Actin-related protein 3

Overview
NameActin-related protein 3
Smed IDSMED30021956
Length (bp)1416
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Actin-related protein 3 (SMED30021956) t-SNE clustered cells

Violin plots show distribution of expression levels for Actin-related protein 3 (SMED30021956) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Actin-related protein 3 (SMED30021956) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Actin-related protein 3 (SMED30021956) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021956

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30021956h1SMcG0010287 Contig5723GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30021956h1SMcG0010287 Contig5723GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
parenchymaSMED30021956h1SMcG0010287 dd_453dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
protonephridiaSMED30021956h1SMcG0010287 dd_Smed_v4_453_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30021956h1SMcG0010287 dd_Smed_v4_453_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021956h1SMcG0010287 dd_Smed_v4_453_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30021956h1SMcG0010287 dd_Smed_v4_453_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30021956h1SMcG0010287 dd_Smed_v4_453_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021956h1SMcG0010287 dd_Smed_v4_453_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Actin-related protein 3 vs. Ensembl Human
Match: ACTR3 (actin related protein 3 [Source:HGNC Symbol;Acc:HGNC:170])

HSP 1 Score: 615.92 bits (1587), Expect = 0.000e+0
Identity = 299/419 (71.36%), Postives = 349/419 (83.29%), Query Frame = 3
Query:   42 ARLPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATRE-GKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFSFDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVFGRMT 1295
             RLPA V+D GTGY+KLG+A N+EPQFIIPSCIA +E  K+G +  RR+  G+DDL+F+IGDEA     K  ++ +WPIRHG+VEDWDL ERFMEQ IFKYLRAEPEDHYFLLTEPPLNTPENRE+TAEIMFE+FN+PGLYIAVQAVLALAASWTSR   ERTLTGTVIDSGDGVTHVIPV +GYVIGS IKHIPIAGRDIT+FIQQLLR+RE  IPP+ S+E AK +KERYSYVCPD+ KEF KYD+D  KWIK +    +    +FS DVGYE+FLGPE+FF PEF N DF   IS+VVD VIQ+CPID RRPLY NIVLSGGS+MF+   RR+QRD+K+ VD RLKL+EE S G+LKP PIDV+V++H MQRYAVWFGG++LAS+ +FY   HTKK Y+E+GPSICRHNPVFG M+
Sbjct:    3 GRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIE---KPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS 418          
BLAST of Actin-related protein 3 vs. Ensembl Human
Match: ACTR3B (actin related protein 3B [Source:HGNC Symbol;Acc:HGNC:17256])

HSP 1 Score: 599.356 bits (1544), Expect = 0.000e+0
Identity = 290/417 (69.54%), Postives = 342/417 (82.01%), Query Frame = 3
Query:   48 LPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATRE-GKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFSFDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVFGRMT 1295
            LP  V+D GTGY+KLG+A N+EPQFIIPSCIA RE  K+  +  RR+  G+DDL+F+IGDEA     K  ++ +WPIRHG++EDWDL ERFMEQ +FKYLRAEPEDHYFL+TEPPLNTPENRE+ AEIMFE+FN+PGLYIAVQAVLALAASWTSR   ERTLTG VIDSGDGVTHVIPV +GYVIGS IKHIPIAGRDIT+FIQQLLRERE  IPP+ S+E AK IKE+Y Y+CPDI KEFAKYD DP KWIK +    +     F  DVGYE+FLGPE+FF PEF N DF  SISDVVD VIQ+CPID RRPLY N+VLSGGS+MF+   RR+QRD+K+ VD RL+L+EE S G++KP P++V+VV+H MQRYAVWFGG++LAS+ +F+   HTKK Y+E GPSICRHNPVFG M+
Sbjct:    5 LPPCVVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRRVLRGVDDLDFFIGDEAI---DKPTYATKWPIRHGIIEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLNTPENREYLAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLREREVGIPPEQSLETAKAIKEKYCYICPDIVKEFAKYDVDPRKWIKQYTGINAINQKKFVIDVGYERFLGPEIFFHPEFANPDFMESISDVVDEVIQNCPIDVRRPLYKNVVLSGGSTMFRDFGRRLQRDLKRVVDARLRLSEELSGGRIKPKPVEVQVVTHHMQRYAVWFGGSMLASTPEFFQVCHTKKDYEEYGPSICRHNPVFGVMS 418          
BLAST of Actin-related protein 3 vs. Ensembl Human
Match: ACTR3 (actin related protein 3 [Source:HGNC Symbol;Acc:HGNC:170])

HSP 1 Score: 552.362 bits (1422), Expect = 0.000e+0
Identity = 268/368 (72.83%), Postives = 310/368 (84.24%), Query Frame = 3
Query:  192 GLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFSFDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVFGRMT 1295
            G+DDL+F+IGDEA     K  ++ +WPIRHG+VEDWDL ERFMEQ IFKYLRAEPEDHYFLLTEPPLNTPENRE+TAEIMFE+FN+PGLYIAVQAVLALAASWTSR   ERTLTGTVIDSGDGVTHVIPV +GYVIGS IKHIPIAGRDIT+FIQQLLR+RE  IPP+ S+E AK +KERYSYVCPD+ KEF KYD+D  KWIK +    +    +FS DVGYE+FLGPE+FF PEF N DF   IS+VVD VIQ+CPID RRPLY NIVLSGGS+MF+   RR+QRD+K+ VD RLKL+EE S G+LKP PIDV+V++H MQRYAVWFGG++LAS+ +FY   HTKK Y+E+GPSICRHNPVFG M+
Sbjct:    3 GVDDLDFFIGDEAIE---KPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS 367          
BLAST of Actin-related protein 3 vs. Ensembl Human
Match: ACTR3B (actin related protein 3B [Source:HGNC Symbol;Acc:HGNC:17256])

HSP 1 Score: 495.738 bits (1275), Expect = 3.830e-175
Identity = 239/329 (72.64%), Postives = 276/329 (83.89%), Query Frame = 3
Query:  309 ERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFSFDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVFGRMT 1295
            ERFMEQ +FKYLRAEPEDHYFL+TEPPLNTPENRE+ AEIMFE+FN+PGLYIAVQAVLALAASWTSR   ERTLTG VIDSGDGVTHVIPV +GYVIGS IKHIPIAGRDIT+FIQQLLRERE  IPP+ S+E AK IKE+Y Y+CPDI KEFAKYD DP KWIK +    +     F  DVGYE+FLGPE+FF PEF N DF  SISDVVD VIQ+CPID RRPLY N+VLSGGS+MF+   RR+QRD+K+ VD RL+L+EE S G++KP P++V+VV+H MQRYAVWFGG++LAS+ +F+   HTKK Y+E GPSICRHNPVFG M+
Sbjct:    2 ERFMEQVVFKYLRAEPEDHYFLMTEPPLNTPENREYLAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLREREVGIPPEQSLETAKAIKEKYCYICPDIVKEFAKYDVDPRKWIKQYTGINAINQKKFVIDVGYERFLGPEIFFHPEFANPDFMESISDVVDEVIQNCPIDVRRPLYKNVVLSGGSTMFRDFGRRLQRDLKRVVDARLRLSEELSGGRIKPKPVEVQVVTHHMQRYAVWFGGSMLASTPEFFQVCHTKKDYEEYGPSICRHNPVFGVMS 330          
BLAST of Actin-related protein 3 vs. Ensembl Human
Match: ACTR3B (actin related protein 3B [Source:HGNC Symbol;Acc:HGNC:17256])

HSP 1 Score: 454.521 bits (1168), Expect = 1.298e-158
Identity = 226/316 (71.52%), Postives = 257/316 (81.33%), Query Frame = 3
Query:   48 LPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATRE-GKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFSFDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYN 992
            LP  V+D GTGY+KLG+A N+EPQFIIPSCIA RE  K+  +  RR+  G+DDL+F+IGDEA     K  ++ +WPIRHG++EDWDL ERFMEQ +FKYLRAEPEDHYFL+TEPPLNTPENRE+ AEIMFE+FN+PGLYIAVQAVLALAASWTSR   ERTLTG VIDSGDGVTHVIPV +GYVIGS IKHIPIAGRDIT+FIQQLLRERE  IPP+ S+E AK IKE+Y Y+CPDI KEFAKYD DP KWIK +    +     F  DVGYE+FLGPE+FF PEF N DF  SISDVVD VIQ+CPID RRPLY 
Sbjct:    5 LPPCVVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRRVLRGVDDLDFFIGDEAI---DKPTYATKWPIRHGIIEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLNTPENREYLAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLREREVGIPPEQSLETAKAIKEKYCYICPDIVKEFAKYDVDPRKWIKQYTGINAINQKKFVIDVGYERFLGPEIFFHPEFANPDFMESISDVVDEVIQNCPIDVRRPLYK 317          

HSP 2 Score: 51.6026 bits (122), Expect = 1.472e-6
Identity = 20/30 (66.67%), Postives = 24/30 (80.00%), Query Frame = 3
Query: 1206 DFYTAAHTKKQYDEVGPSICRHNPVFGRMT 1295
            +F+   HTKK Y+E GPSICRHNPVFG M+
Sbjct:  319 EFFQVCHTKKDYEEYGPSICRHNPVFGVMS 348          
BLAST of Actin-related protein 3 vs. Ensembl Celegans
Match: arx-1 (Actin-related protein 3 [Source:UniProtKB/Swiss-Prot;Acc:Q9N4I0])

HSP 1 Score: 592.808 bits (1527), Expect = 0.000e+0
Identity = 278/423 (65.72%), Postives = 338/423 (79.91%), Query Frame = 3
Query:   45 RLPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATREGKMGGKDSR------RIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFSFDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVFGRMT 1295
            +LPA VIDNGTGY+KLG+A N+EPQFIIPS IA ++ K+   +S+      R+G G+DDL+F+IGDEA +    N ++V++PIRHG+VEDWDL ER+ EQ IFKYLRAEPEDH+FLLTEPPLNTPENRE+TAEIMFE+FN+PGLYIAVQAVLAL ASW SR  NER+LTG VIDSGDGVTH IPV DGYVIGS IKHIPIAGRDIT+FIQ LLR+RE  IP + S E AK IKE++ YVCPD+ KEF KYD+D  KW++ +    S     F+ DVGYE+FLGPE+FF PEF N +F   ISD +DT+IQ CPID RR LY NIVLSGGS+MFK   R++QRD+K+  D RL+++E  S G+LKP PIDV+V+SH MQRYAVWFGG++LAS+ +FY  +HTK +Y E GPSICR+NPVFG +T
Sbjct:    5 QLPACVIDNGTGYTKLGYAGNTEPQFIIPSAIAVKD-KVASSNSQAMRWNNRVGAGIDDLDFFIGDEALSPAATN-YTVKYPIRHGIVEDWDLMERYWEQCIFKYLRAEPEDHFFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALTASWNSREANERSLTGLVIDSGDGVTHCIPVADGYVIGSCIKHIPIAGRDITYFIQSLLRDREHTIPAEQSYEVAKMIKEKFCYVCPDVMKEFVKYDTDAAKWLRTYDGINSITKKPFNVDVGYERFLGPEIFFHPEFCNPEFTTPISDTIDTLIQQCPIDVRRGLYENIVLSGGSTMFKDFARKLQRDVKRLSDGRLQMSETLSGGRLKPKPIDVQVISHKMQRYAVWFGGSMLASTSEFYQVSHTKAEYMERGPSICRYNPVFGALT 425          
BLAST of Actin-related protein 3 vs. Ensembl Celegans
Match: act-4 (Actin-4 [Source:UniProtKB/Swiss-Prot;Acc:P10986])

HSP 1 Score: 261.922 bits (668), Expect = 2.859e-83
Identity = 150/413 (36.32%), Postives = 223/413 (54.00%), Query Frame = 3
Query:   48 LPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATREGKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFS-FDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVF 1283
            + A+V+DNG+G  K GFA +  P+ + PS +       G    + +  G+   + Y+GDEAQ+  G    ++++PI HG+V +WD  E+      +  LR  PE+H  LLTE PLN   NRE   +IMFETFN P +Y+A+QAVL+L AS  +        TG V+DSGDGVTH +P+ +GY +  AI  + +AGRD+T ++ ++L ER          E  + IKE+  YV  D  +E A   S       +  +  S + PD     VG E+F  PE  F+P F+ G   A I +     I  C ID R+ LY N VLSGG++M+  +  R+Q++I                  L P+ + +K+++   ++Y+VW GG++LAS   F     +K++YDE GPSI  H   F
Sbjct:    6 VAALVVDNGSGMCKAGFAGDDAPRAVFPSIV-------GRPRHQGVMVGMGQKDSYVGDEAQSKRGI--LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRT--------TGVVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAS-------SSSLEKSYELPDGQVITVGNERFRCPEALFQPSFL-GMESAGIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEIT----------------ALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV-HRKCF 376          
BLAST of Actin-related protein 3 vs. Ensembl Celegans
Match: act-3 (Actin-3 [Source:UniProtKB/Swiss-Prot;Acc:P0DM42])

HSP 1 Score: 261.922 bits (668), Expect = 3.252e-83
Identity = 150/413 (36.32%), Postives = 223/413 (54.00%), Query Frame = 3
Query:   48 LPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATREGKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFS-FDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVF 1283
            + A+V+DNG+G  K GFA +  P+ + PS +       G    + +  G+   + Y+GDEAQ+  G    ++++PI HG+V +WD  E+      +  LR  PE+H  LLTE PLN   NRE   +IMFETFN P +Y+A+QAVL+L AS  +        TG V+DSGDGVTH +P+ +GY +  AI  + +AGRD+T ++ ++L ER          E  + IKE+  YV  D  +E A   S       +  +  S + PD     VG E+F  PE  F+P F+ G   A I +     I  C ID R+ LY N VLSGG++M+  +  R+Q++I                  L P+ + +K+++   ++Y+VW GG++LAS   F     +K++YDE GPSI  H   F
Sbjct:    6 VAALVVDNGSGMCKAGFAGDDAPRAVFPSIV-------GRPRHQGVMVGMGQKDSYVGDEAQSKRGI--LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRT--------TGVVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAS-------SSSLEKSYELPDGQVITVGNERFRCPEAMFQPSFL-GMESAGIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEIT----------------ALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV-HRKCF 376          
BLAST of Actin-related protein 3 vs. Ensembl Celegans
Match: act-3 (Actin-3 [Source:UniProtKB/Swiss-Prot;Acc:P0DM42])

HSP 1 Score: 261.922 bits (668), Expect = 3.252e-83
Identity = 150/413 (36.32%), Postives = 223/413 (54.00%), Query Frame = 3
Query:   48 LPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATREGKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFS-FDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVF 1283
            + A+V+DNG+G  K GFA +  P+ + PS +       G    + +  G+   + Y+GDEAQ+  G    ++++PI HG+V +WD  E+      +  LR  PE+H  LLTE PLN   NRE   +IMFETFN P +Y+A+QAVL+L AS  +        TG V+DSGDGVTH +P+ +GY +  AI  + +AGRD+T ++ ++L ER          E  + IKE+  YV  D  +E A   S       +  +  S + PD     VG E+F  PE  F+P F+ G   A I +     I  C ID R+ LY N VLSGG++M+  +  R+Q++I                  L P+ + +K+++   ++Y+VW GG++LAS   F     +K++YDE GPSI  H   F
Sbjct:    6 VAALVVDNGSGMCKAGFAGDDAPRAVFPSIV-------GRPRHQGVMVGMGQKDSYVGDEAQSKRGI--LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRT--------TGVVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAS-------SSSLEKSYELPDGQVITVGNERFRCPEAMFQPSFL-GMESAGIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEIT----------------ALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV-HRKCF 376          
BLAST of Actin-related protein 3 vs. Ensembl Celegans
Match: act-3 (Actin-3 [Source:UniProtKB/Swiss-Prot;Acc:P0DM42])

