Plastin-3

Overview
NamePlastin-3
Smed IDSMED30021934
Length (bp)2034
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Plastin-3 (SMED30021934) t-SNE clustered cells

Violin plots show distribution of expression levels for Plastin-3 (SMED30021934) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Plastin-3 (SMED30021934) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Plastin-3 (SMED30021934) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021934

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
prepharyngeal regionSMED30021934SMESG000042101.1 SmedASXL_000091SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
X1 cellSMED30021934SMESG000042101.1 SmedASXL_000091SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
testisSMED30021934SMESG000042101.1 DN311193.1ncbi_smed_estsPMID:22074376
Chong et al., 2011
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
spermatogoniumSMED30021934SMESG000042101.1 DN311193.1ncbi_smed_estsPMID:22074376
Chong et al., 2011
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
spermatocyteSMED30021934SMESG000042101.1 DN311193.1ncbi_smed_estsPMID:22074376
Chong et al., 2011
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
spermatidSMED30021934SMESG000042101.1 DN311193.1ncbi_smed_estsPMID:22074376
Chong et al., 2011
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
testisSMED30021934SMESG000042101.1 HO007660.1ncbi_smed_estsPMID:22074376
Chong et al., 2011
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
spermatogoniumSMED30021934SMESG000042101.1 HO007660.1ncbi_smed_estsPMID:22074376
Chong et al., 2011
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
spermatocyteSMED30021934SMESG000042101.1 HO007660.1ncbi_smed_estsPMID:22074376
Chong et al., 2011
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
spermatidSMED30021934SMESG000042101.1 HO007660.1ncbi_smed_estsPMID:22074376
Chong et al., 2011
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
testisSMED30021934SMESG000042101.1 DN311193ncbi_smed_estsPMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
spermatocyteSMED30021934SMESG000042101.1 DN311193ncbi_smed_estsPMID:17376870
Wang et al., 2007
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
spermatidSMED30021934SMESG000042101.1 DN311193ncbi_smed_estsPMID:17376870
Wang et al., 2007
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testis primordiumSMED30021934SMESG000042101.1 Contig4499_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
testisSMED30021934SMESG000042101.1 HO007660.1ncbi_smed_estsPMID:279364
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Plastin-3 vs. Ensembl Human
Match: PLS3 (plastin 3 [Source:HGNC Symbol;Acc:HGNC:9091])

HSP 1 Score: 249.98 bits (637), Expect = 3.746e-73
Identity = 164/531 (30.89%), Postives = 266/531 (50.09%), Query Frame = 1
Query:  328 VATKMTTGIHEPSERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINR---TPKIMDYTQKIENLSLALNAAR---CHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAPADLKNKMVSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDD------LKNGADRKETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQRVHNCTKIAKIAENYPLTIGSELDPEKMARFDKLTVLGLITEIMITYI--------SKNQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCLDRSCLSNNRL------QNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLI 1842
            ++++ T   +   E+ AF  WIN+ L  DPDCR ++P++PN++D++  V DG++LCK++NLS+P  IDERAIN+   TP I+      ENL+LALN+A    CH  N+GA DL     G    +L  LWQIIKIG   D+ +  +  +A L + GE+++E+ +LSP E+++R+ NFHL  SG +  +  F  D +D   Y HL N+IAP          G    E   D+  S   E   L  A++ L + D          AD    + KL+LA +A LF  Y   L+    Q      + GE  +E   RN++NS  + P  NHL  D ++ L+  Q+ + ++  +         +    ++ +++ NC    ++ ++        +  + +   ++   L L+ ++M  Y            + N+   V+WVN   S   +  SIQ+F D+ I+      +++DA  PGC++   + +  L       NAKY +S A + G  +Y LPE  VE     +   FA L+
Sbjct:  112 LSSEGTQHSYSEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAINKKKLTPFIIQ-----ENLNLALNSASAIGCHVVNIGAEDLRA---GKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLENSGWQK-INNFSADIKDSKAYFHLLNQIAP---------KGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVVSGNPKLNLAFVANLFNKYPA-LTKPENQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYADLQDALVILQLYERIKVPVDWSKVNKPPYPKLGANMKKLENCNYAVELGKHPAKFSLVGIGGQDLNDGNQTLTLALVWQLMRRYTLNVLEDLGDGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGNLTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLM 623          
BLAST of Plastin-3 vs. Ensembl Human
Match: PLS3 (plastin 3 [Source:HGNC Symbol;Acc:HGNC:9091])

