFRNPDSTPFNETEESFLSDQATFIIVGIILGTFFICCGLVTGICTMAYRRWHSSNNRSPPNQLYQAGEELTNLQYIDNYLIMKEMS
Sbjct:    1 MSIIFKRIHFITIDLIFLLIPMVSSLLSSESPISIQIFENLPVGSVICKLSNVIIPRPSDTTKFKLIKNRFFQIENGDNLKVSGLIDRDDNLELCAYRNVNFSCIWRGILFCGTNNLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNNDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEISIIIIDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFV----VIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNLRKVAVFIAHDPDFGVNGDVTYSIVSETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVLVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGEFRNPDSTPFNETEESFLSDQATFIIVGIILGTFFICCGLVTGICTMAYRRWHSSNNRSPPNQLYQAGEELTNLQYIDNYLIMKEMS 872          
BLAST of Protocadherin alpha-11 vs. Planmine SMEST
Match: SMESG000012176.1 (SMESG000012176.1)

HSP 1 Score: 1674.83 bits (4336), Expect = 0.000e+0
Identity = 833/841 (99.05%), Postives = 833/841 (99.05%), Query Frame = 1
Query:  124 QIFENLPVGSVICKLSNVIIPRPSDTTKFKLIKNRFFQIENGDNLKVSGLIDRDDNLELCAYRNVNFSCIWRGILFCGTNNLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGEFRNPDSTPFNETEESFLSDQATFIIVGIILGTFFICCGLVTGICTMAYRRWHSSNNRSPPNQLYQAGEELTNLQYIDNYLIMKEMS 2646
            QIFENLPVGSVICKLSNVIIPRPSDTTKFKLIKNRFFQIENGDNLKVSGLIDRDDNLELCAYRNVNFSCIWRGILFCGTNNLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKN DIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEISIIIIDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFV    VIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKN RKVAVFIAHDPDFGVNGDVTYSIV ETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATV VSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGEFRNPDSTPFNETEESFLSDQATFIIVGIILGTFFICCGLVTGICTMAYRRWHSSNNRSPPNQLYQAGEELTNLQYIDNYLIMKEMS
Sbjct:   15 QIFENLPVGSVICKLSNVIIPRPSDTTKFKLIKNRFFQIENGDNLKVSGLIDRDDNLELCAYRNVNFSCIWRGILFCGTNNLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNNDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEISIIIIDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFV----VIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNLRKVAVFIAHDPDFGVNGDVTYSIVSETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVLVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGEFRNPDSTPFNETEESFLSDQATFIIVGIILGTFFICCGLVTGICTMAYRRWHSSNNRSPPNQLYQAGEELTNLQYIDNYLIMKEMS 851          
BLAST of Protocadherin alpha-11 vs. Planmine SMEST
Match: SMESG000022902.1 (SMESG000022902.1)

HSP 1 Score: 476.863 bits (1226), Expect = 1.456e-150
Identity = 315/852 (36.97%), Postives = 460/852 (53.99%), Query Frame = 1
Query:   55 IDLIFLLIPMVXXXXXXXXXXXXQIF----ENLPVGSVICKLSNVIIPRPSDTTKFKLIKNRFFQIENGDNLKVSGLIDRDDNLELCAYRNVNFSCIWRGILFCGTNNLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRRG--IDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDIN--ANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILL-----PGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRL-TAIQQLTIEIGEFR------NPDSTPFNETEESFLS----DQATFIIVGIILGTFFICCGLVTGICTMAYRR 2538