HSP 1 Score: 261.922 bits (668), Expect = 3.252e-83
Identity = 150/413 (36.32%), Postives = 223/413 (54.00%), Query Frame = 3
Query:   48 LPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATREGKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFS-FDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVF 1283
            + A+V+DNG+G  K GFA +  P+ + PS +       G    + +  G+   + Y+GDEAQ+  G    ++++PI HG+V +WD  E+      +  LR  PE+H  LLTE PLN   NRE   +IMFETFN P +Y+A+QAVL+L AS  +        TG V+DSGDGVTH +P+ +GY +  AI  + +AGRD+T ++ ++L ER          E  + IKE+  YV  D  +E A   S       +  +  S + PD     VG E+F  PE  F+P F+ G   A I +     I  C ID R+ LY N VLSGG++M+  +  R+Q++I                  L P+ + +K+++   ++Y+VW GG++LAS   F     +K++YDE GPSI  H   F
Sbjct:    6 VAALVVDNGSGMCKAGFAGDDAPRAVFPSIV-------GRPRHQGVMVGMGQKDSYVGDEAQSKRGI--LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRT--------TGVVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAS-------SSSLEKSYELPDGQVITVGNERFRCPEAMFQPSFL-GMESAGIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEIT----------------ALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV-HRKCF 376          
BLAST of Actin-related protein 3 vs. Ensembl Fly
Match: Arp3 (gene:FBgn0262716 transcript:FBtr0076737)

HSP 1 Score: 596.66 bits (1537), Expect = 0.000e+0
Identity = 289/419 (68.97%), Postives = 344/419 (82.10%), Query Frame = 3
Query:   42 ARLPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATRE-GKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFSFDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVFGRMT 1295
             RLPA VID GTGYSKLGFA N EPQFIIPS IA +E  ++G  ++RRI  G++DL+F+IGDEA    G   +S+++P+RHG+VEDWDL ERF+EQ +FKYLRAEPEDHYFLLTEPPLNTPENRE+TAEIMFETFN+PGLYIAVQAVLALAASW SR   ERTLTG V+DSGDGVTHVIPV +GYVIGS IKHIPIAGR+IT FIQ LLRERE  IPP+ S+E AK IKE++ Y+CPDIAKEFAKYD++P KWI+      +     F+ DVGYE+FLGPE+FF PEF N DF   +S++VD VIQ+CPID RRPLYNNIVLSGGS+MFK   RR+QRDIK++VD RL+++E  S G++KP PIDV+V++H MQRYAVWFGG++LAS+ +FY   HTK  Y+E GPSICRHNPVFG MT
Sbjct:    3 GRLPACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIGDEAFDATG---YSIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFETFNVPGLYIAVQAVLALAASWASRSAEERTLTGIVVDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRNITSFIQSLLREREVGIPPEQSLETAKAIKEKHCYICPDIAKEFAKYDTEPGKWIRNFSGVNTVTKAPFNVDVGYERFLGPEIFFHPEFSNPDFTIPLSEIVDNVIQNCPIDVRRPLYNNIVLSGGSTMFKDFGRRLQRDIKRSVDTRLRISENLSEGRIKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKAAYEEYGPSICRHNPVFGTMT 418          
BLAST of Actin-related protein 3 vs. Ensembl Fly
Match: Arp3 (gene:FBgn0262716 transcript:FBtr0334087)

HSP 1 Score: 596.66 bits (1537), Expect = 0.000e+0
Identity = 289/419 (68.97%), Postives = 344/419 (82.10%), Query Frame = 3
Query:   42 ARLPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATRE-GKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFSFDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVFGRMT 1295
             RLPA VID GTGYSKLGFA N EPQFIIPS IA +E  ++G  ++RRI  G++DL+F+IGDEA    G   +S+++P+RHG+VEDWDL ERF+EQ +FKYLRAEPEDHYFLLTEPPLNTPENRE+TAEIMFETFN+PGLYIAVQAVLALAASW SR   ERTLTG V+DSGDGVTHVIPV +GYVIGS IKHIPIAGR+IT FIQ LLRERE  IPP+ S+E AK IKE++ Y+CPDIAKEFAKYD++P KWI+      +     F+ DVGYE+FLGPE+FF PEF N DF   +S++VD VIQ+CPID RRPLYNNIVLSGGS+MFK   RR+QRDIK++VD RL+++E  S G++KP PIDV+V++H MQRYAVWFGG++LAS+ +FY   HTK  Y+E GPSICRHNPVFG MT
Sbjct:    3 GRLPACVIDVGTGYSKLGFAGNKEPQFIIPSAIAIKESARVGDTNTRRITKGIEDLDFFIGDEAFDATG---YSIKYPVRHGLVEDWDLMERFLEQCVFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFETFNVPGLYIAVQAVLALAASWASRSAEERTLTGIVVDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRNITSFIQSLLREREVGIPPEQSLETAKAIKEKHCYICPDIAKEFAKYDTEPGKWIRNFSGVNTVTKAPFNVDVGYERFLGPEIFFHPEFSNPDFTIPLSEIVDNVIQNCPIDVRRPLYNNIVLSGGSTMFKDFGRRLQRDIKRSVDTRLRISENLSEGRIKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKAAYEEYGPSICRHNPVFGTMT 418          
BLAST of Actin-related protein 3 vs. Ensembl Fly
Match: Act5C (gene:FBgn0000042 transcript:FBtr0070822)

HSP 1 Score: 258.455 bits (659), Expect = 8.247e-82
Identity = 146/413 (35.35%), Postives = 222/413 (53.75%), Query Frame = 3
Query:   48 LPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATREGKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFS-FDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVF 1283
            + A+V+DNG+G  K GFA +  P+ + PS +       G    + +  G+   + Y+GDEAQ+  G    ++++PI HG+V +WD  E+      +  LR  PE+H  LLTE PLN   NRE   +IMFETFN P +Y+A+QAVL+L AS  +        TG V+DSGDGV+H +P+ +GY +  AI  + +AGRD+T ++ ++L ER          E  + IKE+  YV  D  +E A   S       +  +  S + PD     +G E+F  PE  F+P F+ G     I +     I  C +D R+ LY N VLSGG++M+  +  R+Q++I                  L P+ + +K+++   ++Y+VW GG++LAS   F     +K++YDE GPSI  H   F
Sbjct:    6 VAALVVDNGSGMCKAGFAGDDAPRAVFPSIV-------GRPRHQGVMVGMGQKDSYVGDEAQSKRGI--LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRT--------TGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAS-------SSSLEKSYELPDGQVITIGNERFRCPEALFQPSFL-GMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEIT----------------ALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV-HRKCF 376          
BLAST of Actin-related protein 3 vs. Ensembl Fly
Match: Act5C (gene:FBgn0000042 transcript:FBtr0100662)

HSP 1 Score: 258.455 bits (659), Expect = 8.247e-82
Identity = 146/413 (35.35%), Postives = 222/413 (53.75%), Query Frame = 3
Query:   48 LPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATREGKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFS-FDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVF 1283
            + A+V+DNG+G  K GFA +  P+ + PS +       G    + +  G+   + Y+GDEAQ+  G    ++++PI HG+V +WD  E+      +  LR  PE+H  LLTE PLN   NRE   +IMFETFN P +Y+A+QAVL+L AS  +        TG V+DSGDGV+H +P+ +GY +  AI  + +AGRD+T ++ ++L ER          E  + IKE+  YV  D  +E A   S       +  +  S + PD     +G E+F  PE  F+P F+ G     I +     I  C +D R+ LY N VLSGG++M+  +  R+Q++I                  L P+ + +K+++   ++Y+VW GG++LAS   F     +K++YDE GPSI  H   F
Sbjct:    6 VAALVVDNGSGMCKAGFAGDDAPRAVFPSIV-------GRPRHQGVMVGMGQKDSYVGDEAQSKRGI--LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRT--------TGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAS-------SSSLEKSYELPDGQVITIGNERFRCPEALFQPSFL-GMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEIT----------------ALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV-HRKCF 376          
BLAST of Actin-related protein 3 vs. Ensembl Fly
Match: Act5C (gene:FBgn0000042 transcript:FBtr0345894)

HSP 1 Score: 258.455 bits (659), Expect = 8.247e-82
Identity = 146/413 (35.35%), Postives = 222/413 (53.75%), Query Frame = 3
Query:   48 LPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATREGKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFS-FDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVF 1283
            + A+V+DNG+G  K GFA +  P+ + PS +       G    + +  G+   + Y+GDEAQ+  G    ++++PI HG+V +WD  E+      +  LR  PE+H  LLTE PLN   NRE   +IMFETFN P +Y+A+QAVL+L AS  +        TG V+DSGDGV+H +P+ +GY +  AI  + +AGRD+T ++ ++L ER          E  + IKE+  YV  D  +E A   S       +  +  S + PD     +G E+F  PE  F+P F+ G     I +     I  C +D R+ LY N VLSGG++M+  +  R+Q++I                  L P+ + +K+++   ++Y+VW GG++LAS   F     +K++YDE GPSI  H   F
Sbjct:    6 VAALVVDNGSGMCKAGFAGDDAPRAVFPSIV-------GRPRHQGVMVGMGQKDSYVGDEAQSKRGI--LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRT--------TGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAS-------SSSLEKSYELPDGQVITIGNERFRCPEALFQPSFL-GMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEIT----------------ALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV-HRKCF 376          
BLAST of Actin-related protein 3 vs. Ensembl Zebrafish
Match: actr3b (actin related protein 3B [Source:ZFIN;Acc:ZDB-GENE-070424-10])

HSP 1 Score: 592.423 bits (1526), Expect = 0.000e+0
Identity = 286/419 (68.26%), Postives = 340/419 (81.15%), Query Frame = 3
Query:   42 ARLPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATRE-GKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFSFDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVFGRMT 1295
            AR P  VID GTGY+K+G+A N+EPQFI+P+CIA RE   +G +  RR+  G+DDL+F+IGDEA     K +++ +WPIRHG++EDWD  E+FMEQ IFKYLRAEPEDH FL+TEPPLNTPENRE+ AEIMFETFN+PGLYIAVQAVLALAASWTSR   ERTLTG VIDSGDGVTH IPV +GYVIGS IKHIPIAGRDIT+FIQQLLRERE  IPP+ S+E AK +KERY Y+CPDI KEF KYD DP KWIK +K   +    +F  DVGYE+FLGPE+FF PEF N DF   ISDVVD VIQ+CPID RRPLY NIVLSGGS+MF+   RR+QRD+K+ VD RL+L+EE S G++KP P++V+V+SH MQRYAVWFGG++LAS+ +F+   HTKK Y+E GP ICRHNPVFG M+
Sbjct:   10 ARPPPCVIDCGTGYTKIGYAGNTEPQFIMPTCIAVRESASVGDQAQRRLVKGVDDLDFFIGDEAI---DKPNYATKWPIRHGIIEDWDFMEKFMEQVIFKYLRAEPEDHNFLMTEPPLNTPENREYLAEIMFETFNVPGLYIAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHAIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLREREIGIPPEQSLETAKAVKERYCYICPDIVKEFTKYDMDPGKWIKKYKGINAISKNEFQIDVGYERFLGPEIFFHPEFANPDFMQPISDVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRVVDARLRLSEELSGGRIKPKPMEVQVISHHMQRYAVWFGGSMLASTPEFFQVCHTKKDYEEYGPRICRHNPVFGIMS 425          
BLAST of Actin-related protein 3 vs. Ensembl Zebrafish
Match: actr3b (actin related protein 3B [Source:ZFIN;Acc:ZDB-GENE-070424-10])

HSP 1 Score: 448.743 bits (1153), Expect = 7.782e-157
Identity = 222/318 (69.81%), Postives = 256/318 (80.50%), Query Frame = 3
Query:   42 ARLPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATRE-GKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFSFDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYN 992
            AR P  VID GTGY+K+G+A N+EPQFI+P+CIA RE   +G +  RR+  G+DDL+F+IGDEA     K +++ +WPIRHG++EDWD  E+FMEQ IFKYLRAEPEDH FL+TEPPLNTPENRE+ AEIMFETFN+PGLYIAVQAVLALAASWTSR   ERTLTG VIDSGDGVTH IPV +GYVIGS IKHIPIAGRDIT+FIQQLLRERE  IPP+ S+E AK +KERY Y+CPDI KEF KYD DP KWIK +K   +    +F  DVGYE+FLGPE+FF PEF N DF   ISDVVD VIQ+CPID RRPLY 
Sbjct:    4 ARPPPCVIDCGTGYTKIGYAGNTEPQFIMPTCIAVRESASVGDQAQRRLVKGVDDLDFFIGDEAI---DKPNYATKWPIRHGIIEDWDFMEKFMEQVIFKYLRAEPEDHNFLMTEPPLNTPENREYLAEIMFETFNVPGLYIAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHAIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLREREIGIPPEQSLETAKAVKERYCYICPDIVKEFTKYDMDPGKWIKKYKGINAISKNEFQIDVGYERFLGPEIFFHPEFANPDFMQPISDVVDEVIQNCPIDVRRPLYK 318          
BLAST of Actin-related protein 3 vs. Ensembl Zebrafish
Match: actr3 (actin related protein 3 [Source:ZFIN;Acc:ZDB-GENE-040428-2])

HSP 1 Score: 326.25 bits (835), Expect = 3.643e-110
Identity = 165/216 (76.39%), Postives = 186/216 (86.11%), Query Frame = 3
Query:   81 YSKLGFADNSEPQFIIPSCIATRE-GKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIK 725
            Y+KLG+A N+EPQFIIPSCIA +E  K+G +  RR+  G+DDL+FYIGDEA     K  ++ +WPIRHG+VEDWDL ERFMEQ IFKYLRAEPEDHYFLLTEPPLNTPENRE+TAEIMFE+FN+PGLYIAVQAVLALAASWTSR   ERTLTGTVIDSGDGVTHVIPV +GYVIGS IKHIPIAGRDIT+F QQLLRERE  IPP+ S+E AK +K
Sbjct:    1 YTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRMMKGVDDLDFYIGDEAI---DKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFTQQLLREREVGIPPEQSLETAKAVK 213          
BLAST of Actin-related protein 3 vs. Ensembl Zebrafish
Match: acta1a (actin alpha 1, skeletal muscle a [Source:ZFIN;Acc:ZDB-GENE-050417-267])

HSP 1 Score: 260.381 bits (664), Expect = 2.048e-82
Identity = 149/411 (36.25%), Postives = 221/411 (53.77%), Query Frame = 3
Query:   54 AVVIDNGTGYSKLGFADNSEPQFIIPSCIATREGKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFS-FDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVF 1283
            A+V DNG+G  K GFA +  P+ + PS +       G    + +  G+   + Y+GDEAQ+  G    ++++PI HG++ +WD  E+      +  LR  PE+H  LLTE PLN   NRE   +IMFETFN+P +Y+A+QAVL+L AS  +        TG V+DSGDGVTH +P+ +GY +  AI  + +AGRD+T ++ ++L ER          E  + IKE+  YV  D   E A   S       +  +  S + PD     +G E+F  PE  F+P F+ G   A I +     I  C ID R+ LY N VLSGG++M+  +  R+Q++I                  L P+ + +K+++   ++Y+VW GG++LAS   F     TK++YDE GPSI  H   F
Sbjct:    9 ALVCDNGSGLVKAGFAGDDAPRAVFPSIV-------GRPRHQGVMVGMGQKDSYVGDEAQSKRGI--LTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRT--------TGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAAS-------SSSLEKSYELPDGQVITIGNERFRCPETLFQPSFI-GMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEIT----------------ALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWITKQEYDEAGPSIV-HRKCF 377          
BLAST of Actin-related protein 3 vs. Ensembl Zebrafish
Match: acta2 (actin alpha 2, smooth muscle [Source:ZFIN;Acc:ZDB-GENE-030131-1229])

HSP 1 Score: 260.381 bits (664), Expect = 2.137e-82
Identity = 148/411 (36.01%), Postives = 222/411 (54.01%), Query Frame = 3
Query:   54 AVVIDNGTGYSKLGFADNSEPQFIIPSCIATREGKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFS-FDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVF 1283
            A+V DNG+G  K GFA +  P+ + PS +       G    + +  G+   + Y+GDEAQ+  G    ++++PI HG++ +WD  E+    + +  LR  PE+H  LLTE PLN   NRE   +IMFETFN+P +Y+A+QAVL+L AS  +        TG V+DSGDGVTH +P+ +GY +  AI  + +AGRD+T ++ ++L ER          E  + IKE+  YV  D   E A   S       +  +  S + PD     +G E+F  PE  F+P F+ G   A I +     I  C ID R+ LY N VLSGG++M+  +  R+Q++I                  L P+ + +K+++   ++Y+VW GG++LAS   F     +K++YDE GPSI  H   F
Sbjct:    9 ALVCDNGSGLCKAGFAGDDAPRAVFPSIV-------GRPRHQGVMVGMGQKDSYVGDEAQSKRGI--LTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRT--------TGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAAS-------SSSLEKSYELPDGQVITIGNERFRCPETLFQPSFI-GMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEIT----------------ALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIV-HRKCF 377          
BLAST of Actin-related protein 3 vs. Ensembl Xenopus
Match: calr3 (calreticulin 3 [Source:Xenbase;Acc:XB-GENE-6258823])