HSP 1 Score: 249.98 bits (637), Expect = 3.746e-73
Identity = 164/531 (30.89%), Postives = 266/531 (50.09%), Query Frame = 1
Query:  328 VATKMTTGIHEPSERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINR---TPKIMDYTQKIENLSLALNAAR---CHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAPADLKNKMVSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDD------LKNGADRKETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQRVHNCTKIAKIAENYPLTIGSELDPEKMARFDKLTVLGLITEIMITYI--------SKNQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCLDRSCLSNNRL------QNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLI 1842
            ++++ T   +   E+ AF  WIN+ L  DPDCR ++P++PN++D++  V DG++LCK++NLS+P  IDERAIN+   TP I+      ENL+LALN+A    CH  N+GA DL     G    +L  LWQIIKIG   D+ +  +  +A L + GE+++E+ +LSP E+++R+ NFHL  SG +  +  F  D +D   Y HL N+IAP          G    E   D+  S   E   L  A++ L + D          AD    + KL+LA +A LF  Y   L+    Q      + GE  +E   RN++NS  + P  NHL  D ++ L+  Q+ + ++  +         +    ++ +++ NC    ++ ++        +  + +   ++   L L+ ++M  Y            + N+   V+WVN   S   +  SIQ+F D+ I+      +++DA  PGC++   + +  L       NAKY +S A + G  +Y LPE  VE     +   FA L+
Sbjct:  112 LSSEGTQHSYSEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAINKKKLTPFIIQ-----ENLNLALNSASAIGCHVVNIGAEDLRA---GKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLENSGWQK-INNFSADIKDSKAYFHLLNQIAP---------KGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVVSGNPKLNLAFVANLFNKYPA-LTKPENQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYADLQDALVILQLYERIKVPVDWSKVNKPPYPKLGANMKKLENCNYAVELGKHPAKFSLVGIGGQDLNDGNQTLTLALVWQLMRRYTLNVLEDLGDGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGNLTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLM 623          
BLAST of Plastin-3 vs. Ensembl Human
Match: PLS3 (plastin 3 [Source:HGNC Symbol;Acc:HGNC:9091])

HSP 1 Score: 242.662 bits (618), Expect = 1.412e-70
Identity = 163/539 (30.24%), Postives = 266/539 (49.35%), Query Frame = 1
Query:  328 VATKMTTGIHEPSERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINR---TPKIMDYTQKIENLSLALNAAR---CHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHM--------VKGFDEDFRDCIVYAHLTNRIAPADLKNKMVSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDD------LKNGADRKETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQRVHNCTKIAKIAENYPLTIGSELDPEKMARFDKLTVLGLITEIMITYI--------SKNQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCLDRSCLSNNRL------QNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLI 1842
            ++++ T   +   E+ AF  WIN+ L  DPDCR ++P++PN++D++  V DG++LCK++NLS+P  IDERAIN+   TP I+      ENL+LALN+A    CH  N+GA DL     G    +L  LWQIIKIG   D+ +  +  +A L + GE+++E+ +LSP E+++R+ NFHL  SG + +        +  F    +D   Y HL N+IAP          G    E   D+  S   E   L  A++ L + D          AD    + KL+LA +A LF  Y   L+    Q      + GE  +E   RN++NS  + P  NHL  D ++ L+  Q+ + ++  +         +    ++ +++ NC    ++ ++        +  + +   ++   L L+ ++M  Y            + N+   V+WVN   S   +  SIQ+F D+ I+      +++DA  PGC++   + +  L       NAKY +S A + G  +Y LPE  VE     +   FA L+
Sbjct:   90 LSSEGTQHSYSEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAINKKKLTPFIIQ-----ENLNLALNSASAIGCHVVNIGAEDLRA---GKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLENSGWQKINNFSADIKLIDFSNSVKDSKAYFHLLNQIAP---------KGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVVSGNPKLNLAFVANLFNKYPA-LTKPENQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYADLQDALVILQLYERIKVPVDWSKVNKPPYPKLGANMKKLENCNYAVELGKHPAKFSLVGIGGQDLNDGNQTLTLALVWQLMRRYTLNVLEDLGDGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGNLTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLM 610          
BLAST of Plastin-3 vs. Ensembl Human
Match: PLS3 (plastin 3 [Source:HGNC Symbol;Acc:HGNC:9091])