            I +IFLL  ++     S      QIF    EN+ +G+ I  L   ++       KF L  N +F I     L     +DRD + ELC       +C W  +L  G     IL+I I D NDN P+W  N I +++ ENT+   + LE P A D D   N I YY I P S  F++S +  N    P L L +G  +DREL SWHN+TL+A DGG    +G++ + I+I+D NDN P+F+SSFY   ID ++   +TL L+IHA DLD      +TY+FSL+ P  V + F ++P  A +   KSL  +     Y F I A D G P + ++T++ + + ++N + P I +     P +  +I + EN  I  ++ +  + D DSG++ KFNCS+    + D  L  +K K   + I  L T + FDRE+++ + + I C+D G P    S +I I + D+ND+SP F+   Y     E N PN  +  + A D+D G NA+LRY+I W   +   +   K++S  ++ A   LDRE  P G+ F    QV+A D G+P +S ST V IEL D+ND  P F +  Y     ED+G+    + V    A D D   N  V Y + +E  +PF+++  SG +Y+  L+DRE+    ++F   A D+P NLLYRKTATV +++ I D NDN+P FIFPNE+   I LSY       V  V A D+D+GIN++I++I+ +     LFS+N  +G +  +T L   +KG E L IKAID G  ++ TA+ Q+ I+I  F+        D  P NE+   FL     +    II+ I+L T  I C L+  IC MA RR
Sbjct:    2 IRVIFLLSTIIVRYSISILQNQRQIFLDIDENIEIGTRIIDLQTKLLSNEEKNIKFSLTSNPYFHIRENSVLYTKSFLDRDKDRELCHNSEFPANCQWSRLLTLGNGGYYILKITINDVNDNPPKWEINHIHLKISENTQ-PGYKLEFPLATDDDFGINGIQYYTIFPISSVFYVS-DSGNGERSPRLVLSKGSKLDRELNSWHNMTLVAYDGGINKLSGTVPVSIEILDENDNGPVFQSSFYNVLIDEDIMPGTTLPLRIHAYDLDAGNFGKITYKFSLSTPQHVLEIFSISPNTANIITSKSLNFKSRRKFYDFEIVAQDGGIPPKTAQTSIKVEIVDKNTHAPEIKVTPMPDPTSKNII-VPENSAINRIVASFTINDKDSGINSKFNCSLTGLNSKDFNLKHSK-KLGKLEIYVLETKRSFDRELESLLTVCISCQDQGVPQLTGSQDILIEVEDINDHSPVFQHPEYRLRTTEGNAPNSLVYHILATDMDKGDNARLRYKIIW-PDIETQSLPFKIDSEGRLFAKYVLDREANPQGYTF----QVMAFDYGDPSKSASTIVKIELEDLNDCPPKFNRDHYQFQIKEDYGNIHIRQHVGDVYAEDLDLQENAIVFYRLSQEINVPFEIDSKSGSIYTSKLIDRESVSVPFSFLCMAVDNPFNLLYRKTATVEITVTIIDVNDNKPQFIFPNETQQDINLSYYARKEHFVGKVIANDQDAGINAKIKYIITQGNALKLFSLNNDTGVINLNTDLKPSNKGYELLTIKAIDSGQFQIHTAVCQIRIKISNFQLITKPEYKDQKPSNES--GFLHFDWWEPNKMIIIIILLVTALISCILIGAICVMAKRR 842          
BLAST of Protocadherin alpha-11 vs. Planmine SMEST
Match: SMESG000063589.1 (SMESG000063589.1)

HSP 1 Score: 348.591 bits (893), Expect = 2.073e-102
Identity = 274/828 (33.09%), Postives = 413/828 (49.88%), Query Frame = 1
Query:  127 IFENLPVGSVICKLSNVIIPRPSDTTKFKLI----KNRFFQIENGDNLKVSGLIDRDDNLELCAYRNVNFSCIWRG-ILFCGTNNLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKY---FFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDIN--ANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILL--------PGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFG--SKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGEFRNPDSTPFNETEESFL------SDQATFIIVGIILG-TFFICCGLVTGICTMA 2529
            I+EN+P+   +  L   I     D  K++L+    +N++F +    +L V   IDRD N +LC      F C+W G I+F G N +  L I+I D NDN+P W+   I+IE++EN       ++L +A+D D  PNN+  Y++  ++KY   F ++ E    GI P L +   +D E     ++TL A DG  P  +GS+ + IKI+D NDN P FE S ++ +I  N  +   L L + A D D     +V Y  S + P      F +N  + I+ V +++ ++     + F + A D G P   S   V + +K+ N  PP+IL+          N +V+ I+EN  IG  +      D+DS      NC++    ++ ++   N  K   + I  LI NK+FDRE ++ I++ + C D G P   +S  + II+ DVNDN+P F+K  Y Y + EEN PN  IA+L A D D G N +L Y I  ++   DP   IKV  N +IIA+Q LDRE    G++F    Q+IA D G+  RSG+T V I L DIND  P F    Y     ED G  S    + V      D D G NG  ++ I+ +   PFK++ N   + +   +DRE +   Y  ++ A D   +   R T +  V+I + D NDN P F  P   +  I +S     G + T ++A D D G N+++ + +       LF I   +G L     +    K   T+ I A D G+P L++   + I + +      TP   TE + L      S Q   I++ II+  T  IC GL+T IC MA