HSP 1 Score: 579.326 bits (1492), Expect = 0.000e+0
Identity = 286/419 (68.26%), Postives = 338/419 (80.67%), Query Frame = 3
Query:   42 ARLPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATRE-GKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFSFDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVFGRMT 1295
            ARLPA V+D GTGY+KLG+A N+EPQFIIPSCIA +E  K+G +  RR+  G+DDL+F+IGDEA     K  ++ +WPIRHG+VEDWDL ERFMEQ IFKYLRAEPEDHYFLLTEPPLNTPENRE+TAEIMFE+FN+PGLYIAVQAVLALAASWTSR   ERTLTGTVIDSGDGVTHVIPV +GYVIGS IKHIPIAGRDIT+FIQQLLR+RE  IPP+ S+E AK +KER+SYVCPD+ KEF+KYD+D  KWIK +    +    +FS DVGYE+FLGPE+FF PEF N DF   IS+VVD VIQ+CPID RRPLY NIVLSGGS+MF+   RR+QRD+K+ VD RLKL+EE S G+LKP P   + ++H  Q + +  GG    S+ +FY   HTKK Y+E+GPSICRHNPVFG M+
Sbjct:    3 ARLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRLMKGVDDLDFHIGDEAI---DKPTYATKWPIRHGIVEDWDLMERFMEQIIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERFSYVCPDLVKEFSKYDTDGAKWIKQYTGVNAVSKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDVKRTVDARLKLSEELSGGRLKPPPPWHRELAHLTQSWHICMGGTSAHSTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS 418          
BLAST of Actin-related protein 3 vs. Ensembl Xenopus
Match: calr3 (calreticulin 3 [Source:Xenbase;Acc:XB-GENE-6258823])

HSP 1 Score: 545.814 bits (1405), Expect = 0.000e+0
Identity = 276/409 (67.48%), Postives = 323/409 (78.97%), Query Frame = 3
Query:   72 GTGYSKLGFADNSEPQFIIPSCIATRE-GKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFSFDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVFGRMT 1295
            G GY+KLG+A N+EPQFIIPSCIA +E  K+G +  RR+  G+DDL+F+IGDEA     K  ++ +WPIRHG+VEDWDL ERFMEQ IFKYLRAEPEDHYFLLTEPPLNTPENRE+TAEIMFE+FN+PGLYIAVQAVLALAASWTSR   ERTLTGTVIDSGDGVTHVIPV +GYVIGS IKHIPIAGRDIT+FIQQLLR+RE  IPP+ S+E AK +KER+SYVCPD+ KEF+KYD+D  KWIK +    +    +FS DVGYE+FLGPE+FF PEF N DF   IS+VVD VIQ+CPID RRPLY NIVLSGGS+MF+   RR+QRD+K+ VD RLKL+EE S G+LK  P+        MQ +   FG        +FY   HTKK Y+E+GPSICRHNPVFG M+
Sbjct:   13 GRGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRLMKGVDDLDFHIGDEAI---DKPTYATKWPIRHGIVEDWDLMERFMEQIIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERFSYVCPDLVKEFSKYDTDGAKWIKQYTGVNAVSKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDVKRTVDARLKLSEELSGGRLK-APL--------MQNHRCRFGTTF---GPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS 406          
BLAST of Actin-related protein 3 vs. Ensembl Xenopus
Match: calr3 (calreticulin 3 [Source:Xenbase;Acc:XB-GENE-6258823])

HSP 1 Score: 543.117 bits (1398), Expect = 0.000e+0
Identity = 276/413 (66.83%), Postives = 324/413 (78.45%), Query Frame = 3
Query:   60 VIDNGTGYSKLGFADNSEPQFIIPSCIATRE-GKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFSFDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVFGRMT 1295
            V + G  Y+KLG+A N+EPQFIIPSCIA +E  K+G +  RR+  G+DDL+F+IGDEA     K  ++ +WPIRHG+VEDWDL ERFMEQ IFKYLRAEPEDHYFLLTEPPLNTPENRE+TAEIMFE+FN+PGLYIAVQAVLALAASWTSR   ERTLTGTVIDSGDGVTHVIPV +GYVIGS IKHIPIAGRDIT+FIQQLLR+RE  IPP+ S+E AK +KER+SYVCPD+ KEF+KYD+D  KWIK +    +    +FS DVGYE+FLGPE+FF PEF N DF   IS+VVD VIQ+CPID RRPLY NIVLSGGS+MF+   RR+QRD+K+ VD RLKL+EE S G+LK  P+        MQ +   FG        +FY   HTKK Y+E+GPSICRHNPVFG M+
Sbjct:   13 VHNAGPQYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRLMKGVDDLDFHIGDEAI---DKPTYATKWPIRHGIVEDWDLMERFMEQIIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERFSYVCPDLVKEFSKYDTDGAKWIKQYTGVNAVSKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDVKRTVDARLKLSEELSGGRLK-APL--------MQNHRCRFGTTF---GPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS 410          
BLAST of Actin-related protein 3 vs. Ensembl Xenopus
Match: calr3 (calreticulin 3 [Source:Xenbase;Acc:XB-GENE-6258823])

HSP 1 Score: 536.569 bits (1381), Expect = 0.000e+0
Identity = 270/406 (66.50%), Postives = 315/406 (77.59%), Query Frame = 3
Query:   81 YSKLGFADNSEPQFIIPSCIATRE-GKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFSFDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVFGRMT 1295
            Y+KLG+A N+EPQFIIPSCIA +E  K+G +  RR+  G+DDL+F+IGDEA     K  ++ +WPIRHG+VEDWDL ERFMEQ IFKYLRAEPEDHYFLLTEPPLNTPENRE+TAEIMFE+FN+PGLYIAVQAVLALAASWTSR   ERTLTGTVIDSGDGVTHVIPV +GYVIGS IKHIPIAGRDIT+FIQQLLR+RE  IPP+ S+E AK +KER+SYVCPD+ KEF+KYD+D  KWIK +    +    +FS DVGYE+FLGPE+FF PEF N DF   IS+VVD VIQ+CPID RRPLY NIVLSGGS+MF+   RR+QRD+K+ VD RLKL+EE S G+LKP                            +FY   HTKK Y+E+GPSICRHNPVFG M+
Sbjct:   19 YTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRLMKGVDDLDFHIGDEAI---DKPTYATKWPIRHGIVEDWDLMERFMEQIIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERFSYVCPDLVKEFSKYDTDGAKWIKQYTGVNAVSKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDVKRTVDARLKLSEELSGGRLKP----------------------------EFYQVCHTKKDYEEIGPSICRHNPVFGVMS 393          
BLAST of Actin-related protein 3 vs. Ensembl Xenopus
Match: calr3 (calreticulin 3 [Source:Xenbase;Acc:XB-GENE-6258823])

HSP 1 Score: 532.332 bits (1370), Expect = 0.000e+0
Identity = 269/407 (66.09%), Postives = 313/407 (76.90%), Query Frame = 3
Query:   78 GYSKLGFADNSEPQFIIPSCIATRE-GKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFSFDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVFGRMT 1295
            G   LG+A N+EPQFIIPSCIA +E  K+G +  RR+  G+DDL+F+IGDEA     K  ++ +WPIRHG+VEDWDL ERFMEQ IFKYLRAEPEDHYFLLTEPPLNTPENRE+TAEIMFE+FN+PGLYIAVQAVLALAASWTSR   ERTLTGTVIDSGDGVTHVIPV +GYVIGS IKHIPIAGRDIT+FIQQLLR+RE  IPP+ S+E AK +KER+SYVCPD+ KEF+KYD+D  KWIK +    +    +FS DVGYE+FLGPE+FF PEF N DF   IS+VVD VIQ+CPID RRPLY NIVLSGGS+MF+   RR+QRD+K+ VD RLKL+EE S G+LKP                            +FY   HTKK Y+E+GPSICRHNPVFG M+
Sbjct:   12 GVHNLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRLMKGVDDLDFHIGDEAI---DKPTYATKWPIRHGIVEDWDLMERFMEQIIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERFSYVCPDLVKEFSKYDTDGAKWIKQYTGVNAVSKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDVKRTVDARLKLSEELSGGRLKP----------------------------EFYQVCHTKKDYEEIGPSICRHNPVFGVMS 387          
BLAST of Actin-related protein 3 vs. Ensembl Mouse
Match: Actr3 (ARP3 actin-related protein 3 [Source:MGI Symbol;Acc:MGI:1921367])

HSP 1 Score: 616.305 bits (1588), Expect = 0.000e+0
Identity = 299/419 (71.36%), Postives = 349/419 (83.29%), Query Frame = 3
Query:   42 ARLPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATRE-GKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFSFDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVFGRMT 1295
             RLPA V+D GTGY+KLG+A N+EPQFIIPSCIA +E  K+G +  RR+  G+DDL+F+IGDEA     K  ++ +WPIRHG+VEDWDL ERFMEQ IFKYLRAEPEDHYFLLTEPPLNTPENRE+TAEIMFE+FN+PGLYIAVQAVLALAASWTSR   ERTLTGTVIDSGDGVTHVIPV +GYVIGS IKHIPIAGRDIT+FIQQLLR+RE  IPP+ S+E AK +KERYSYVCPD+ KEF KYD+D  KWIK +    +    +FS DVGYE+FLGPE+FF PEF N DF   IS+VVD VIQ+CPID RRPLY NIVLSGGS+MF+   RR+QRD+K+ VD RLKL+EE S G+LKP PIDV+V++H MQRYAVWFGG++LAS+ +FY   HTKK Y+E+GPSICRHNPVFG M+
Sbjct:    3 GRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIE---KPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGVNAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS 418          
BLAST of Actin-related protein 3 vs. Ensembl Mouse
Match: Actr3 (ARP3 actin-related protein 3 [Source:MGI Symbol;Acc:MGI:1921367])

HSP 1 Score: 616.305 bits (1588), Expect = 0.000e+0
Identity = 299/419 (71.36%), Postives = 349/419 (83.29%), Query Frame = 3
Query:   42 ARLPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATRE-GKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFSFDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVFGRMT 1295
             RLPA V+D GTGY+KLG+A N+EPQFIIPSCIA +E  K+G +  RR+  G+DDL+F+IGDEA     K  ++ +WPIRHG+VEDWDL ERFMEQ IFKYLRAEPEDHYFLLTEPPLNTPENRE+TAEIMFE+FN+PGLYIAVQAVLALAASWTSR   ERTLTGTVIDSGDGVTHVIPV +GYVIGS IKHIPIAGRDIT+FIQQLLR+RE  IPP+ S+E AK +KERYSYVCPD+ KEF KYD+D  KWIK +    +    +FS DVGYE+FLGPE+FF PEF N DF   IS+VVD VIQ+CPID RRPLY NIVLSGGS+MF+   RR+QRD+K+ VD RLKL+EE S G+LKP PIDV+V++H MQRYAVWFGG++LAS+ +FY   HTKK Y+E+GPSICRHNPVFG M+
Sbjct:    3 GRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIE---KPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGVNAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS 418          
BLAST of Actin-related protein 3 vs. Ensembl Mouse
Match: Actr3b (ARP3 actin-related protein 3B [Source:MGI Symbol;Acc:MGI:2661120])

HSP 1 Score: 600.512 bits (1547), Expect = 0.000e+0
Identity = 291/417 (69.78%), Postives = 342/417 (82.01%), Query Frame = 3
Query:   48 LPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATRE-GKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFSFDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVFGRMT 1295
            LP  V+D GTGY+KLG+A N+EPQFIIPSCIA RE  K+  +  RR+  G+DDL+F+IGDEA     K  ++ +WPIRHG+VEDWDL ERFMEQ +FKYLRAEPEDHYFL+TEPPLNTPENRE+ AEIMFE+FN+PGLYIAVQAVLALAASWTSR   ERTLTG VIDSGDGVTHVIPV +GYVIGS IKHIPIAGRDIT+FIQQLLRERE  IPP+ S+E AK IKE+Y Y+CPDI +EFAKYD DP KWIK +    +     F  DVGYE+FLGPE+FF PEF N DF  SISDVVD VIQSCPID RRPLY N+VLSGGS+MF+   RR+QRD+K+ VD RLKL++E S G++KP P++V+VV+H MQRYAVWFGG++LAS+ +F+   HTKK Y+E GPSICRHNPVFG M+
Sbjct:    5 LPPCVVDCGTGYTKLGYAGNTEPQFIIPSCIAIRESAKVVDQAQRRVLRGVDDLDFFIGDEAI---DKPTYATKWPIRHGIVEDWDLMERFMEQVVFKYLRAEPEDHYFLMTEPPLNTPENREYLAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLREREVGIPPEQSLETAKAIKEKYCYICPDIVREFAKYDVDPRKWIKQYTGINAINQKKFIIDVGYERFLGPEIFFHPEFANPDFMESISDVVDEVIQSCPIDVRRPLYKNVVLSGGSTMFRDFGRRLQRDLKRVVDARLKLSQELSGGRIKPKPVEVQVVTHHMQRYAVWFGGSMLASTPEFFQVCHTKKDYEEYGPSICRHNPVFGVMS 418          
BLAST of Actin-related protein 3 vs. Ensembl Mouse
Match: Actr3b (ARP3 actin-related protein 3B [Source:MGI Symbol;Acc:MGI:2661120])

HSP 1 Score: 495.352 bits (1274), Expect = 3.897e-175
Identity = 239/329 (72.64%), Postives = 276/329 (83.89%), Query Frame = 3
Query:  309 ERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFSFDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVFGRMT 1295
            ERFMEQ +FKYLRAEPEDHYFL+TEPPLNTPENRE+ AEIMFE+FN+PGLYIAVQAVLALAASWTSR   ERTLTG VIDSGDGVTHVIPV +GYVIGS IKHIPIAGRDIT+FIQQLLRERE  IPP+ S+E AK IKE+Y Y+CPDI +EFAKYD DP KWIK +    +     F  DVGYE+FLGPE+FF PEF N DF  SISDVVD VIQSCPID RRPLY N+VLSGGS+MF+   RR+QRD+K+ VD RLKL++E S G++KP P++V+VV+H MQRYAVWFGG++LAS+ +F+   HTKK Y+E GPSICRHNPVFG M+
Sbjct:    2 ERFMEQVVFKYLRAEPEDHYFLMTEPPLNTPENREYLAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLREREVGIPPEQSLETAKAIKEKYCYICPDIVREFAKYDVDPRKWIKQYTGINAINQKKFIIDVGYERFLGPEIFFHPEFANPDFMESISDVVDEVIQSCPIDVRRPLYKNVVLSGGSTMFRDFGRRLQRDLKRVVDARLKLSQELSGGRIKPKPVEVQVVTHHMQRYAVWFGGSMLASTPEFFQVCHTKKDYEEYGPSICRHNPVFGVMS 330          
BLAST of Actin-related protein 3 vs. Ensembl Mouse
Match: Actr3 (ARP3 actin-related protein 3 [Source:MGI Symbol;Acc:MGI:1921367])

HSP 1 Score: 327.791 bits (839), Expect = 6.189e-111
Identity = 167/217 (76.96%), Postives = 188/217 (86.64%), Query Frame = 3
Query:   42 ARLPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATRE-GKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIP 689
             RLPA V+D GTGY+KLG+A N+EPQFIIPSCIA +E  K+G +  RR+  G+DDL+F+IGDEA     K  ++ +WPIRHG+VEDWDL ERFMEQ IFKYLRAEPEDHYFLLTEPPLNTPENRE+TAEIMFE+FN+PGLYIAVQAVLALAASWTSR   ERTLTGTVIDSGDGVTHVIPV +GYVIGS IKHIPIAGRDIT+FIQQLLR+RE  IP
Sbjct:    3 GRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIE---KPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIP 216          
BLAST of Actin-related protein 3 vs. UniProt/SwissProt
Match: sp|Q4V7C7|ARP3_RAT (Actin-related protein 3 OS=Rattus norvegicus OX=10116 GN=Actr3 PE=1 SV=1)