HSP 1 Score: 242.662 bits (618), Expect = 1.517e-70
Identity = 163/539 (30.24%), Postives = 266/539 (49.35%), Query Frame = 1
Query:  328 VATKMTTGIHEPSERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINR---TPKIMDYTQKIENLSLALNAAR---CHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHM--------VKGFDEDFRDCIVYAHLTNRIAPADLKNKMVSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDD------LKNGADRKETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQRVHNCTKIAKIAENYPLTIGSELDPEKMARFDKLTVLGLITEIMITYI--------SKNQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCLDRSCLSNNRL------QNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLI 1842
            ++++ T   +   E+ AF  WIN+ L  DPDCR ++P++PN++D++  V DG++LCK++NLS+P  IDERAIN+   TP I+      ENL+LALN+A    CH  N+GA DL     G    +L  LWQIIKIG   D+ +  +  +A L + GE+++E+ +LSP E+++R+ NFHL  SG + +        +  F    +D   Y HL N+IAP          G    E   D+  S   E   L  A++ L + D          AD    + KL+LA +A LF  Y   L+    Q      + GE  +E   RN++NS  + P  NHL  D ++ L+  Q+ + ++  +         +    ++ +++ NC    ++ ++        +  + +   ++   L L+ ++M  Y            + N+   V+WVN   S   +  SIQ+F D+ I+      +++DA  PGC++   + +  L       NAKY +S A + G  +Y LPE  VE     +   FA L+
Sbjct:   90 LSSEGTQHSYSEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAINKKKLTPFIIQ-----ENLNLALNSASAIGCHVVNIGAEDLRA---GKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLENSGWQKINNFSADIKLIDFSNSVKDSKAYFHLLNQIAP---------KGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVVSGNPKLNLAFVANLFNKYPA-LTKPENQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYADLQDALVILQLYERIKVPVDWSKVNKPPYPKLGANMKKLENCNYAVELGKHPAKFSLVGIGGQDLNDGNQTLTLALVWQLMRRYTLNVLEDLGDGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGNLTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLM 610          
BLAST of Plastin-3 vs. Ensembl Human
Match: LCP1 (lymphocyte cytosolic protein 1 [Source:HGNC Symbol;Acc:HGNC:6528])

HSP 1 Score: 233.032 bits (593), Expect = 6.604e-67
Identity = 157/516 (30.43%), Postives = 262/516 (50.78%), Query Frame = 1
Query:  355 HEPSERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINRTPKIMDYTQKIENLSLALNAAR---CHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAPADLKN---KMVSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDDLKNGADRKETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQRVHNCTKIAKIAENYPLTIGSELDPEKMARFDKLTVLGLITEIMITYI--------SKNQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCLDRSCLS------NNRLQNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLI 1842
            +   E+ AF  WIN+ L  DPDCR ++P++PN+ND+++ V DG++LCK++NLS+P  IDER IN+  K+  +T + ENL+LALN+A    CH  N+GA DL E   G    +L  LWQ+IKIG   D+ +  +  +  L + GES++++ +LSP E+++R+ N+HL  +G  + +  F  D +D   Y HL  ++AP   +     +V   +  +EK    R+  +++  + L    F+   D+  G      + KL+LA +A LF  Y   L     Q     ++ GE  +E   RN++NS  + P  NHL  D  + L+  Q+ + ++  +         +     + +++ NC    ++ +N        +  + +   ++   L LI ++M  Y            + N+   V+WVN+      +  SI +F D  I+      +++DA  PG ++   L       + +L NAKY IS A K G  +Y LPE  VE N   +   FA L+
Sbjct:  118 YSEEEKYAFVNWINKALENDPDCRHVIPMNPNTNDLFNAVGDGIVLCKMINLSVPDTIDERTINKK-KLTPFTIQ-ENLNLALNSASAIGCHVVNIGAEDLKE---GKPYLVLGLLWQVIKIGLFADIELSRNEALIALLREGESLEDLMKLSPEELLLRWANYHLENAGC-NKIGNFSTDIKDSKAYYHLLEQVAPKGDEEGVPAVVIDMSGLREKDDIQRAECMLQQAERLGCRQFVTATDVVRG------NPKLNLAFIANLFNRYPA-LHKPENQDIDWGALEGETREERTFRNWMNSLGVNPRVNHLYSDLSDALVIFQLYEKIKVPVDWNRVNKPPYPKLGGNMKKLENCNYAVELGKNQAKFSLVGIGGQDLNEGNRTLTLALIWQLMRRYTLNILEEIGGGQKVNDDIIVNWVNETLREAKKSSSISSFKDPKISTSLPVLDLIDAIQPGSINYDLLKTENLNDDEKLNNAKYAISMARKIGARVYALPEDLVEVNPKMVMTVFACLM 620          
BLAST of Plastin-3 vs. Ensembl Celegans
Match: plst-1 (PLaSTin (Actin bundling protein) homolog [Source:UniProtKB/TrEMBL;Acc:U4PMA7])