Sbjct:   11 IYENVPLNVSVVNLRPEIEKSQKDF-KYELLMGLSQNKYFYVNKNYDLIVLTNIDRDRNPDLCKEMTTEFLCVWTGVIMFEGYNVIISLRIEIKDVNDNIPFWNH-PILIEIMENNPPGK-TIDLTQAQDDDSPPNNVQRYELM-SNKYSSIFRLTKEPGPSGIIPRLTILTVLDHEKYKEFSLTLNAFDGAYPYHSGSVNISIKILDQNDNAPKFEKSHFSLTIPENYPLFKPLMLNLTAVDDDSGQFGSVIYYISESSPPDSLKKFSINN-HGIITVIRNIDYDIGEKLFTFIVVAKDQGNPPLSSLAMVKITIKDVNDQPPTILINSYSTSGSKNNPSVLSIVENNSIGQAVARISATDSDSFESDFCNCTLTHFSDFQLVFERNVAK---MTIYRLIANKVFDRETRSIIKVTVICSDTGYPPMTSSETLRIIVEDVNDNNPIFDKNVYSYVVAEENAPNTIIAKLRATDDDAGKNGKLTYNISPNSKFRDPRPAIKVNENGEIIAVQPLDRESNLQGYKF----QIIAIDQGDNPRSGTTIVVIHLNDINDCKPKFSDDSYFFQLEEDSGISSIFRPKIVGSIKVTDADIGKNGISSFEILPKN-SPFKIDENK-YIKTTRFIDREHR-KNYMLTVLAVDGLADSEIRHTTSTVVNITVTDVNDNAPQFYIPKNLSIPINVSLYEEPGFVFTNLQATDSDEGENARVTYHISGGNIFGLFEIESQTGRLSVRDHIQSKLKVPFTVTILARDHGTPSLSSTVVIRILLTD------TPAIGTEINKLNNRTASSTQTNQILIMIIVTITCVICIGLITIICLMA 817          
BLAST of Protocadherin alpha-11 vs. Planmine SMEST
Match: SMESG000063589.1 (SMESG000063589.1)

HSP 1 Score: 348.206 bits (892), Expect = 4.388e-102
Identity = 274/828 (33.09%), Postives = 413/828 (49.88%), Query Frame = 1
Query:  127 IFENLPVGSVICKLSNVIIPRPSDTTKFKLI----KNRFFQIENGDNLKVSGLIDRDDNLELCAYRNVNFSCIWRG-ILFCGTNNLKILEIQILDENDNVPQWSQNSIVIEVVENTKLDSFYLELPKARDSDEHPNNISYYKIEPTSKY---FFISSEKSNKGIKPFLKLRRGIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYTQSIDCNLEINSTLDLKIHATDLDIN--ANVTYRFSLNVPFIVQDCFDLNPFNAILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPPSILL--------PGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYDIILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSAEXXXXXXDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQLRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVIATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFG--SKKNSRKVAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQPSQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKIQLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGELLTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGEFRNPDSTPFNETEESFL------SDQATFIIVGIILG-TFFICCGLVTGICTMA 2529
            I+EN+P+   +  L   I     D  K++L+    +N++F +    +L V   IDRD N +LC      F C+W G I+F G N +  L I+I D NDN+P W+   I+IE++EN       ++L +A+D D  PNN+  Y++  ++KY   F ++ E    GI P L +   +D E     ++TL A DG  P  +GS+ + IKI+D NDN P FE S ++ +I  N  +   L L + A D D     +V Y  S + P      F +N  + I+ V +++ ++     + F + A D G P   S   V + +K+ N  PP+IL+          N +V+ I+EN  IG  +      D+DS      NC++    ++ ++   N  K   + I  LI NK+FDRE ++ I++ + C D G P   +S  + II+ DVNDN+P F+K  Y Y + EEN PN  IA+L A D D G N +L Y I  ++   DP   IKV  N +IIA+Q LDRE    G++F    Q+IA D G+  RSG+T V I L DIND  P F    Y     ED G  S    + V      D D G NG  ++ I+ +   PFK++ N   + +   +DRE +   Y  ++ A D   +   R T +  V+I + D NDN P F  P   +  I +S     G + T ++A D D G N+++ + +       LF I   +G L     +    K   T+ I A D G+P L++   + I + +      TP   TE + L      S Q   I++ II+  T  IC GL+T IC MA