HSP 1 Score: 616.305 bits (1588), Expect = 0.000e+0
Identity = 299/419 (71.36%), Postives = 349/419 (83.29%), Query Frame = 3
Query:   42 ARLPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATRE-GKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFSFDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVFGRMT 1295
             RLPA V+D GTGY+KLG+A N+EPQFIIPSCIA +E  K+G +  RR+  G+DDL+F+IGDEA     K  ++ +WPIRHG+VEDWDL ERFMEQ IFKYLRAEPEDHYFLLTEPPLNTPENRE+TAEIMFE+FN+PGLYIAVQAVLALAASWTSR   ERTLTGTVIDSGDGVTHVIPV +GYVIGS IKHIPIAGRDIT+FIQQLLR+RE  IPP+ S+E AK +KERYSYVCPD+ KEF KYD+D  KWIK +    +    +FS DVGYE+FLGPE+FF PEF N DF   IS+VVD VIQ+CPID RRPLY NIVLSGGS+MF+   RR+QRD+K+ VD RLKL+EE S G+LKP PIDV+V++H MQRYAVWFGG++LAS+ +FY   HTKK Y+E+GPSICRHNPVFG M+
Sbjct:    3 GRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIE---KPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGVNAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS 418          
BLAST of Actin-related protein 3 vs. UniProt/SwissProt
Match: sp|Q99JY9|ARP3_MOUSE (Actin-related protein 3 OS=Mus musculus OX=10090 GN=Actr3 PE=1 SV=3)

HSP 1 Score: 616.305 bits (1588), Expect = 0.000e+0
Identity = 299/419 (71.36%), Postives = 349/419 (83.29%), Query Frame = 3
Query:   42 ARLPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATRE-GKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFSFDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVFGRMT 1295
             RLPA V+D GTGY+KLG+A N+EPQFIIPSCIA +E  K+G +  RR+  G+DDL+F+IGDEA     K  ++ +WPIRHG+VEDWDL ERFMEQ IFKYLRAEPEDHYFLLTEPPLNTPENRE+TAEIMFE+FN+PGLYIAVQAVLALAASWTSR   ERTLTGTVIDSGDGVTHVIPV +GYVIGS IKHIPIAGRDIT+FIQQLLR+RE  IPP+ S+E AK +KERYSYVCPD+ KEF KYD+D  KWIK +    +    +FS DVGYE+FLGPE+FF PEF N DF   IS+VVD VIQ+CPID RRPLY NIVLSGGS+MF+   RR+QRD+K+ VD RLKL+EE S G+LKP PIDV+V++H MQRYAVWFGG++LAS+ +FY   HTKK Y+E+GPSICRHNPVFG M+
Sbjct:    3 GRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIE---KPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGVNAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS 418          
BLAST of Actin-related protein 3 vs. UniProt/SwissProt
Match: sp|Q5R8R1|ARP3_PONAB (Actin-related protein 3 OS=Pongo abelii OX=9601 GN=ACTR3 PE=2 SV=3)

HSP 1 Score: 615.92 bits (1587), Expect = 0.000e+0
Identity = 299/419 (71.36%), Postives = 349/419 (83.29%), Query Frame = 3
Query:   42 ARLPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATRE-GKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFSFDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVFGRMT 1295
             RLPA V+D GTGY+KLG+A N+EPQFIIPSCIA +E  K+G +  RR+  G+DDL+F+IGDEA     K  ++ +WPIRHG+VEDWDL ERFMEQ IFKYLRAEPEDHYFLLTEPPLNTPENRE+TAEIMFE+FN+PGLYIAVQAVLALAASWTSR   ERTLTGTVIDSGDGVTHVIPV +GYVIGS IKHIPIAGRDIT+FIQQLLR+RE  IPP+ S+E AK +KERYSYVCPD+ KEF KYD+D  KWIK +    +    +FS DVGYE+FLGPE+FF PEF N DF   IS+VVD VIQ+CPID RRPLY NIVLSGGS+MF+   RR+QRD+K+ VD RLKL+EE S G+LKP PIDV+V++H MQRYAVWFGG++LAS+ +FY   HTKK Y+E+GPSICRHNPVFG M+
Sbjct:    3 GRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIE---KPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS 418          
BLAST of Actin-related protein 3 vs. UniProt/SwissProt
Match: sp|P61158|ARP3_HUMAN (Actin-related protein 3 OS=Homo sapiens OX=9606 GN=ACTR3 PE=1 SV=3)

HSP 1 Score: 615.92 bits (1587), Expect = 0.000e+0
Identity = 299/419 (71.36%), Postives = 349/419 (83.29%), Query Frame = 3
Query:   42 ARLPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATRE-GKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFSFDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVFGRMT 1295
             RLPA V+D GTGY+KLG+A N+EPQFIIPSCIA +E  K+G +  RR+  G+DDL+F+IGDEA     K  ++ +WPIRHG+VEDWDL ERFMEQ IFKYLRAEPEDHYFLLTEPPLNTPENRE+TAEIMFE+FN+PGLYIAVQAVLALAASWTSR   ERTLTGTVIDSGDGVTHVIPV +GYVIGS IKHIPIAGRDIT+FIQQLLR+RE  IPP+ S+E AK +KERYSYVCPD+ KEF KYD+D  KWIK +    +    +FS DVGYE+FLGPE+FF PEF N DF   IS+VVD VIQ+CPID RRPLY NIVLSGGS+MF+   RR+QRD+K+ VD RLKL+EE S G+LKP PIDV+V++H MQRYAVWFGG++LAS+ +FY   HTKK Y+E+GPSICRHNPVFG M+
Sbjct:    3 GRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIE---KPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS 418          
BLAST of Actin-related protein 3 vs. UniProt/SwissProt
Match: sp|P61157|ARP3_BOVIN (Actin-related protein 3 OS=Bos taurus OX=9913 GN=ACTR3 PE=1 SV=3)

HSP 1 Score: 615.92 bits (1587), Expect = 0.000e+0
Identity = 299/419 (71.36%), Postives = 349/419 (83.29%), Query Frame = 3
Query:   42 ARLPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATRE-GKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFSFDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVFGRMT 1295
             RLPA V+D GTGY+KLG+A N+EPQFIIPSCIA +E  K+G +  RR+  G+DDL+F+IGDEA     K  ++ +WPIRHG+VEDWDL ERFMEQ IFKYLRAEPEDHYFLLTEPPLNTPENRE+TAEIMFE+FN+PGLYIAVQAVLALAASWTSR   ERTLTGTVIDSGDGVTHVIPV +GYVIGS IKHIPIAGRDIT+FIQQLLR+RE  IPP+ S+E AK +KERYSYVCPD+ KEF KYD+D  KWIK +    +    +FS DVGYE+FLGPE+FF PEF N DF   IS+VVD VIQ+CPID RRPLY NIVLSGGS+MF+   RR+QRD+K+ VD RLKL+EE S G+LKP PIDV+V++H MQRYAVWFGG++LAS+ +FY   HTKK Y+E+GPSICRHNPVFG M+
Sbjct:    3 GRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIE---KPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLRDREVGIPPEQSLETAKAVKERYSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFSIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGRLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS 418          
BLAST of Actin-related protein 3 vs. TrEMBL
Match: C1LJL3 (Actin-like protein 3 OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 693.73 bits (1789), Expect = 0.000e+0
Identity = 326/420 (77.62%), Postives = 369/420 (87.86%), Query Frame = 3
Query:   39 MARLPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATRE-GKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFSFDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVFGRMT 1295
            + RLPA+VIDNGTGYSK+G+A N+EPQ IIPSCIA +E  K+G ++ RR+GTGLDDLNFYIGDEA A++GKNDFSV+WPIRHG++EDWDL +R+MEQ IFK LRAEPEDHYFLLTEPPLNTPENRE+ AEIMFETFNIPGLYIAVQAVLAL+ASW S     R+LTGTVIDSGDGVTHVIPVVDGYVIGS IKHIPIAGRDIT FIQ LLR+RET IPP++SME AKQIKERYSYVCPD+ KEFAKYDS+P+KWIK H +S S+KYP FS DVGYE+FLGPE+FF+PEFVN DF  S+SDVVD VIQ  PIDSRR LY NIVLSGGSSMFKHLDRR+QRDIK+NVD RLKLTEE + G++KP  IDVKVVSH MQRYAVWFGG++LA+  +FY   HTK QYDE+GP+ICRHNPVFG MT
Sbjct:    2 IGRLPAIVIDNGTGYSKIGYAGNTEPQSIIPSCIAVKEYSKVGAREVRRLGTGLDDLNFYIGDEAIALDGKNDFSVKWPIRHGIIEDWDLMQRYMEQLIFKLLRAEPEDHYFLLTEPPLNTPENREYLAEIMFETFNIPGLYIAVQAVLALSASWCSNRTGGRSLTGTVIDSGDGVTHVIPVVDGYVIGSCIKHIPIAGRDITSFIQHLLRDRETNIPPELSMEVAKQIKERYSYVCPDLPKEFAKYDSEPDKWIKPHVVSKSAKYPAFSVDVGYERFLGPEIFFQPEFVNPDFTTSLSDVVDEVIQKSPIDSRRGLYGNIVLSGGSSMFKHLDRRLQRDIKRNVDNRLKLTEELTGGQMKPKSIDVKVVSHPMQRYAVWFGGSVLANESEFYNVCHTKAQYDEIGPAICRHNPVFGTMT 421          
BLAST of Actin-related protein 3 vs. TrEMBL
Match: C1LJL2 (Actin-like protein 3 OS=Schistosoma japonicum OX=6182 GN=EWB00_007426 PE=2 SV=1)

HSP 1 Score: 692.575 bits (1786), Expect = 0.000e+0
Identity = 325/420 (77.38%), Postives = 369/420 (87.86%), Query Frame = 3
Query:   39 MARLPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATRE-GKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFSFDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVFGRMT 1295
            + RLPA+VIDNGTGYSK+G+A N+EPQ IIPSCIA +E  K+G ++ RR+GTGLDDLNFYIGDEA A++GKNDFSV+WPIRHG++EDWDL +R+MEQ IFK LRAEPEDHYFLLTEPPLNTPENRE+ AEIMFETFNIPGLYIAVQAVLAL+ASW S     R+LTGTVIDSGDGVTHVIPVVDGYVIGS IKHIPIAGRDIT FIQ LLR+RET IPP++SME AKQIKERYSYVCPD+ KEFAKYDS+P+KWIK H +S S+KYP FS DVGYE+FLGPE+FF+PEFVN DF  S+SDVVD VIQ  PIDSRR LY NIVLSGGSSMFKHLDRR+QRDIK+NVD RLKLTEE + G++KP  IDVKVVSH MQRYAVWFGG++LA+  +FY   HTK QY+E+GP+ICRHNPVFG MT
Sbjct:    2 IGRLPAIVIDNGTGYSKIGYAGNTEPQSIIPSCIAVKEYSKVGAREVRRLGTGLDDLNFYIGDEAIALDGKNDFSVKWPIRHGIIEDWDLMQRYMEQLIFKLLRAEPEDHYFLLTEPPLNTPENREYLAEIMFETFNIPGLYIAVQAVLALSASWCSNRTGGRSLTGTVIDSGDGVTHVIPVVDGYVIGSCIKHIPIAGRDITSFIQHLLRDRETNIPPELSMEVAKQIKERYSYVCPDLPKEFAKYDSEPDKWIKPHVVSKSAKYPAFSVDVGYERFLGPEIFFQPEFVNPDFTTSLSDVVDEVIQKSPIDSRRGLYGNIVLSGGSSMFKHLDRRLQRDIKRNVDNRLKLTEELTGGQMKPKSIDVKVVSHPMQRYAVWFGGSVLANESEFYNVCHTKAQYEEIGPAICRHNPVFGTMT 421          
BLAST of Actin-related protein 3 vs. TrEMBL
Match: A0A3Q0KVF2 (Prolyl oligopeptidase (S09 family) OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 690.649 bits (1781), Expect = 0.000e+0
Identity = 324/420 (77.14%), Postives = 368/420 (87.62%), Query Frame = 3
Query:   39 MARLPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATRE-GKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFSFDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVFGRMT 1295
            +  LPA+VIDNGTGYSK+G+A N+EPQ IIPSCIA +E  K+G ++ RR+GTGLDDLNF+IGDEA A++GKNDFSV+WPIRHG++EDWDL +R+MEQ IFK LRAEPEDHYFLLTEPPLNTPENRE+ AEIMFETFNIPGLYIAVQAVLAL+ASW S   + R+LTGTVIDSGDGVTHVIPVVDGYVIGS IKHIPIAGRDIT FIQ LLRERE  IPP++SME AKQIKERYSYVCPD+ KEFAKYDS+PEKWIK H +S S+KYP FS DVGYE+FLGPE+FF+PEFVN DF  S+SDVVD VIQ  PIDSRR LY NIVLSGGSSMFKHLDRR+QRDIK+NVD RLKLTEE + G++KP  IDVKVVSH MQRYAVWFGG++LA+  +FY   HTK QY+E+GP+ICRHNPVFG MT
Sbjct:    2 IGHLPAIVIDNGTGYSKIGYAGNTEPQSIIPSCIAVKEYSKVGTREVRRLGTGLDDLNFFIGDEALALDGKNDFSVKWPIRHGIIEDWDLMQRYMEQLIFKLLRAEPEDHYFLLTEPPLNTPENREYLAEIMFETFNIPGLYIAVQAVLALSASWCSNRTDSRSLTGTVIDSGDGVTHVIPVVDGYVIGSCIKHIPIAGRDITSFIQHLLRERENNIPPELSMEVAKQIKERYSYVCPDLPKEFAKYDSEPEKWIKPHVVSKSAKYPSFSVDVGYERFLGPEIFFQPEFVNPDFTTSLSDVVDEVIQKSPIDSRRGLYGNIVLSGGSSMFKHLDRRLQRDIKRNVDNRLKLTEELTGGRVKPKSIDVKVVSHPMQRYAVWFGGSVLANESEFYNVCHTKAQYEEIGPAICRHNPVFGTMT 421          
BLAST of Actin-related protein 3 vs. TrEMBL
Match: G4VGA3 (Prolyl oligopeptidase (S09 family) OS=Schistosoma mansoni OX=6183 GN=Smp_210740 PE=3 SV=1)

HSP 1 Score: 686.797 bits (1771), Expect = 0.000e+0
Identity = 320/415 (77.11%), Postives = 364/415 (87.71%), Query Frame = 3
Query:   39 MARLPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATRE-GKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFSFDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPV 1280
            +  LPA+VIDNGTGYSK+G+A N+EPQ IIPSCIA +E  K+G ++ RR+GTGLDDLNF+IGDEA A++GKNDFSV+WPIRHG++EDWDL +R+MEQ IFK LRAEPEDHYFLLTEPPLNTPENRE+ AEIMFETFNIPGLYIAVQAVLAL+ASW S   + R+LTGTVIDSGDGVTHVIPVVDGYVIGS IKHIPIAGRDIT FIQ LLRERE  IPP++SME AKQIKERYSYVCPD+ KEFAKYDS+PEKWIK H +S S+KYP FS DVGYE+FLGPE+FF+PEFVN DF  S+SDVVD VIQ  PIDSRR LY NIVLSGGSSMFKHLDRR+QRDIK+NVD RLKLTEE + G++KP  IDVKVVSH MQRYAVWFGG++LA+  +FY   HTK QY+E+GP+ICRHNPV
Sbjct:    2 IGHLPAIVIDNGTGYSKIGYAGNTEPQSIIPSCIAVKEYSKVGTREVRRLGTGLDDLNFFIGDEALALDGKNDFSVKWPIRHGIIEDWDLMQRYMEQLIFKLLRAEPEDHYFLLTEPPLNTPENREYLAEIMFETFNIPGLYIAVQAVLALSASWCSNRTDSRSLTGTVIDSGDGVTHVIPVVDGYVIGSCIKHIPIAGRDITSFIQHLLRERENNIPPELSMEVAKQIKERYSYVCPDLPKEFAKYDSEPEKWIKPHVVSKSAKYPSFSVDVGYERFLGPEIFFQPEFVNPDFTTSLSDVVDEVIQKSPIDSRRGLYGNIVLSGGSSMFKHLDRRLQRDIKRNVDNRLKLTEELTGGRVKPKSIDVKVVSHPMQRYAVWFGGSVLANESEFYNVCHTKAQYEEIGPAICRHNPV 416          
BLAST of Actin-related protein 3 vs. TrEMBL
Match: H2KVF0 (Actin-related protein 3 OS=Clonorchis sinensis OX=79923 GN=ACTR3 PE=3 SV=1)