HSP 1 Score: 132.109 bits (331), Expect = 2.242e-33
Identity = 95/363 (26.17%), Postives = 167/363 (46.01%), Query Frame = 1
Query:  820 IRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAPADLKNKMVSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDDLKNGADRKETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQRVHNCTKIAKIAENYPLTIGSEL-------DPEKMARFDKLTVLGLITEIMITYI----------SKNQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCLDRSCLSN-----NRLQNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLI 1842
            +R+VN+HL ++G +  +  F  D  D  +Y HL ++IAP      +   G          R+ ++++  + L+   F+   D+  G      + KL+LA +A LF N   +L   G        V  E  +E   RN++NS  + P+ N L  D +NG++  Q+ D++RPG+    R +  F   R    ++ NC        NY + +G +L         + +   ++   L L+ ++M  Y             +   +KD V WVN++   + +  SI++F D  I++  +  +++DA  P  +D S + +     +++ NAKY I+   K G  IY LPE  VE     +   FA L+
Sbjct:    1 MRWVNYHLERAGTQRRLHNFTSDIVDSEIYTHLLHQIAPNGSGVTLSPLGVHGNVP----RAGAMLDEAEKLDCREFVTATDVAAG------NYKLNLAFVANLF-NKHPNLPDPGADE-VVEDVIEETREEKTYRNWMNSMGVDPYVNWLYADLQNGVVIFQLYDIIRPGMVTWKRVVRTFHKLRGMMDQIQNC--------NYAVELGKQLRFSLVGIQGKDIYDGNQTLTLALVWQLMRAYTLSVLAQCTQSGDSLPADKDIVAWVNEKLKNSGKSTSIRSFQDPAISDGKVVLDLIDAIKPNVIDHSLVKSGKSNEDKMSNAKYAITCGRKIGAKIYALPEDIVEVKPKMVLTVFACLM 343          

HSP 2 Score: 67.781 bits (164), Expect = 8.429e-12
Identity = 63/271 (23.25%), Postives = 124/271 (45.76%), Query Frame = 1
Query:  352 IHEPSERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINRT-PKIMDYTQKIENLSLALNAARCHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGF-DEDFRDCIVYAHLTNRIAPADLKNKMVSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDDLKNGADRKETSAKLHLATLAYLF-RNYSGDL 1155
            I E  E   +  W+N            + +DP  N +Y+ +Q+G+++ +L ++  P ++  + + RT  K+     +I+N + A+   +    +L  I   ++Y+GNQT  L  +WQ+++  +   V       +A   ++G+S+   K+      I+ +VN  L  SG    ++ F D    D  V   L + I P  + + +V SG   ++K S+ + +  I   + + A  + + +D+       E   K+ L   A L  R+Y  D+
Sbjct:  114 IEETREEKTYRNWMNS-----------MGVDPYVNWLYADLQNGVVIFQLYDIIRPGMVTWKRVVRTFHKLRGMMDQIQNCNYAVELGKQLRFSLVGIQGKDIYDGNQTLTLALVWQLMR-AYTLSV-------LAQCTQSGDSLPADKD------IVAWVNEKLKNSGKSTSIRSFQDPAISDGKVVLDLIDAIKPNVIDHSLVKSGKSNEDKMSNAKYA--ITCGRKIGAKIYALPEDI------VEVKPKMVLTVFACLMARDYLPDM 351          
BLAST of Plastin-3 vs. Ensembl Celegans
Match: plst-1 (PLaSTin (Actin bundling protein) homolog [Source:UniProtKB/TrEMBL;Acc:U4PMA7])

HSP 1 Score: 131.724 bits (330), Expect = 3.103e-33
Identity = 96/366 (26.23%), Postives = 169/366 (46.17%), Query Frame = 1
Query:  820 IRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAPADLKNKMVSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDDLKNGADRKETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSG---ECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQRVHNCTKIAKIAENYPLTIGSEL-------DPEKMARFDKLTVLGLITEIMITYI----------SKNQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCLDRSCLSN-----NRLQNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLI 1842
            +R+VN+HL ++G +  +  F  D  D  +Y HL ++IAP      +   G          R+ ++++  + L+   F+   D+  G      + KL+LA +A LF N   +L   G      +SV     E  +E   RN++NS  + P+ N L  D +NG++  Q+ D++RPG+    R +  F   R    ++ NC        NY + +G +L         + +   ++   L L+ ++M  Y             +   +KD V WVN++   + +  SI++F D  I++  +  +++DA  P  +D S + +     +++ NAKY I+   K G  IY LPE  VE     +   FA L+
Sbjct:    1 MRWVNYHLERAGTQRRLHNFTSDIVDSEIYTHLLHQIAPNGSGVTLSPLGVHGNVP----RAGAMLDEAEKLDCREFVTATDVAAG------NYKLNLAFVANLF-NKHPNLPDPGADE-VGFSVEDVIEETREEKTYRNWMNSMGVDPYVNWLYADLQNGVVIFQLYDIIRPGMVTWKRVVRTFHKLRGMMDQIQNC--------NYAVELGKQLRFSLVGIQGKDIYDGNQTLTLALVWQLMRAYTLSVLAQCTQSGDSLPADKDIVAWVNEKLKNSGKSTSIRSFQDPAISDGKVVLDLIDAIKPNVIDHSLVKSGKSNEDKMSNAKYAITCGRKIGAKIYALPEDIVEVKPKMVLTVFACLM 346          