Sbjct:   29 IYENVPLNVSVVNLRPEIEKSQKDF-KYELLMGLSQNKYFYVNKNYDLIVLTNIDRDRNPDLCKEMTTEFLCVWTGVIMFEGYNVIISLRIEIKDVNDNIPFWNH-PILIEIMENNPPGK-TIDLTQAQDDDSPPNNVQRYELM-SNKYSSIFRLTKEPGPSGIIPRLTILTVLDHEKYKEFSLTLNAFDGAYPYHSGSVNISIKILDQNDNAPKFEKSHFSLTIPENYPLFKPLMLNLTAVDDDSGQFGSVIYYISESSPPDSLKKFSINN-HGIITVIRNIDYDIGEKLFTFIVVAKDQGNPPLSSLAMVKITIKDVNDQPPTILINSYSTSGSKNNPSVLSIVENNSIGQAVARISATDSDSFESDFCNCTLTHFSDFQLVFERNVAK---MTIYRLIANKVFDRETRSIIKVTVICSDTGYPPMTSSETLRIIVEDVNDNNPIFDKNVYSYVVAEENAPNTIIAKLRATDDDAGKNGKLTYNISPNSKFRDPRPAIKVNENGEIIAVQPLDRESNLQGYKF----QIIAIDQGDNPRSGTTIVVIHLNDINDCKPKFSDDSYFFQLEEDSGISSIFRPKIVGSIKVTDADIGKNGISSFEILPKN-SPFKIDENK-YIKTTRFIDREHR-KNYMLTVLAVDGLADSEIRHTTSTVVNITVTDVNDNAPQFYIPKNLSIPINVSLYEEPGFVFTNLQATDSDEGENARVTYHISGGNIFGLFEIESQTGRLSVRDHIQSKLKVPFTVTILARDHGTPSLSSTVVIRILLTD------TPAIGTEINKLNNRTASSTQTNQILIMIIVTITCVICIGLITIICLMA 835          
The following BLAST results are available for this feature:
BLAST of Protocadherin alpha-11 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDH11X1.582e-6027.88protocadherin 11 X-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11X3.799e-6028.01protocadherin 11 X-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11X4.744e-6028.01protocadherin 11 X-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11X5.284e-6028.01protocadherin 11 X-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11X5.675e-6028.01protocadherin 11 X-linked [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Protocadherin alpha-11 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fmi-11.713e-4527.22FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
fmi-11.326e-3627.43FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
cdh-13.270e-3626.24CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4... [more]
cdh-42.377e-2223.94Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI... [more]
hmr-12.018e-2025.77Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of Protocadherin alpha-11 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ds3.379e-5929.52gene:FBgn0284247 transcript:FBtr0078045[more]
ds3.379e-5929.52gene:FBgn0284247 transcript:FBtr0343249[more]
ft6.520e-5729.63gene:FBgn0001075 transcript:FBtr0077478[more]
stan6.537e-5027.53gene:FBgn0024836 transcript:FBtr0304899[more]
stan6.537e-5027.53gene:FBgn0024836 transcript:FBtr0300578[more]
back to top
BLAST of Protocadherin alpha-11 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1a3.224e-6429.56protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1a1.400e-6329.56protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
CT030123.14.140e-6029.40protocadherin 1b [Source:NCBI gene;Acc:572016][more]
CT030123.14.760e-6029.40protocadherin 1b [Source:NCBI gene;Acc:572016][more]
CT030123.15.103e-6029.40protocadherin 1b [Source:NCBI gene;Acc:572016][more]
back to top
BLAST of Protocadherin alpha-11 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000047801.17.431e-6128.57protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
ENSXETT00000047798.18.749e-6128.57protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
ENSXETT00000047804.11.149e-6028.57protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
ENSXETT00000027070.19.980e-6028.36pep primary_assembly:Xenopus_tropicalis_v9.1:3:190... [more]