HSP 1 Score: 669.848 bits (1727), Expect = 0.000e+0
Identity = 319/419 (76.13%), Postives = 372/419 (88.78%), Query Frame = 3
Query:   42 ARLPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATRE-GKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFSFDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVFGRMT 1295
             RLPA+VIDNGTGYSK+G+A NSEPQ I PSCIA +E  K+G +++RR+GTGLDDLNF+IGD+A A++GK DFSV+WPIRHG++EDWDL +RFMEQ I+K LRAEPEDHYFLLTEPPLNTPENRE+TAEIMFETFN+PGLYIAVQAVLALAASW+SRP  ERTLTGTVIDSGDGVTHVIPVVDGYV+GS IKHIPIAGRDIT+FIQ LLRERE+ IPP+MSME AKQIKERYSYVCPD+ KEFAKYD++P KWI+ H +  ++KYP FS DVGYE+FLGPE+FF+PEFVN DF  S+SDVV+ VIQ  PID+RR LY NIVLSGGSSMFKHL +R+QRDIK+ VD RL+LTEE S G+LKPTPI+VK+V+H MQRYAVWFGG++LA +++FY+  HTK QY+E GPSICRHNPVFG MT
Sbjct:    3 GRLPAIVIDNGTGYSKIGYAGNSEPQTIFPSCIAVKEYSKVGTRETRRLGTGLDDLNFHIGDDALALDGKGDFSVKWPIRHGIIEDWDLMQRFMEQVIYKLLRAEPEDHYFLLTEPPLNTPENREYTAEIMFETFNVPGLYIAVQAVLALAASWSSRPKEERTLTGTVIDSGDGVTHVIPVVDGYVVGSCIKHIPIAGRDITYFIQHLLRERESNIPPEMSMEVAKQIKERYSYVCPDLPKEFAKYDAEPAKWIQKHNVPKTAKYPGFSVDVGYERFLGPEIFFQPEFVNPDFTTSLSDVVEEVIQKSPIDARRGLYRNIVLSGGSSMFKHLGKRLQRDIKQIVDNRLRLTEELSCGRLKPTPIEVKIVTHPMQRYAVWFGGSILADTNEFYSVCHTKAQYEEYGPSICRHNPVFGTMT 421          
BLAST of Actin-related protein 3 vs. Ensembl Cavefish
Match: actr3 (actin related protein 3 [Source:NCBI gene;Acc:103045207])

HSP 1 Score: 612.838 bits (1579), Expect = 0.000e+0
Identity = 297/419 (70.88%), Postives = 348/419 (83.05%), Query Frame = 3
Query:   42 ARLPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATRE-GKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFSFDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVFGRMT 1295
             RLPA V+D GTGY+KLG+A N+EPQFI+PSCIA +E  K+G +  RR+  G+DDL+F+IGDEA     K  ++ +WPIRHG+VEDWDL ERFMEQ IFKYLRAEPEDHYFLLTEPPLNTPENRE+TAEIMFE+FN+PGLYIAVQAVLALAASWTSR   ERTLTGTVIDSGDGVTHVIPV +GYVIGS IKHIPIAGRDIT+F QQLLRERE  IPP+ S+E AK +KER+SYVCPD+ KEF KYD+D  KWIK +    +    +F+ DVGYE+FLGPE+FF PEF N DF   IS+VVD VIQ+CPID RRPLY NIVLSGGS+MF+   RR+QRD+K+ VD RLKL+EE S GKLKP PIDV+V++H MQRYAVWFGG++LAS+ +FY   HTKK Y+E+GPSICRHNPVFG M+
Sbjct:    3 GRLPACVVDCGTGYTKLGYAGNTEPQFIVPSCIAIKESAKVGDQAQRRMMKGVDDLDFFIGDEAI---DKPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFTQQLLREREVGIPPEQSLETAKAVKERFSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFTIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGKLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS 418          
BLAST of Actin-related protein 3 vs. Ensembl Cavefish
Match: actr3b (actin related protein 3B [Source:ZFIN;Acc:ZDB-GENE-070424-10])

HSP 1 Score: 548.125 bits (1411), Expect = 0.000e+0
Identity = 268/388 (69.07%), Postives = 316/388 (81.44%), Query Frame = 3
Query:  135 CIATRE-GKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFSFDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVFGRMT 1295
            CIA RE   +G +  RR+  G+DDL+F+IGDEA     K +++ +WPIRHG++EDWDL E+FMEQ IFKYLRAEPEDH FL+TEPPLNTPENRE+ AEIMFETFNIPGLYIAVQAVLALAASWTSR   ERTLTG VIDSGDGVTH IPV +GYVIGS IKHIPIAGRDIT+FIQQLLRERE  IPP+ S+E AK +KERY Y+CPDI KEF KYD DP KWIK +K   +    +F  DVGYE+FLGPE+FF PEF N DF   ISDVVD VIQ+CPID RRPLY NIVLSGGS+MF+   RR+QRD+K+ VD RL+L+EE S G++KP P++V+V++H MQRYAVWFGG++LAS+ +F+   HTKK Y+E GPSICRHNPVFG M+
Sbjct:   37 CIAIRETAGVGDQAQRRLMKGVDDLDFFIGDEAI---DKPNYATKWPIRHGIIEDWDLMEKFMEQVIFKYLRAEPEDHNFLMTEPPLNTPENREYLAEIMFETFNIPGLYIAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHAIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLREREVGIPPEQSLETAKAVKERYCYICPDIVKEFTKYDMDPGKWIKKYKGINAISKNEFHIDVGYERFLGPEIFFHPEFANPDFMQPISDVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRVVDARLRLSEELSGGRIKPKPMEVQVITHHMQRYAVWFGGSMLASTPEFFEVCHTKKDYEEHGPSICRHNPVFGIMS 421          
BLAST of Actin-related protein 3 vs. Ensembl Cavefish
Match: actr3b (actin related protein 3B [Source:ZFIN;Acc:ZDB-GENE-070424-10])

HSP 1 Score: 488.419 bits (1256), Expect = 1.376e-172
Identity = 238/329 (72.34%), Postives = 274/329 (83.28%), Query Frame = 3
Query:  309 ERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFSFDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVFGRMT 1295
            E+FMEQ IFKYLRAEPEDH FL+TEPPLNTPENRE+ AEIMFETFNIPGLYIAVQAVLALAASWTSR   ERTLTG VIDSGDGVTH IPV +GYVIGS IKHIPIAGRDIT+FIQQLLRERE  IPP+ S+E AK +KERY Y+CPDI KEF KYD DP KWIK +K   +    +F  DVGYE+FLGPE+FF PEF N DF   ISDVVD VIQ+CPID RRPLY NIVLSGGS+MF+   RR+QRD+K+ VD RL+L+EE S G++KP P++V+V++H MQRYAVWFGG++LAS+ +F+   HTKK Y+E GPSICRHNPVFG M+
Sbjct:    2 EKFMEQVIFKYLRAEPEDHNFLMTEPPLNTPENREYLAEIMFETFNIPGLYIAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHAIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLREREVGIPPEQSLETAKAVKERYCYICPDIVKEFTKYDMDPGKWIKKYKGINAISKNEFHIDVGYERFLGPEIFFHPEFANPDFMQPISDVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRVVDARLRLSEELSGGRIKPKPMEVQVITHHMQRYAVWFGGSMLASTPEFFEVCHTKKDYEEHGPSICRHNPVFGIMS 330          
BLAST of Actin-related protein 3 vs. Ensembl Cavefish
Match: actr3b (actin related protein 3B [Source:ZFIN;Acc:ZDB-GENE-070424-10])

HSP 1 Score: 400.593 bits (1028), Expect = 5.793e-138
Identity = 200/270 (74.07%), Postives = 224/270 (82.96%), Query Frame = 3
Query:  309 ERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFSFDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLK 1118
            E+FMEQ IFKYLRAEPEDH FL+TEPPLNTPENRE+ AEIMFETFNIPGLYIAVQAVLALAASWTSR   ERTLTG VIDSGDGVTH IPV +GYVIGS IKHIPIAGRDIT+FIQQLLRERE  IPP+ S+E AK +KERY Y+CPDI KEF KYD DP KWIK +K   +    +F  DVGYE+FLGPE+FF PEF N DF   ISDVVD VIQ+CPID RRPLY NIVLSGGS+MF+   RR+QRD+K+ VD RL+L+EE S G++K
Sbjct:    2 EKFMEQVIFKYLRAEPEDHNFLMTEPPLNTPENREYLAEIMFETFNIPGLYIAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHAIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLREREVGIPPEQSLETAKAVKERYCYICPDIVKEFTKYDMDPGKWIKKYKGINAISKNEFHIDVGYERFLGPEIFFHPEFANPDFMQPISDVVDEVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRVVDARLRLSEELSGGRIK 271          
BLAST of Actin-related protein 3 vs. Ensembl Cavefish
Match: actb1 (actin, cytoplasmic 1 [Source:NCBI gene;Acc:103039558])

HSP 1 Score: 260.766 bits (665), Expect = 1.037e-82
Identity = 147/417 (35.25%), Postives = 223/417 (53.48%), Query Frame = 3
Query:   36 EMARLPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATREGKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFS-FDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVF 1283
            E+  + A+V+DNG+G  K GFA +  P+ + PS +       G    + +  G+   + Y+GDEAQ+  G    ++++PI HG+V +WD  E+      +  LR  PE+H  LLTE PLN   NRE   +IMFETFN P +Y+A+QAVL+L AS  +        TG V+DSGDGVTH +P+ +GY +  AI  + +AGRD+T ++ ++L ER          E  + IKE+  YV  D  +E     S       +  +  S + PD     +G E+F  PE  F+P F+ G     I +     I  C +D R+ LY N VLSGG++M+  +  R+Q++I                  L P+ + +K+++   ++Y+VW GG++LAS   F     +K++YDE GPSI  H   F
Sbjct:    3 ELLEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIV-------GRPRHQGVMVGMGQKDSYVGDEAQSKRGI--LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRT--------TGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAAS-------SSSLEKSYELPDGQVITIGNERFRCPEALFQPSFL-GMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEIT----------------SLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV-HRKCF 377          
BLAST of Actin-related protein 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003686.1 (pep scaffold:Pmarinus_7.0:GL476472:70600:102044:1 gene:ENSPMAG00000003346.1 transcript:ENSPMAT00000003686.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 596.66 bits (1537), Expect = 0.000e+0
Identity = 287/415 (69.16%), Postives = 343/415 (82.65%), Query Frame = 3
Query:   54 AVVIDNGTGYSKLGFADNSEPQFIIPSCIATRE-GKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFSFDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVFGRMT 1295
            A  +D    Y+K+G+A N+EPQFIIPSCI+ +E  K+G +  RR+  G+DDL+F+IGDEA     K ++S +WPIRHG+VEDWDL ERFMEQ IFKYLRAEPEDHYFLLTEPPLNTPENRE+TAEIMFE+FNIPGLYIAVQAVLALAASWTSR   ERTLTGTVIDSGDGVTHVIPV +GYVIGS IKHIPIAGRDIT+FIQQLLRERE  IPP+ S+E AK IKER+SY+CPDI KEF+K+D+DP KW+K +    +    +F+ DVGYE+FLGPE+FF PEF N DF   IS+VVD VIQ+CPID RRPLY N+VLSGGS+MF+   RR+QRD+K+ VD RLK +EE S G++KP PIDV+V++H MQRYAVWFGG++LAS+ +F+   HTKK Y+E GPSICRHNPVFG M+
Sbjct:    4 ACTLDKKNRYTKIGYAGNTEPQFIIPSCISIKESAKVGDQSQRRVMKGVDDLDFFIGDEAIE---KPNYSTKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNIPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLREREVGIPPEQSLETAKVIKERFSYICPDIVKEFSKFDADPSKWMKQYTGINAITKKEFTIDVGYERFLGPEIFFHPEFCNPDFTQPISEVVDNVIQNCPIDVRRPLYKNVVLSGGSTMFRDFGRRLQRDLKRTVDSRLKFSEELSGGRIKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFFQVCHTKKDYEEYGPSICRHNPVFGVMS 415          
BLAST of Actin-related protein 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001851.1 (pep scaffold:Pmarinus_7.0:GL479410:2915:28079:-1 gene:ENSPMAG00000001683.1 transcript:ENSPMAT00000001851.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 501.13 bits (1289), Expect = 7.066e-177
Identity = 260/410 (63.41%), Postives = 315/410 (76.83%), Query Frame = 3
Query:   75 TGYSKLGFADNSEPQFIIPSCIATRE-GKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFSFDVGYEKFLGPEVFFR--PEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVFGRMT 1295
            T Y+KLG+A N+EPQFIIPSCIA +E  K+G +  RR+  G+DDL+F+IGDEA     K +++ +WPIRHG+VEDWDL ERFMEQ IFKYLRAEPEDHYFLLTEPPLNTPENRE+TAEIMFE+FN+PGLYIAVQAVLALAASWTSR   ERTLTGTVIDSGDGVTHVIPV +GYVIGS IKHIPIAGRDIT+FIQQLLRERE  IPP+      +  +  Y Y+   I  ++ K DS   +++K      S +    S+      F+G  ++     EF N DF   IS+VVD VIQ+CPID RRPLY N+VLSGGS+MF+   RR+QRD+K+ VD RL+++EE S G++KP PIDV+VV+H MQRYAVWFGG++LAS+ +FY   HTKK Y+E GPSICRHNPVFG M+
Sbjct:   13 TWYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQSQRRVMKGVDDLDFFIGDEAIE---KPNYATKWPIRHGMVEDWDLMERFMEQIIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLREREVGIPPEPVAGDCQGHQVEYEYI-NVIIMDYTKGDS--REFLKEVNCYVSLQKDPHSYGRNVCVFVGEPLYLNMPAEFCNPDFTQPISEVVDDVIQNCPIDVRRPLYKNVVLSGGSTMFRDFGRRLQRDLKRTVDSRLRISEELSGGRIKPKPIDVQVVTHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEYGPSICRHNPVFGVMS 416          
BLAST of Actin-related protein 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001857.1 (pep scaffold:Pmarinus_7.0:GL479410:2915:28006:-1 gene:ENSPMAG00000001683.1 transcript:ENSPMAT00000001857.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 491.115 bits (1263), Expect = 4.895e-173
Identity = 257/414 (62.08%), Postives = 312/414 (75.36%), Query Frame = 3
Query:   81 YSKLGFADNSEPQFIIPSCIATRE-GKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKN---DFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPD-MSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPD--FSFDVGYEKFLGPEVFFR--PEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVFGRMT 1295
            Y+KLG+A N+EPQFIIPSCIA +E  K+G +  RR+  G+DDL+F+IGDEA  +E  N        WPIRHG+VEDWDL ERFMEQ IFKYLRAEPEDHYFLLTEPPLNTPENRE+TAEIMFE+FN+PGLYIAVQAVLALAASWTSR   ERTLTGTVIDSGDGVTHVIPV +GYVIGS IKHIPIAGRDIT+FIQQLLRERE  IPP+ ++ +         ++   +  K F     D  +++K   M+    + +   S+      F+G  ++     EF N DF   IS+VVD VIQ+CPID RRPLY N+VLSGGS+MF+   RR+QRD+K+ VD RL+++EE S G++KP PIDV+VV+H MQRYAVWFGG++LAS+ +FY   HTKK Y+E GPSICRHNPVFG M+
Sbjct:    1 YTKLGYAGNTEPQFIIPSCIAIKESAKVGDQSQRRVMKGVDDLDFFIGDEA--IEKPNYATKLEKHWPIRHGMVEDWDLMERFMEQIIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLREREVGIPPEPVAGDCQGHQGTLAAFQLQECIKHFPVAKGDSREFLKELWMTIVFPFVEDPHSYGRNVCVFVGEPLYLNMPAEFCNPDFTQPISEVVDDVIQNCPIDVRRPLYKNVVLSGGSTMFRDFGRRLQRDLKRTVDSRLRISEELSGGRIKPKPIDVQVVTHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEYGPSICRHNPVFGVMS 412          
BLAST of Actin-related protein 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001856.1 (pep scaffold:Pmarinus_7.0:GL479410:2915:28006:-1 gene:ENSPMAG00000001683.1 transcript:ENSPMAT00000001856.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 486.108 bits (1250), Expect = 6.553e-171
Identity = 263/429 (61.31%), Postives = 317/429 (73.89%), Query Frame = 3
Query:   81 YSKLGFADNSEPQFIIPSC------------IATRE-GKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVR----WPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPD-MSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFSFD-----VGYEKFLGPEVFF-RPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVFGRMT 1295
            Y+KLG+A N+EPQFIIPSC            IA +E  K+G +  RR+  G+DDL+F+IGDEA  +E  N  + +    WPIRHG+VEDWDL ERFMEQ IFKYLRAEPEDHYFLLTEPPLNTPENRE+TAEIMFE+FN+PGLYIAVQAVLALAASWTSR   ERTLTGTVIDSGDGVTHVIPV +GYVIGS IKHIPIAGRDIT+FIQQLLRERE  IPP+ ++ +   Q+K  + Y    I   F K D +  K   ++ +      P F+       +  + F G E  F  P+F N DF   IS+VVD VIQ+CPID RRPLY N+VLSGGS+MF+   RR+QRD+K+ VD RL+++EE S G++KP PIDV+VV+H MQRYAVWFGG++LAS+ +FY   HTKK Y+E GPSICRHNPVFG M+
Sbjct:    1 YTKLGYAGNTEPQFIIPSCENVGVFHIHCRRIAIKESAKVGDQSQRRVMKGVDDLDFFIGDEA--IEKPNYATKKTISYWPIRHGMVEDWDLMERFMEQIIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLREREVGIPPEPVAGDCQAQLKTSFLYSL-GIGTIFVKRDKNLNKQPCSY-VEHIHHCPLFTSHLVCTRIHDQSFSGNETRFGHPQFCNPDFTQPISEVVDDVIQNCPIDVRRPLYKNVVLSGGSTMFRDFGRRLQRDLKRTVDSRLRISEELSGGRIKPKPIDVQVVTHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEYGPSICRHNPVFGVMS 425          
BLAST of Actin-related protein 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011113.1 (pep scaffold:Pmarinus_7.0:GL498954:115:1245:1 gene:ENSPMAG00000010086.1 transcript:ENSPMAT00000011113.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 258.455 bits (659), Expect = 1.603e-82
Identity = 146/413 (35.35%), Postives = 222/413 (53.75%), Query Frame = 3
Query:   48 LPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATREGKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFS-FDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVF 1283
            + A+V+DNG+G  K GFA +  P+ + PS +       G    + +  G+   + Y+GDEAQ+  G    ++++PI HG+V +WD  E+      +  LR  PE+H  LLTE PLN   NRE   +IMFETFN P +Y+A+QAVL+L AS  +        TG V+DSGDGV+H +P+ +GY +  AI  + +AGRD+T ++ ++L ER          E  + IKE+  YV  D  +E A   S       +  +  S + PD     +G E+F  PE  F+P F+ G     I +     I  C +D R+ LY N VLSGG++M+  +  R+Q++I                  L P+ + +K+++   ++Y+VW GG++LAS   F     +K++YDE GPSI  H   F
Sbjct:    6 IAALVVDNGSGMCKAGFAGDDAPRAVFPSIV-------GRPRHQGVMVGMGQKDSYVGDEAQSKRGI--LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRT--------TGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAS-------SSSLEKSYELPDGQVITIGNERFRCPEALFQPSFL-GMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEIT----------------ALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV-HRKCF 376          
BLAST of Actin-related protein 3 vs. Ensembl Yeast
Match: ARP3 (Essential component of the Arp2/3 complex; Arp2/3 is a highly conserved actin nucleation center required for the motility and integrity of actin patches; involved in endocytosis and membrane growth and polarity [Source:SGD;Acc:S000003826])