vapa4.196e-5728.76VAMP associated protein A [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Protocadherin alpha-11 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcdh11x1.039e-6329.13protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x3.130e-6329.13protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x9.174e-6329.13protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x1.097e-6229.13protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
Pcdh11x1.539e-6229.13protocadherin 11 X-linked [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Protocadherin alpha-11 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6KEQ9|PC11X_PIG8.843e-6128.05Protocadherin-11 X-linked OS=Sus scrofa OX=9823 GN... [more]
sp|Q71M42|PC11X_PANTR8.612e-6028.18Protocadherin-11 X-linked OS=Pan troglodytes OX=95... [more]
sp|Q6WYY1|PC11X_PANPA9.648e-6028.18Protocadherin-11 X-linked OS=Pan paniscus OX=9597 ... [more]
sp|Q6X862|PC11X_GORGO1.309e-5928.18Protocadherin-11 X-linked OS=Gorilla gorilla goril... [more]
sp|Q9BZA7|PC11X_HUMAN1.824e-5928.01Protocadherin-11 X-linked OS=Homo sapiens OX=9606 ... [more]
back to top
BLAST of Protocadherin alpha-11 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RYN89.425e-10530.85Putative protocadherin alpha OS=Fasciola hepatica ... [more]
A0A267F7Y44.073e-9430.90Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267F2A88.730e-9430.78Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8JAE51.392e-9330.78Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A068X3A55.586e-8929.95Protocadherin 1 OS=Echinococcus granulosus OX=6210... [more]
back to top
BLAST of Protocadherin alpha-11 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1a7.097e-6329.87protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1b2.220e-6229.61protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-... [more]
pcdh1a2.828e-6229.87protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
ENSAMXT00000035285.11.554e-5828.91pep primary_assembly:Astyanax_mexicanus-2.0:8:8923... [more]
pcdh117.005e-5829.19protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
back to top
BLAST of Protocadherin alpha-11 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh111.726e-5227.75protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
ENSPMAT00000004042.11.632e-4926.34pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
ENSPMAT00000004043.11.930e-4926.34pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
si:ch211-199f5.18.135e-4724.89protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660][more]
ENSPMAT00000006996.12.839e-4627.86pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 g... [more]
back to top
BLAST of Protocadherin alpha-11 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin alpha-11 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO461893.508e-5829.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404708.982e-5228.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348153.435e-5027.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354126.668e-4828.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482378.909e-4526.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protocadherin alpha-11 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1a1.969e-6328.66protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
pcdh1a8.208e-6329.85protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
si:ch73-379j16.21.861e-5628.44si:ch73-379j16.2 [Source:ZFIN;Acc:ZDB-GENE-141215-... [more]
pcdh194.296e-5627.67protocadherin 19 [Source:NCBI gene;Acc:101169296][more]
pcdh92.054e-5528.17protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
back to top
BLAST of Protocadherin alpha-11 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000012176.10.000e+099.09SMESG000012176.1[more]
SMESG000012176.10.000e+099.05SMESG000012176.1[more]
SMESG000022902.11.456e-15036.97SMESG000022902.1[more]
SMESG000063589.12.073e-10233.09SMESG000063589.1[more]
SMESG000063589.14.388e-10233.09SMESG000063589.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021961 ID=SMED30021961|Name=Protocadherin alpha-11|organism=Schmidtea mediterranea sexual|type=transcript|length=3685bp
TAGTCACATGGGCATGTTATGTCTATTATTTTCAAACGGATTCATTTTAT
CACAATCGATTTGATTTTTCTTTTGATTCCAATGGTTTCCTCATTGCTGT
CGAGCGAAAGTCCAATCAGTATTCAGATTTTCGAGAACTTGCCTGTCGGT
TCAGTGATTTGCAAATTATCCAATGTTATCATTCCAAGACCGAGTGATAC
AACCAAATTCAAACTGATAAAAAACAGATTTTTCCAAATTGAAAATGGCG
ACAATCTGAAAGTAAGTGGCCTCATTGACAGAGACGATAATTTGGAATTA
TGCGCTTATCGAAACGTGAATTTCTCATGCATTTGGAGAGGGATTCTGTT
TTGCGGTACCAACAATTTGAAAATTCTGGAAATTCAAATCTTAGATGAAA
ACGACAATGTTCCCCAATGGAGTCAGAATAGTATCGTGATTGAGGTGGTT
GAAAATACCAAGTTGGATTCGTTCTATTTGGAACTACCGAAAGCCAGAGA
CTCAGATGAACATCCAAACAATATTAGTTATTACAAAATTGAACCGACTT
CCAAGTATTTTTTCATTTCTTCAGAAAAATCAAATAAGGGAATAAAGCCG
TTTCTGAAACTACGACGAGGCATTGATCGGGAACTGATTTCCTGGCATAA
TGTCACGTTACTTGCCGTAGATGGCGGAACTCCATCGAAAACCGGATCAT
TACAACTATTGATCAAAATAATCGATGTCAACGATAACAAACCGATTTTT
GAATCGTCCTTTTACACCCAATCGATCGATTGTAACCTGGAAATCAATAG
CACTTTGGATTTGAAAATTCACGCCACCGATCTAGACATTAACGCCAATG
TTACCTATCGGTTTTCTCTAAACGTTCCTTTCATCGTTCAGGATTGTTTC
GATTTGAATCCTTTCAATGCGATTTTGCGAGTGAAAAAATCCTTGAAACA
CGAATGTTTCGCGTCAGAATATCGGTTCAGCATCGACGCGTTAGATCACG
GACGACCGGTGGAAAAGTCGAAAACGACTGTGACTTTGCATTTAAAAAAT
CAAAATTTATACCCCCCGTCCATTTTACTGCCTGGCAATAACGCCGTTAT
CAGAATAATAGAGAATCAGGACATCGGCGTTGTCATTCTCACTGGGGTTG
TCAAAGACAACGATTCAGGGATGGATGGCAAATTCAACTGCTCGATTTTA
GAGCCGAAAAACTATGATATCATTTTGACAATGAATAAAACCAAAAGCGA
AAACATAGCTATCATCTCGCTGATAACCAACAAAATTTTTGATCGCGAGG
TTAAAACAAGAATTCAATTAATTATCTTTTGTAAAGATTTCGGTAAACCG
GCTTTTAATACTTCTGCGGAGATTTCCATTATAATAATCGATGTCAATGA
CAACAGCCCCCAATTCGAAAAAGAATTTTATCACTACACAATTTTTGAAG
AGAATCAGCCAAATTTTACAATTGCTCAACTAACTGCCCACGATTTGGAT
GATGGTCTCAATGCTCAATTGAGATACCGAATTCAATGGGACACGAGTCT
ATATGATCCCAACAAACTAATAAAAGTCGAAAGCAATTGTCAGATCATAG
CCATCCAATCTCTTGACAGGGAAAAGTATCCGAATGGGTTCAGATTTGTT
TGTCCTTATCAGGTAATCGCTACCGACAGTGGAGAGCCCCAAAGAAGTGG
ATCTACAACAGTTTCAATCGAGTTAATGGATATCAACGATAACATTCCAG
TGTTTCAACAAGCCTTTTATAATATATCATTTCTTGAAGATTTTGGATCA
AAGAAAAACTCAAGAAAAGTAGCAGTATTTATTGCTCACGACCCGGATTT
TGGTGTTAATGGGGATGTGACTTACTCAATAGTCAGGGAAACTTTATTAC
CATTCAAACTTAATCCAAATTCTGGTGAATTGTACAGCTATGACTTGGTT
GACAGAGAAACTCAGCCATCCCAATATACATTTTCTATAACCGCAAGAGA