HSP 1 Score: 440.269 bits (1131), Expect = 1.208e-152
Identity = 241/446 (54.04%), Postives = 290/446 (65.02%), Query Frame = 3
Query:   51 PAVVIDNGTGYSKLGFADNSEPQFIIPSCIATR---------------------------------EGKMGGKDSRRIGT--GLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFSFDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVF 1283
            PAVV+DNGTG +KLGFA N  P ++ P+ IAT                                   G  GG  S  +    G +DL+FYIG+EA        +S+ +PIRHG VE+WD  ERF E +IFKYLR EPEDH+FLLTEPPLN PENRE  AEI FE+FN  GLYIAVQAVLALAASWTS    +R+LTGTVIDSGDGVTHVIPV +GYVIGSAIK+IPIAGRDIT FIQ LLRER      D S+  A++IK+ Y YVCPDI KEF K+D DP K+ +   +    K      D+GYE+FL PE+FF PE  + DF   +  VVD  IQ+CPID R+ LYNNIVLSGGS+MFK   RR+QRD+K  V+ R+  +E  S    K T +DV V+SH  QR AVWFGG+LLA + +F    HTKK Y+E GP I R+  +F
Sbjct:    7 PAVVMDNGTGLTKLGFAGNDSPSWVFPTAIATAAPSNTKKSSGVGAPSAVSNEASYFGNSTSATNFNGATGGLLSNNLSGKRGTEDLDFYIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFKYLRTEPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERGEA---DTSLRTAEKIKQEYCYVCPDIVKEFNKFDKDPSKFAQ-FVVENQEKTRRKVVDIGYERFLAPEIFFNPEIASSDFLTPLPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKSIVNNRIAQSELLS--GTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEFKGYCHTKKDYEEYGPEIVRNFSLF 446          
BLAST of Actin-related protein 3 vs. Ensembl Yeast
Match: ACT1 (Actin; structural protein involved in cell polarization, endocytosis, and other cytoskeletal functions [Source:SGD;Acc:S000001855])

HSP 1 Score: 261.922 bits (668), Expect = 5.305e-84
Identity = 148/412 (35.92%), Postives = 221/412 (53.64%), Query Frame = 3
Query:   42 ARLPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATREGKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFS-FDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHN 1274
            + + A+VIDNG+G  K GFA +  P+ + PS +       G    + I  G+   + Y+GDEAQ+  G    ++R+PI HG+V +WD  E+      +  LR  PE+H  LLTE P+N   NRE   +IMFETFN+P  Y+++QAVL+L +S  +        TG V+DSGDGVTHV+P+  G+ +  AI  I +AGRD+T ++ ++L ER          E  + IKE+  YV  D  +E        +   ++  +  S + PD     +G E+F  PE  F P  V G   A I       I  C +D R+ LY NIV+SGG++MF  +  R+Q++I                  L P+ + VK+++   ++Y+VW GG++LAS   F     +K++YDE GPSI  H 
Sbjct:    3 SEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIV-------GRPRHQGIMVGMGQKDSYVGDEAQSKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRT--------TGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEM-------QTAAQSSSIEKSYELPDGQVITIGNERFRAPEALFHPS-VLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEIT----------------ALAPSSMKVKIIAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHK 373          
BLAST of Actin-related protein 3 vs. Ensembl Yeast
Match: ARP2 (Essential component of the Arp2/3 complex; Arp2/3 is a highly conserved actin nucleation center required for the motility and integrity of actin patches; involved in endocytosis and membrane growth and polarity; required for efficient Golgi-to-ER trafficking in COPI mutants [Source:SGD;Acc:S000002187])

HSP 1 Score: 198.364 bits (503), Expect = 2.306e-59
Identity = 130/407 (31.94%), Postives = 216/407 (53.07%), Query Frame = 3
Query:   57 VVIDNGTGYSKLGFADNSEPQFIIPSCIATREGKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRA-EPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPD-FSFDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLAS----SDDFYTAAHTKKQYDEVGPS 1259
            +V+D GTG+ K+G A  + P +  PS +      +  ++   + T L D+   IGDEA   E ++   + +P+ +G++++W   E   + A F+ ++     +   LLTEPP+N  +NRE   E+MFE ++  G+Y+A+QAVLAL A   S        +G V+DSGDGVTH++PV +  V+    + + +AGRD+T  +  LL  R          E  +QIKE+  YV  D+       D D +   +   +  S + PD  +  VG E+F  PE  F+P  V+ + Q  + +++   +QS  +D R  LY  IVLSGGSSM+  L  R+++++K+    R+   + +   K K     V++     +++ V+ GGA+LAS     D  +    +K+++ E GPS
Sbjct:    7 IVLDQGTGFVKIGRAGENFPDYTFPSIVG--RPILRAEERASVATPLKDI--MIGDEAS--EVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLS--------SGVVVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-------DLDTKLARETTALVESYELPDGRTIKVGQERFEAPECLFQPGLVDVE-QPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFK-----VRIEDPPRRKHMVFIGGAVLASIMADKDHMWL---SKQEWQESGPS 383          
BLAST of Actin-related protein 3 vs. Ensembl Yeast
Match: ARP1 (Actin-related protein of the dynactin complex; required for spindle orientation and nuclear migration; forms actin-like short filament composed of 9 or 10 Arp1p monomers; putative ortholog of mammalian centractin [Source:SGD;Acc:S000001171])

HSP 1 Score: 179.104 bits (453), Expect = 3.801e-52
Identity = 122/400 (30.50%), Postives = 202/400 (50.50%), Query Frame = 3
Query:   57 VVIDNGTGYSKLGFADNSEPQFIIPSCIATREGKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEP-EDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETV-IPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPD-FSFDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDE 1247
            VVIDNG+G  K GF+    P+  +  C+         K  + +  GL   + +IG+ AQ + G     +R+PI+HGVVEDWD  E      + + L+ +   +H  L+TE P+N  +NRE  A+++FETF++  LY++  AVL+L AS        RT TG V+D G+G    +P+ DG+ + +++  + I G DIT  +Q  LR+   V +      E  + +KE+  Y+  +I KE  KY    +  I   K+      PD    +VG +++  PE+ F P+ +   +   +SD+    I    +D R+PL ++I+LSGG++  K    R+  D++        LT+  S          +K+++ S ++Y  W GG++L     F      K  + E
Sbjct:   15 VVIDNGSGIIKAGFSGEERPK-ALEYCLVGNT-----KYDKVMLEGLQG-DTFIGNNAQKLRGL--LKLRYPIKHGVVEDWDSMELIWSYVLNEVLQLQNIGEHPLLITEAPMNPLKNREQMAQVLFETFDVSALYVSNPAVLSLYAS-------GRT-TGCVVDCGEGYCSTVPIYDGFALPASMMRMDIGGADITEQLQFQLRKSAGVSLFSSSEREIVRTMKEKVCYLAKNIKKEEEKYLQGTQDLISTFKL------PDGRCIEVGNDRYRAPEILFSPQIIGLGYDG-LSDMCMQSIWKVDLDLRKPLLSSIILSGGTTTLKGFGDRMLWDLE-------ALTKGTSK---------IKIIAPSERKYTTWIGGSILTGLSTFQRLWTKKSDWLE 374          
BLAST of Actin-related protein 3 vs. Ensembl Yeast
Match: ARP4 (Nuclear actin-related protein involved in chromatin remodeling; component of chromatin-remodeling enzyme complexes [Source:SGD;Acc:S000003617])

HSP 1 Score: 70.8626 bits (172), Expect = 1.145e-13
Identity = 58/213 (27.23%), Postives = 93/213 (43.66%), Query Frame = 3
Query:   54 AVVIDNGTGYSKLGFADNSEPQFIIPSCIATREGKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHY-FLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIP 689
            AVVID G+  + +G++ +  PQ I+PS         G K               I  E      + D+ ++  I +G+V DWD  +   + A+   L          LLTEP  N+ ENR+ + E++ E       Y+A  +      S+ +  PN       V+D G     V P+VDG  +  + +   IAG+ I   I++ L  +E +IP
Sbjct:   16 AVVIDPGSYTTNIGYSGSDFPQSILPSVYGKYTADEGNKK--------------IFSEQSIGIPRKDYELKPIIENGLVIDWDTAQEQWQWALQNELYLNSNSGIPALLTEPVWNSTENRKKSLEVLLEGMQFEACYLAPTST---CVSFAAGRPN-----CLVVDIGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIKKALEPKE-IIP 205          

HSP 2 Score: 51.9878 bits (123), Expect = 1.119e-7
Identity = 33/113 (29.20%), Postives = 57/113 (50.44%), Query Frame = 3
Query:  927 ISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKK---NVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQR-YAVWFGGALLASSDDFYTAAHTKKQYDEVG 1253
            ++D+V + I S  +D R  L +N+VL+GG+S    L  R+  ++ K   ++ +R+  T                   H+++R Y  W GG++L S   F+     KK+Y+EVG
Sbjct:  385 LADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRILTT------------------GHTIERQYQSWLGGSILTSLGTFHQLWVGKKEYEEVG 479          
BLAST of Actin-related protein 3 vs. Ensembl Nematostella
Match: EDO41822 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3B3])

HSP 1 Score: 594.734 bits (1532), Expect = 0.000e+0
Identity = 290/419 (69.21%), Postives = 340/419 (81.15%), Query Frame = 3
Query:   42 ARLPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATRE-GKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFSFDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVFGRMT 1295
             R PA VIDNGTGY+K+GFA N+EPQ+I+P+ IA +E  K+G K   R   G++DL+F+IGDEA     K  ++ +WPIRH +VEDWDL ERF EQ IFKYLRAEPEDHYFLLTEPPLNTPENRE+TAEIMFE+FNIPGLYIAVQAVLALAASWTSR   ERTLTG VIDSGDGVTHVIPV +GYVIGS IKHIPIAGRDITFF+QQLLRERE  IPP+ SME AK IKER+ Y+CPDIAKEFAKY+ +P KWIK ++   +     FS DV YE+FLGPE+FF PEF N DF   +S+VVD VIQ+CPID RRPLY NIVLSGGS+MF+   RR+QRDIK+ VD RLK++E  S G++KP PI+ +V+SH MQRYAVWFGG++LAS+ +FY+  HTK  YDE GPSICRHNPVFG M+
Sbjct:    3 GRQPACVIDNGTGYTKMGFAGNTEPQYILPTAIAIKESAKVGNKSLGRSAKGVEDLDFFIGDEAI---DKPSYATKWPIRHAIVEDWDLMERFWEQCIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNIPGLYIAVQAVLALAASWTSRQVGERTLTGCVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITFFVQQLLREREMGIPPEQSMETAKTIKERWGYICPDIAKEFAKYEQEPAKWIKKYESINAVTKKPFSVDVAYERFLGPEIFFHPEFSNPDFTTPLSEVVDNVIQNCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDIKRTVDARLKMSETLSGGRIKPKPIETQVISHHMQRYAVWFGGSMLASTPEFYSVCHTKADYDEHGPSICRHNPVFGVMS 418          
BLAST of Actin-related protein 3 vs. Ensembl Nematostella
Match: EDO38006 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEB1])

HSP 1 Score: 260.766 bits (665), Expect = 3.527e-83
Identity = 149/413 (36.08%), Postives = 223/413 (54.00%), Query Frame = 3
Query:   48 LPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATREGKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFS-FDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVF 1283
            + A+V+DNG+G  K GFA +  P+ + PS +       G    + +  G+   + Y+GDEAQ+  G    ++++PI HG+V +WD  E+      +  LR  PE+H  LLTE PLN   NRE   +IMFETFN P +Y+A+QAVL+L AS  +        TG V+DSGDGVTH +P+ +GY +  AI  + +AGRD+T ++ ++L ER          E  + IKE+ +YV  D  +E A   +       +  +  S + PD     +G E+F  PE  F+P F+ G   A I +     I  C +D R+ LY N VLSGGS+MF  +  R+Q++I                  L P  + +K+++   ++Y+VW GG++LAS   F     +K++YDE GPSI  H   F
Sbjct:    5 VAALVVDNGSGMCKAGFAGDDAPRAVFPSIV-------GRPRHQGVMVGMGQKDSYVGDEAQSKRGI--LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRT--------TGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLAYVALDFEQEMATAAA-------SSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFL-GMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEIS----------------ALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV-HRKCF 375          
BLAST of Actin-related protein 3 vs. Ensembl Nematostella
Match: EDO42646 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0V7])