CAGCCCGACAAACCTGCTTTACAGAAAAACAGCCACAGTATCAGTCTCAA
TTGTCATAGAAGATTGCAACGACAACGAACCAATATTCATATTTCCTAAT
GAGTCAAATTATAAAATTCAGTTGTCCTATTTGGTACCGGTTGGGTCACT
TGTGACCCTTGTGAAAGCGATTGACAAAGATTCTGGAATAAATTCGCAGA
TTCAATTTATTTTGGAAGAAGAAAAAAGAAATATTCTGTTTTCGATCAAC
GAGACCTCAGGGGAATTGCTGACCTCGACAGTTCTCAGTGTAATCCACAA
GGGAGAAGAAACTCTTTTCATTAAAGCAATAGATTGCGGTTCTCCTCGGC
TTACGGCTATTCAACAGCTTACCATTGAAATCGGTGAGTTTCGGAATCCT
GATTCGACTCCTTTCAATGAAACCGAAGAATCGTTTCTATCAGACCAAGC
AACCTTTATCATTGTTGGAATTATTTTAGGAACATTTTTCATTTGTTGTG
GACTAGTAACTGGGATTTGTACGATGGCATACCGTCGATGGCACAGCTCA
AACAATAGGTCACCCCCAAATCAGTTATATCAAGCTGGAGAAGAACTAAC
AAACTTGCAATATATAGATAATTATTTGATAATGAAAGAGATGTCATAAT
TAGGAATTGTGTATTTTTACAGATTCGTCGGTCCAATAATTTCACTTGAT
GGTTTTGGAGAAATTTTTTTTTTTATTGAAGACGTCTGGATGAATAAGTT
ACTATTGTAAATATTGTGTATACCTTGTTGTGGATCTATTGTTGCGAACT
TTCTCACCTTAAATTCGAGGTAGTCGATTAATAATTTGATAGGAGACAAA
CCCCAACAGAATCGTCGAATTTCTTTTGCAAAGTATGATTTGTTTCTTTC
GCGTTTCCGAGACCTCCAACCTGTTTCAGTCAGTAAAATACACCTGGTAT
TCGTGAATGACTGTTTATTCTGATTATTTTACTATTTAGTTCCTAAATTA
TTGTAAATTATTTGTAATTTTTACAAAACTGAATTGGAAAAATCACCGAA
ATTTTGAATATTTCACACATTTCTCTTGGGGAAAAATAGTGCAACGAACA
TTTTATAAGGGGAGGACTAAAATAATAAAACATTTTCTGACTATTTCTAT
TCTTTGATTATTCATTTGAAATTGATTAAAGCAAAACTTTGCAACTCTTG
CTCGTTTGCGAAAGTGGAGGAATGCCACGAGAAAATTGTAAATATGTAAA
AGAAAATAGAAATTATTAATGAGCTGAAACACGGGTGTTATTGATAAAAA
GAAAACACATCAAAGGGGGACAAAAGGATAAATGAAAGTTGCAATGCTTG
ATAGCACATTGACAAAACTGTATCTATGCTTTCCTTTATAAACCAACACT
GTTTATTTTCTGTTAGAATTGTACAAACCAAATCAAGACTTTTTCTATGA
CTTTTATTAATTACACACTCATGTACCTTTTTGTTGTTATCGTAGACGTT
TAGATCATTCACCCCTGAGGCTCAAGATGATCCAAACCTTCATTCTTTAA
ATTTAAAAGAAATAGCTAATAATTCTGGTTTGGATACTCCACCGAAAGTC
TCTATACAAATCCTGCTAACCCAAATTCGACAGGTTAACTAGCAGTCAAC
CCGTCTCTGAGATTCCAACAAAGTAAAGAAAGATA
back to top

protein sequence of SMED30021961-orf-1

>SMED30021961-orf-1 ID=SMED30021961-orf-1|Name=SMED30021961-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=877bp
MSIIFKRIHFITIDLIFLLIPMVSSLLSSESPISIQIFENLPVGSVICKL
SNVIIPRPSDTTKFKLIKNRFFQIENGDNLKVSGLIDRDDNLELCAYRNV
NFSCIWRGILFCGTNNLKILEIQILDENDNVPQWSQNSIVIEVVENTKLD
SFYLELPKARDSDEHPNNISYYKIEPTSKYFFISSEKSNKGIKPFLKLRR
GIDRELISWHNVTLLAVDGGTPSKTGSLQLLIKIIDVNDNKPIFESSFYT
QSIDCNLEINSTLDLKIHATDLDINANVTYRFSLNVPFIVQDCFDLNPFN
AILRVKKSLKHECFASEYRFSIDALDHGRPVEKSKTTVTLHLKNQNLYPP
SILLPGNNAVIRIIENQDIGVVILTGVVKDNDSGMDGKFNCSILEPKNYD
IILTMNKTKSENIAIISLITNKIFDREVKTRIQLIIFCKDFGKPAFNTSA
EISIIIIDVNDNSPQFEKEFYHYTIFEENQPNFTIAQLTAHDLDDGLNAQ
LRYRIQWDTSLYDPNKLIKVESNCQIIAIQSLDREKYPNGFRFVCPYQVI
ATDSGEPQRSGSTTVSIELMDINDNIPVFQQAFYNISFLEDFGSKKNSRK
VAVFIAHDPDFGVNGDVTYSIVRETLLPFKLNPNSGELYSYDLVDRETQP
SQYTFSITARDSPTNLLYRKTATVSVSIVIEDCNDNEPIFIFPNESNYKI
QLSYLVPVGSLVTLVKAIDKDSGINSQIQFILEEEKRNILFSINETSGEL
LTSTVLSVIHKGEETLFIKAIDCGSPRLTAIQQLTIEIGEFRNPDSTPFN
ETEESFLSDQATFIIVGIILGTFFICCGLVTGICTMAYRRWHSSNNRSPP
NQLYQAGEELTNLQYIDNYLIMKEMS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0002028dorsal-ventral muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR002126Cadherin-like_dom
IPR020894Cadherin_CS
IPR015919Cadherin-like_sf
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007155cell adhesion