HSP 1 Score: 259.225 bits (661), Expect = 1.394e-82
Identity = 149/413 (36.08%), Postives = 221/413 (53.51%), Query Frame = 3
Query:   48 LPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATREGKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFS-FDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVF 1283
            + A+VIDNG+G  K GFA +  P+ + PS +       G    + +  G+   + Y+GDEAQ+  G    ++++PI HG+V +WD  E+      +  LR  PE+H  LLTE PLN   NRE   +IMFETFN P +Y+A+QAVL+L AS  +        TG V+DSGDGVTH +P+ +GY +  AI  + +AGRD+T ++ ++L ER          E  + IKE+  YV  D  +E        E    +  +  S + PD     +G E+F  PE  F+P F+ G   A I +     I  C +D R+ LY N VLSGGS+M+  +  R+Q++I                  L P  + +K+++   ++Y+VW GG++LAS   F     +K++YDE GPSI  H   F
Sbjct:    5 VAALVIDNGSGMCKAGFAGDDAPRAVFPSIV-------GRPRHQGVMVGMGQKDSYVGDEAQSKRGI--LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRT--------TGIVMDSGDGVTHTVPIYEGYALPHAIIRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEM-------ETAASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFL-GMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEIT----------------SLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV-HRKCF 375          
BLAST of Actin-related protein 3 vs. Ensembl Nematostella
Match: EDO45013 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU31])

HSP 1 Score: 258.455 bits (659), Expect = 2.830e-82
Identity = 148/413 (35.84%), Postives = 221/413 (53.51%), Query Frame = 3
Query:   48 LPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATREGKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFS-FDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVF 1283
            + A+V+DNG+G  K GFA +  P+ + PS +       G    + +  G+   + Y+GDEAQ+  G    ++++PI HG+V +WD  E+      +  LR  PE+H  LLTE PLN   NRE   +IMFETFN P +Y+A+QAVL+L AS  +        TG V+DSGDGVTH +P+ +GY +  AI  + +AGRD+T ++ ++L ER          E  + IKE+  YV  D  +E     S       +  +  S + PD     +G E+F  PE  F+P F+ G   A I +     I  C +D R+ LY N VLSGGS+M+  +  R+Q++I                  L P  + +K+++   ++Y+VW GG++LAS   F     +K++YDE GPSI  H   F
Sbjct:    5 VAALVVDNGSGMCKAGFAGDDAPRAVFPSIV-------GRPRHQGVMVGMGQKDSYVGDEAQSKRGI--LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRT--------TGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMQTAAS-------SSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFL-GMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEIT----------------SLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV-HRKCF 375          
BLAST of Actin-related protein 3 vs. Ensembl Nematostella
Match: EDO38520 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCN8])

HSP 1 Score: 258.455 bits (659), Expect = 3.537e-82
Identity = 148/413 (35.84%), Postives = 221/413 (53.51%), Query Frame = 3
Query:   48 LPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATREGKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFS-FDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVF 1283
            + A+V+DNG+G  K GFA +  P+ + PS +       G    + +  G+   + Y+GDEAQ+  G    ++++PI HG+V +WD  E+      +  LR  PE+H  LLTE PLN   NRE   +IMFETFN P +Y+A+QAVL+L AS  +        TG V+DSGDGVTH +P+ +GY +  AI  + +AGRD+T ++ ++L ER          E  + IKE+  YV  D  +E     S       +  +  S + PD     +G E+F  PE  F+P F+ G   A I +     I  C +D R+ LY N VLSGGS+M+  +  R+Q++I                  L P  + +K+++   ++Y+VW GG++LAS   F     +K++YDE GPSI  H   F
Sbjct:    6 VAALVVDNGSGMCKAGFAGDDAPRAVFPSIV-------GRPRHQGVMVGMGQKDSYVGDEAQSKRGI--LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRT--------TGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMTTAAS-------SSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFL-GMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEIS----------------ALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIV-HRKCF 376          
BLAST of Actin-related protein 3 vs. Ensembl Medaka
Match: actr3 (ARP3 actin related protein 3 homolog [Source:NCBI gene;Acc:101158395])

HSP 1 Score: 613.609 bits (1581), Expect = 0.000e+0
Identity = 295/419 (70.41%), Postives = 349/419 (83.29%), Query Frame = 3
Query:   42 ARLPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATRE-GKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFSFDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVFGRMT 1295
             RLPA V+D GTGY+KLG+A N+EPQFI+PSCIA +E  K+G +  RR+  G+DDL+F+IGDEA     K  +S +WPIRHG+VEDWDL ERFMEQ IFKYLRAEPEDHYFLLTEPPLNTPENRE+TAEIMFE+FN+PGLYIAVQAVLALAASWTSR   ERTLTGTVIDSGDGVTHVIPV +GYVIGS IKHIPIAGRDIT+F QQLLRERE  IPP+ S+E AK +KER+SYVCPD+ KEF+KYD+D  KW+K +    +    +F+ DVGYE+FLGPE+FF PEF N DF   IS+VVD VIQ+CPID RRPLY N+VLSGGS+MF+   RR+QRD+K+ VD RLK++EE S GKLKP PIDV+V++H MQRYAVWFGG++LAS+ +FY   HTKK Y+E+GPSICRHNPVFG M+
Sbjct:    3 GRLPACVVDCGTGYTKLGYAGNTEPQFIVPSCIAIKESAKVGDQAQRRMMKGVDDLDFFIGDEAV---DKPSYSTKWPIRHGIVEDWDLMERFMEQIIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFTQQLLREREVGIPPEQSLETAKAVKERFSYVCPDLVKEFSKYDTDSSKWLKQYTGINAISKKEFTIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNVVLSGGSTMFRDFGRRLQRDLKRTVDARLKMSEELSGGKLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEMGPSICRHNPVFGVMS 418          
BLAST of Actin-related protein 3 vs. Ensembl Medaka
Match: ACTR3 (actin-related protein 3 [Source:NCBI gene;Acc:101155832])

HSP 1 Score: 613.224 bits (1580), Expect = 0.000e+0
Identity = 296/419 (70.64%), Postives = 349/419 (83.29%), Query Frame = 3
Query:   42 ARLPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATRE-GKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFSFDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVFGRMT 1295
            +RLPA V+D GTGY+KLG+A N+EPQFIIPSCIA +E  K+G +  RR+  G+DDL+F+IGDEA     K  ++ +WPIRHG+VEDWDL ERFMEQ IFKYLRAEPEDHYFLLTEPPLNTPENRE+TAEIMFE+FN+PGLYIAVQAVLALAASWTSR   ERTLTGTVIDSGDGVTHVIPV +GYVIGS IKHIPIAGRDIT+F QQLLRERE  IPP+ S+E AK +KER+SYVCPD+ KEF KYD+D  KWIK +    +    +F+ DVGYE+FLGPE+FF PEF N DF   IS+VVD VIQ+CPID RRPLY N+VLSGGS+MF+   RR+QRD+K+ VD RLK++EE S GKLKP PIDV+V++H MQRYAVWFGG++LAS+ +FY   HTKK Y+E+GPSICRHNPVFG M+
Sbjct:    3 SRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRMMKGVDDLDFFIGDEAI---DKPSYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQIGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFTQQLLREREVGIPPEQSLETAKAVKERFSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFTIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNVVLSGGSTMFRDFGRRLQRDLKRTVDARLKISEELSGGKLKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFYQVCHTKKDYEEIGPSICRHNPVFGVMS 418          
BLAST of Actin-related protein 3 vs. Ensembl Medaka
Match: actr3 (ARP3 actin related protein 3 homolog [Source:NCBI gene;Acc:101158395])

HSP 1 Score: 566.229 bits (1458), Expect = 0.000e+0
Identity = 274/388 (70.62%), Postives = 324/388 (83.51%), Query Frame = 3
Query:   42 ARLPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATRE-GKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFSFDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASS 1202
             RLPA V+D GTGY+KLG+A N+EPQFI+PSCIA +E  K+G +  RR+  G+DDL+F+IGDEA     K  +S +WPIRHG+VEDWDL ERFMEQ IFKYLRAEPEDHYFLLTEPPLNTPENRE+TAEIMFE+FN+PGLYIAVQAVLALAASWTSR   ERTLTGTVIDSGDGVTHVIPV +GYVIGS IKHIPIAGRDIT+F QQLLRERE  IPP+ S+E AK +KER+SYVCPD+ KEF+KYD+D  KW+K +    +    +F+ DVGYE+FLGPE+FF PEF N DF   IS+VVD VIQ+CPID RRPLY N+VLSGGS+MF+   RR+QRD+K+ VD RLK++EE S GKLKP PIDV+V++H MQRYAVWFGG++LAS+
Sbjct:    3 GRLPACVVDCGTGYTKLGYAGNTEPQFIVPSCIAIKESAKVGDQAQRRMMKGVDDLDFFIGDEAV---DKPSYSTKWPIRHGIVEDWDLMERFMEQIIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFTQQLLREREVGIPPEQSLETAKAVKERFSYVCPDLVKEFSKYDTDSSKWLKQYTGINAISKKEFTIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNVVLSGGSTMFRDFGRRLQRDLKRTVDARLKMSEELSGGKLKPKPIDVQVITHHMQRYAVWFGGSMLAST 387          
BLAST of Actin-related protein 3 vs. Ensembl Medaka
Match: ACTR3 (actin-related protein 3 [Source:NCBI gene;Acc:101155832])

HSP 1 Score: 565.074 bits (1455), Expect = 0.000e+0
Identity = 275/388 (70.88%), Postives = 324/388 (83.51%), Query Frame = 3
Query:   42 ARLPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATRE-GKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFSFDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASS 1202
            +RLPA V+D GTGY+KLG+A N+EPQFIIPSCIA +E  K+G +  RR+  G+DDL+F+IGDEA     K  ++ +WPIRHG+VEDWDL ERFMEQ IFKYLRAEPEDHYFLLTEPPLNTPENRE+TAEIMFE+FN+PGLYIAVQAVLALAASWTSR   ERTLTGTVIDSGDGVTHVIPV +GYVIGS IKHIPIAGRDIT+F QQLLRERE  IPP+ S+E AK +KER+SYVCPD+ KEF KYD+D  KWIK +    +    +F+ DVGYE+FLGPE+FF PEF N DF   IS+VVD VIQ+CPID RRPLY N+VLSGGS+MF+   RR+QRD+K+ VD RLK++EE S GKLKP PIDV+V++H MQRYAVWFGG++LAS+
Sbjct:    3 SRLPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRMMKGVDDLDFFIGDEAI---DKPSYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQIGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFTQQLLREREVGIPPEQSLETAKAVKERFSYVCPDLVKEFNKYDTDGSKWIKQYTGINAISKKEFTIDVGYERFLGPEIFFHPEFANPDFTQPISEVVDEVIQNCPIDVRRPLYKNVVLSGGSTMFRDFGRRLQRDLKRTVDARLKISEELSGGKLKPKPIDVQVITHHMQRYAVWFGGSMLAST 387          
BLAST of Actin-related protein 3 vs. Ensembl Medaka
Match: actr3b (actin-related protein 3B [Source:NCBI gene;Acc:101162164])

HSP 1 Score: 540.421 bits (1391), Expect = 0.000e+0
Identity = 271/410 (66.10%), Postives = 318/410 (77.56%), Query Frame = 3
Query:   45 RLPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATRE-GKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFSFDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLK-----------------------PTPIDVKVVSHSMQRYAVWFGGALLASS 1202
            +LP  VID GTGY+K+G+A N+EPQFI+PSCIA +E   +G +  RR+  G+DDL+FYIGDEA     K +++ +WPIRHG+VEDWDL E+F+EQ IFKYLRAEPEDH FL+TEPPLNTPENRE+ AEIMFETFNIPGLYIAVQAVLALAASWTSR   +RTLTG VIDSGDGVTH IPV +GYVIGS IKHIPIAGRDITFFIQQLLR+RE  IPP+ SME AK +KERY Y+CPDI KEF KYDSDP KWIK ++   +     F  DVGYE+FLGPE+FF PEF N DF   ISDVVD VIQSCPID RRPLY NIVLSGGS+MF+   RR+QRD+K+ VD RL+L+EE S G++K                       P P++V+VVSH MQRYAVWFGG++LAS+
Sbjct:    4 QLPPCVIDCGTGYTKVGYAGNTEPQFIMPSCIAIKESASVGEQAQRRVTRGVDDLDFYIGDEAV---DKPNYATKWPIRHGMVEDWDLMEKFLEQVIFKYLRAEPEDHSFLMTEPPLNTPENREYLAEIMFETFNIPGLYIAVQAVLALAASWTSRQVGQRTLTGIVIDSGDGVTHAIPVAEGYVIGSCIKHIPIAGRDITFFIQQLLRDREVGIPPEQSMETAKAVKERYCYICPDIVKEFTKYDSDPGKWIKLYRGVNTLTNSAFHIDVGYERFLGPEIFFHPEFANPDFTQPISDVVDEVIQSCPIDVRRPLYKNIVLSGGSTMFRDFGRRLQRDLKRVVDARLRLSEELSGGRIKVGQDWPLLVLCFCRSSYLFVFLQPKPMEVQVVSHHMQRYAVWFGGSMLAST 410          
BLAST of Actin-related protein 3 vs. Planmine SMEST
Match: SMESG000078631.1 (SMESG000078631.1)

HSP 1 Score: 872.848 bits (2254), Expect = 0.000e+0
Identity = 419/419 (100.00%), Postives = 419/419 (100.00%), Query Frame = 3
Query:   39 MARLPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATREGKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFSFDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVFGRMT 1295
            MARLPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATREGKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFSFDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVFGRMT
Sbjct:    1 MARLPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATREGKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFSFDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVFGRMT 419          
BLAST of Actin-related protein 3 vs. Planmine SMEST
Match: SMESG000020125.1 (SMESG000020125.1)

HSP 1 Score: 266.544 bits (680), Expect = 5.177e-85
Identity = 150/413 (36.32%), Postives = 224/413 (54.24%), Query Frame = 3
Query:   48 LPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATREGKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFS-FDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVF 1283
            + A+VIDNG+G  K GFA +  P+ + PS I       G    + +  G+   + Y+GDEAQ+  G    ++++PI HG+V +WD  E+      +  +R  PE+H  LLTE PLN   NRE   +IMFETFN+P +Y+A+QAVL+L AS  +        TG V+DSGDGVTH +P+ +GY +  AI  I +AGRD+T ++ +++ ER          E  + IKE+ SY+  D  +E     S          +  S + PD     +G E+F  PE  F+P F+ G   A I +     I  C +D R+ LY+NIVLSGGS+MF  +  R+Q++I                  L P+ + +K+++   ++Y+VW GG++LAS   F     +K++YDE GP I  H   F
Sbjct:    5 IAALVIDNGSGMCKAGFAGDDAPRAVFPSII-------GRPRHQGVMVGMGQKDSYVGDEAQSKRGI--LTLKYPIEHGIVTNWDDMEKIWHHTFYNEMRTAPEEHPILLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRT--------TGIVLDSGDGVTHTVPIYEGYALPHAICRIDLAGRDLTDYLMKIMTERGYSFTTTAEREIVRDIKEKLSYIALDFEQEMQSASS-------TSSLEKSYELPDGQIITIGNERFRCPESLFQPSFL-GMESAGIHETTYNSIMKCDVDIRKDLYSNIVLSGGSTMFPGISDRMQKEIS----------------SLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV-HRKCF 375          
BLAST of Actin-related protein 3 vs. Planmine SMEST
Match: SMESG000057914.1 (SMESG000057914.1)

HSP 1 Score: 260.766 bits (665), Expect = 9.765e-83
Identity = 149/413 (36.08%), Postives = 222/413 (53.75%), Query Frame = 3
Query:   48 LPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATREGKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFS-FDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVF 1283
            + A+V+DNG+G  K GFA +  P+ + PS +       G    + +  G+   + Y+GDEAQ+  G    ++++PI HG+V +WD  E+      +  LR  PE+H  LLTE PLN   NRE   +IMFETFN P +Y+A+QAVL+L AS  +        TG V+DSGDGVTH +P+ +GY +  AI  + +AGRD+T ++ ++L ER          E  + IKE+  YV  D  +E +   S       +  +  S + PD     +G E+F  PE  F+P F+ G   A I +     I  C +D R+ LY N VLSGGS+MF  +  R+Q++I                  L P+ + +K+V+   ++Y+VW GG++LAS   F     +K++YDE GP I  H   F
Sbjct:    6 ISALVVDNGSGMCKAGFAGDDAPRAVFPSIV-------GRPRHQGVMVGMGQKDSYVGDEAQSKRGI--LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRT--------TGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMSTAAS-------SSSLEKSYELPDGQVITIGNERFRCPESLFQPAFL-GMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEIT----------------SLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV-HRKCF 376          
BLAST of Actin-related protein 3 vs. Planmine SMEST
Match: SMESG000057913.1 (SMESG000057913.1)

HSP 1 Score: 260.766 bits (665), Expect = 9.765e-83
Identity = 149/413 (36.08%), Postives = 222/413 (53.75%), Query Frame = 3
Query:   48 LPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATREGKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFS-FDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVF 1283
            + A+V+DNG+G  K GFA +  P+ + PS +       G    + +  G+   + Y+GDEAQ+  G    ++++PI HG+V +WD  E+      +  LR  PE+H  LLTE PLN   NRE   +IMFETFN P +Y+A+QAVL+L AS  +        TG V+DSGDGVTH +P+ +GY +  AI  + +AGRD+T ++ ++L ER          E  + IKE+  YV  D  +E +   S       +  +  S + PD     +G E+F  PE  F+P F+ G   A I +     I  C +D R+ LY N VLSGGS+MF  +  R+Q++I                  L P+ + +K+V+   ++Y+VW GG++LAS   F     +K++YDE GP I  H   F
Sbjct:    6 ISALVVDNGSGMCKAGFAGDDAPRAVFPSIV-------GRPRHQGVMVGMGQKDSYVGDEAQSKRGI--LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRT--------TGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMSTAAS-------SSSLEKSYELPDGQVITIGNERFRCPESLFQPAFL-GMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEIT----------------SLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV-HRKCF 376          
BLAST of Actin-related protein 3 vs. Planmine SMEST
Match: SMESG000066029.1 (SMESG000066029.1)

HSP 1 Score: 260.381 bits (664), Expect = 1.111e-82
Identity = 149/411 (36.25%), Postives = 221/411 (53.77%), Query Frame = 3
Query:   54 AVVIDNGTGYSKLGFADNSEPQFIIPSCIATREGKMGGKDSRRIGTGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFKYLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLALAASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRDITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDPEKWIKAHKMSGSSKYPDFS-FDVGYEKFLGPEVFFRPEFVNGDFQASISDVVDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKLTEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQYDEVGPSICRHNPVF 1283
            A+V+DNG+G  K GFA +  P+ + PS +       G    + +  G+   + Y+GDEAQ+  G    ++++PI HG+V +WD  E+      +  LR  PE+H  LLTE PLN   NRE   +IMFETFN P +Y+A+QAVL+L AS  +        TG V+DSGDGVTH +P+ +GY +  AI  + +AGRD+T ++ ++L ER          E  + IKE+  YV  D  +E A   S       +  +  S + PD     +G E+F  PE  F+P F+ G   A I +     I  C +D R+ LY N VLSGGS+M+  +  R+Q++I                  L P+ + +K+V+   ++Y+VW GG++LAS   F     +K++YDE GP I  H   F
Sbjct:    8 ALVVDNGSGMCKAGFAGDDAPRAVFPSIV-------GRPRHQGVMVGMGQKDSYVGDEAQSKRGI--LTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRT--------TGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAAS-------SSSLEKSYELPDGQVITIGNERFRCPESLFQPSFL-GMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEIT----------------ALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV-HRKCF 376          
The following BLAST results are available for this feature:
BLAST of Actin-related protein 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ACTR30.000e+071.36actin related protein 3 [Source:HGNC Symbol;Acc:HG... [more]
ACTR3B0.000e+069.54actin related protein 3B [Source:HGNC Symbol;Acc:H... [more]
ACTR30.000e+072.83actin related protein 3 [Source:HGNC Symbol;Acc:HG... [more]
ACTR3B3.830e-17572.64actin related protein 3B [Source:HGNC Symbol;Acc:H... [more]
ACTR3B1.298e-15871.52actin related protein 3B [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Actin-related protein 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arx-10.000e+065.72Actin-related protein 3 [Source:UniProtKB/Swiss-P... [more]
act-42.859e-8336.32Actin-4 [Source:UniProtKB/Swiss-Prot;Acc:P10986][more]
act-33.252e-8336.32Actin-3 [Source:UniProtKB/Swiss-Prot;Acc:P0DM42][more]
act-33.252e-8336.32Actin-3 [Source:UniProtKB/Swiss-Prot;Acc:P0DM42][more]
act-33.252e-8336.32Actin-3 [Source:UniProtKB/Swiss-Prot;Acc:P0DM42][more]
back to top
BLAST of Actin-related protein 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Arp30.000e+068.97gene:FBgn0262716 transcript:FBtr0076737[more]
Arp30.000e+068.97gene:FBgn0262716 transcript:FBtr0334087[more]
Act5C8.247e-8235.35gene:FBgn0000042 transcript:FBtr0070822[more]
Act5C8.247e-8235.35gene:FBgn0000042 transcript:FBtr0100662[more]
Act5C8.247e-8235.35gene:FBgn0000042 transcript:FBtr0345894[more]
back to top
BLAST of Actin-related protein 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actr3b0.000e+068.26actin related protein 3B [Source:ZFIN;Acc:ZDB-GENE... [more]
actr3b7.782e-15769.81actin related protein 3B [Source:ZFIN;Acc:ZDB-GENE... [more]
actr33.643e-11076.39actin related protein 3 [Source:ZFIN;Acc:ZDB-GENE-... [more]
acta1a2.048e-8236.25actin alpha 1, skeletal muscle a [Source:ZFIN;Acc:... [more]
acta22.137e-8236.01actin alpha 2, smooth muscle [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Actin-related protein 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
calr30.000e+068.26calreticulin 3 [Source:Xenbase;Acc:XB-GENE-6258823... [more]
calr30.000e+067.48calreticulin 3 [Source:Xenbase;Acc:XB-GENE-6258823... [more]
calr30.000e+066.83calreticulin 3 [Source:Xenbase;Acc:XB-GENE-6258823... [more]
calr30.000e+066.50calreticulin 3 [Source:Xenbase;Acc:XB-GENE-6258823... [more]
calr30.000e+066.09calreticulin 3 [Source:Xenbase;Acc:XB-GENE-6258823... [more]
back to top
BLAST of Actin-related protein 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Actr30.000e+071.36ARP3 actin-related protein 3 [Source:MGI Symbol;Ac... [more]
Actr30.000e+071.36ARP3 actin-related protein 3 [Source:MGI Symbol;Ac... [more]
Actr3b0.000e+069.78ARP3 actin-related protein 3B [Source:MGI Symbol;A... [more]
Actr3b3.897e-17572.64ARP3 actin-related protein 3B [Source:MGI Symbol;A... [more]
Actr36.189e-11176.96ARP3 actin-related protein 3 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Actin-related protein 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q4V7C7|ARP3_RAT0.000e+071.36Actin-related protein 3 OS=Rattus norvegicus OX=10... [more]
sp|Q99JY9|ARP3_MOUSE0.000e+071.36Actin-related protein 3 OS=Mus musculus OX=10090 G... [more]
sp|Q5R8R1|ARP3_PONAB0.000e+071.36Actin-related protein 3 OS=Pongo abelii OX=9601 GN... [more]
sp|P61158|ARP3_HUMAN0.000e+071.36Actin-related protein 3 OS=Homo sapiens OX=9606 GN... [more]
sp|P61157|ARP3_BOVIN0.000e+071.36Actin-related protein 3 OS=Bos taurus OX=9913 GN=A... [more]
back to top
BLAST of Actin-related protein 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C1LJL30.000e+077.62Actin-like protein 3 OS=Schistosoma japonicum OX=6... [more]
C1LJL20.000e+077.38Actin-like protein 3 OS=Schistosoma japonicum OX=6... [more]
A0A3Q0KVF20.000e+077.14Prolyl oligopeptidase (S09 family) OS=Schistosoma ... [more]
G4VGA30.000e+077.11Prolyl oligopeptidase (S09 family) OS=Schistosoma ... [more]
H2KVF00.000e+076.13Actin-related protein 3 OS=Clonorchis sinensis OX=... [more]
back to top
BLAST of Actin-related protein 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actr30.000e+070.88actin related protein 3 [Source:NCBI gene;Acc:1030... [more]
actr3b0.000e+069.07actin related protein 3B [Source:ZFIN;Acc:ZDB-GENE... [more]
actr3b1.376e-17272.34actin related protein 3B [Source:ZFIN;Acc:ZDB-GENE... [more]
actr3b5.793e-13874.07actin related protein 3B [Source:ZFIN;Acc:ZDB-GENE... [more]
actb11.037e-8235.25actin, cytoplasmic 1 [Source:NCBI gene;Acc:1030395... [more]
back to top
BLAST of Actin-related protein 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003686.10.000e+069.16pep scaffold:Pmarinus_7.0:GL476472:70600:102044:1 ... [more]
ENSPMAT00000001851.17.066e-17763.41pep scaffold:Pmarinus_7.0:GL479410:2915:28079:-1 g... [more]
ENSPMAT00000001857.14.895e-17362.08pep scaffold:Pmarinus_7.0:GL479410:2915:28006:-1 g... [more]
ENSPMAT00000001856.16.553e-17161.31pep scaffold:Pmarinus_7.0:GL479410:2915:28006:-1 g... [more]
ENSPMAT00000011113.11.603e-8235.35pep scaffold:Pmarinus_7.0:GL498954:115:1245:1 gene... [more]
back to top
BLAST of Actin-related protein 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ARP31.208e-15254.04Essential component of the Arp2/3 complex; Arp2/3 ... [more]
ACT15.305e-8435.92Actin; structural protein involved in cell polariz... [more]
ARP22.306e-5931.94Essential component of the Arp2/3 complex; Arp2/3 ... [more]
ARP13.801e-5230.50Actin-related protein of the dynactin complex; req... [more]
ARP41.145e-1327.23Nuclear actin-related protein involved in chromati... [more]
back to top
BLAST of Actin-related protein 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO418220.000e+069.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380063.527e-8336.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO426461.394e-8236.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO450132.830e-8235.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO385203.537e-8235.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Actin-related protein 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actr30.000e+070.41ARP3 actin related protein 3 homolog [Source:NCBI ... [more]
ACTR30.000e+070.64actin-related protein 3 [Source:NCBI gene;Acc:1011... [more]
actr30.000e+070.62ARP3 actin related protein 3 homolog [Source:NCBI ... [more]
ACTR30.000e+070.88actin-related protein 3 [Source:NCBI gene;Acc:1011... [more]
actr3b0.000e+066.10actin-related protein 3B [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Actin-related protein 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000078631.10.000e+0100.00SMESG000078631.1[more]
SMESG000020125.15.177e-8536.32SMESG000020125.1[more]
SMESG000057914.19.765e-8336.08SMESG000057914.1[more]
SMESG000057913.19.765e-8336.08SMESG000057913.1[more]
SMESG000066029.11.111e-8236.25SMESG000066029.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021956 ID=SMED30021956|Name=Actin-related protein 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1416bp
GTTTATATTATAAGTTCTATTTAAAAATATTTTAGGAAATGGCAAGACTT
CCAGCCGTTGTAATTGATAATGGCACAGGATATTCTAAATTAGGGTTTGC
TGATAATTCAGAACCTCAATTTATAATCCCTTCATGTATTGCTACCAGAG
AAGGTAAAATGGGTGGTAAAGACTCTAGAAGAATAGGAACTGGATTAGAT
GATTTAAATTTTTATATTGGAGATGAAGCACAAGCTATGGAAGGAAAAAA
TGATTTTTCAGTCAGGTGGCCTATTCGCCATGGAGTAGTTGAAGATTGGG
ATCTCCATGAAAGATTTATGGAGCAAGCTATTTTTAAATATCTCAGAGCT
GAACCAGAAGATCATTATTTTTTATTAACTGAACCGCCATTAAATACTCC
TGAAAATCGTGAATTTACCGCCGAAATAATGTTCGAAACATTTAATATTC
CTGGATTATACATTGCTGTTCAGGCAGTTCTTGCACTAGCCGCATCTTGG
ACATCTCGTCCACCAAATGAAAGAACTCTTACCGGAACGGTTATTGATTC
TGGCGATGGGGTTACACACGTTATTCCAGTTGTTGACGGATACGTTATTG
GCAGTGCGATCAAACACATTCCTATTGCTGGTCGGGATATCACATTTTTC
ATCCAGCAATTGCTACGGGAACGGGAAACTGTAATCCCACCCGATATGAG
CATGGAGGCTGCCAAACAAATCAAGGAGCGCTATTCTTATGTGTGTCCCG
ATATTGCTAAAGAATTCGCAAAATACGACTCAGATCCGGAAAAATGGATC
AAGGCTCACAAAATGAGTGGATCAAGCAAATACCCAGATTTCTCATTCGA
CGTCGGATATGAAAAATTTTTAGGGCCTGAAGTGTTTTTCCGACCAGAGT
TTGTGAACGGAGATTTCCAGGCCTCAATAAGTGATGTTGTCGACACGGTT
ATACAGAGTTGTCCTATTGACTCCCGTCGACCATTATACAATAATATTGT
ATTATCAGGAGGTAGTTCGATGTTCAAGCATCTTGATAGACGAATACAGA
GAGATATTAAGAAGAATGTTGATTACAGATTAAAGCTGACTGAAGAAAAT
AGTCACGGTAAATTGAAACCAACTCCGATTGATGTTAAAGTGGTGTCACA
TAGCATGCAACGATATGCCGTGTGGTTCGGTGGAGCTCTGTTGGCAAGTT
CGGACGATTTTTATACTGCAGCTCATACCAAAAAACAGTATGATGAAGTT
GGTCCATCAATTTGTCGACATAATCCGGTTTTCGGTCGAATGACCTAAAT
TTGGTCATATTGCGAGACGGCGTATAACAGTGTGATCATGCTAGCTTTGT
TATAAATTCAATTTTGACGATTTCCTGATAATTTTGTACTCGAATATAAT
TGATGAACTTTTCTTT
back to top

protein sequence of SMED30021956-orf-1

>SMED30021956-orf-1 ID=SMED30021956-orf-1|Name=SMED30021956-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=420bp
MARLPAVVIDNGTGYSKLGFADNSEPQFIIPSCIATREGKMGGKDSRRIG
TGLDDLNFYIGDEAQAMEGKNDFSVRWPIRHGVVEDWDLHERFMEQAIFK
YLRAEPEDHYFLLTEPPLNTPENREFTAEIMFETFNIPGLYIAVQAVLAL
AASWTSRPPNERTLTGTVIDSGDGVTHVIPVVDGYVIGSAIKHIPIAGRD
ITFFIQQLLRERETVIPPDMSMEAAKQIKERYSYVCPDIAKEFAKYDSDP
EKWIKAHKMSGSSKYPDFSFDVGYEKFLGPEVFFRPEFVNGDFQASISDV
VDTVIQSCPIDSRRPLYNNIVLSGGSSMFKHLDRRIQRDIKKNVDYRLKL
TEENSHGKLKPTPIDVKVVSHSMQRYAVWFGGALLASSDDFYTAAHTKKQ
YDEVGPSICRHNPVFGRMT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR015623Arp3
IPR043129ATPase_NBD
IPR004000Actin
IPR020902Actin/actin-like_CS
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
Vocabulary: cellular component
TermDefinition
GO:0005885Arp2/3 protein complex
Vocabulary: biological process
TermDefinition
GO:0007015actin filament organization
GO:0034314Arp2/3 complex-mediated actin nucleation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004000Actin familySMARTSM00268actin_3coord: 4..414
e-value: 5.0E-158
score: 540.9
IPR004000Actin familyPFAMPF00022Actincoord: 4..410
e-value: 2.5E-82
score: 276.7
IPR004000Actin familyPANTHERPTHR11937ACTINcoord: 2..409
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 146..387
e-value: 1.0E-131
score: 441.0
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 8..407
e-value: 1.0E-131
score: 441.0
NoneNo IPR availableGENE3DG3DSA:3.90.640.10coord: 203..301
e-value: 1.0E-131
score: 441.0
NoneNo IPR availableCDDcd00012NBD_sugar-kinase_HSP70_actincoord: 7..216
e-value: 2.65132E-12
score: 62.9915
IPR015623Actin-related protein 3PANTHERPTHR11937:SF175ACTIN-RELATED PROTEIN 3coord: 2..409
IPR020902Actin/actin-like conserved sitePROSITEPS01132ACTINS_ACT_LIKEcoord: 112..124
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 4..156
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 163..414