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002126Cadherin-likePRINTSPR00205CADHERINcoord: 577..590
score: 35.92
coord: 558..577
score: 41.73
coord: 672..689
score: 38.81
coord: 466..495
score: 27.77
IPR002126Cadherin-likeSMARTSM00112CA_2coord: 376..464
e-value: 1.9E-12
score: 57.4
coord: 157..242
e-value: 1.4E-14
score: 64.5
coord: 488..577
e-value: 2.2E-13
score: 60.4
coord: 715..796
e-value: 6.8E-7
score: 38.9
coord: 267..350
e-value: 4.3E-8
score: 42.9
coord: 604..688
e-value: 7.4E-22
score: 88.6
IPR002126Cadherin-likePFAMPF00028Cadherincoord: 476..569
e-value: 5.7E-9
score: 36.3
coord: 600..680
e-value: 6.3E-10
score: 39.4
coord: 701..788
e-value: 3.4E-9
score: 37.0
coord: 141..234
e-value: 2.4E-8
score: 34.3
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 239..347
e-value: 9.6E-16
score: 60.1
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 348..461
e-value: 3.8E-15
score: 58.3
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 687..790
e-value: 3.5E-17
score: 64.8
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 128..238
e-value: 1.1E-19
score: 72.9
coord: 575..686
e-value: 1.4E-21
score: 79.0
coord: 462..574
e-value: 3.0E-24
score: 87.7
NoneNo IPR availablePANTHERPTHR24026FAMILY NOT NAMEDcoord: 525..788
coord: 418..623
coord: 266..506
coord: 120..403
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 467..579
score: 19.714
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 245..352
score: 14.584
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 580..690
score: 21.402
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 361..466
score: 16.403
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 694..800
score: 13.268
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 135..244
score: 19.999
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 138..240
e-value: 2.53405E-17
score: 75.8129
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 698..788
e-value: 2.17665E-16
score: 73.1165
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 256..346
e-value: 2.53197E-11
score: 58.8641
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 471..575
e-value: 1.22066E-21
score: 88.1393
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 601..686
e-value: 3.0892E-19
score: 81.2057
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 360..462
e-value: 3.73296E-15
score: 69.6497
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..25
score: 0.746
NoneNo IPR availableTMHMMTMhelixcoord: 811..833
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 567..577
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 678..688
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 454..464
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 232..242
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 360..459
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 122..261
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 232..353
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 567..692
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 678..790
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 454..591