HSP 2 Score: 67.781 bits (164), Expect = 8.583e-12
Identity = 63/271 (23.25%), Postives = 124/271 (45.76%), Query Frame = 1
Query:  352 IHEPSERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINRT-PKIMDYTQKIENLSLALNAARCHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGF-DEDFRDCIVYAHLTNRIAPADLKNKMVSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDDLKNGADRKETSAKLHLATLAYLF-RNYSGDL 1155
            I E  E   +  W+N            + +DP  N +Y+ +Q+G+++ +L ++  P ++  + + RT  K+     +I+N + A+   +    +L  I   ++Y+GNQT  L  +WQ+++  +   V       +A   ++G+S+   K+      I+ +VN  L  SG    ++ F D    D  V   L + I P  + + +V SG   ++K S+ + +  I   + + A  + + +D+       E   K+ L   A L  R+Y  D+
Sbjct:  117 IEETREEKTYRNWMNS-----------MGVDPYVNWLYADLQNGVVIFQLYDIIRPGMVTWKRVVRTFHKLRGMMDQIQNCNYAVELGKQLRFSLVGIQGKDIYDGNQTLTLALVWQLMR-AYTLSV-------LAQCTQSGDSLPADKD------IVAWVNEKLKNSGKSTSIRSFQDPAISDGKVVLDLIDAIKPNVIDHSLVKSGKSNEDKMSNAKYA--ITCGRKIGAKIYALPEDI------VEVKPKMVLTVFACLMARDYLPDM 354          
BLAST of Plastin-3 vs. Ensembl Celegans
Match: Y73B3B.1 (pep chromosome:WBcel235:X:209108:211241:-1 gene:WBGene00022223.1 transcript:Y73B3B.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y73B3B.1)

HSP 1 Score: 64.3142 bits (155), Expect = 1.138e-10
Identity = 32/102 (31.37%), Postives = 55/102 (53.92%), Query Frame = 1
Query: 1552 EKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCLDRSCLSN-----NRLQNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLI 1842
            +KD V WVN++   + +  SI++F D  I++  +  +++D+  P  +D S + +     +++ NAKY I+   K G  IY LPE  VE     +   FA L+
Sbjct:  251 DKDIVAWVNEKLKNSGKSTSIRSFQDPAISDGKVVLDLIDSIKPNVIDHSLVKSGKSNEDKMSNAKYAITCGRKIGAKIYALPEDIVEVKPKMVLTVFACLM 352          
BLAST of Plastin-3 vs. Ensembl Fly
Match: Fim (gene:FBgn0024238 transcript:FBtr0074442)

HSP 1 Score: 243.817 bits (621), Expect = 2.572e-71
Identity = 162/533 (30.39%), Postives = 263/533 (49.34%), Query Frame = 1
Query:  328 VATKMTTGIHEPSERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINRTPKIMDYTQKIENLSLALNAARCHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAPADLKNKMVSSGTITKEKFSDMRSSS--IIENLKLLNADAFLIEDDLKNGADRKETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSG-----ECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQRVHNCTKIAKIAENYPLTIGSELD-------PEKMARFDKLTVLGLITEIMITYI---------SKNQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCLD-----RSCLSNNRLQNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLI 1842
            ++++ TT      E+ AFS WIN  L  D D + LLP+D     +Y  ++DG++LCK++N S P  IDERAIN+  K +   ++ ENL+LAL +++  G N+  ID +++  G    +L  LWQII+IG    + +   P +A L    E ++++ ++SP  I++R+VN HL ++G+      F  D  D  +Y+HL  +IA  D      +   +   + SD++S +  +++    LN  +FL   D+ NG        KL+LA +A LF N+ G          KP  + G     E  +E   RN++NS  + P  N L  D  +GL+  Q+ DV++PGI N  R    F   R   +++ NC        NY + +G +L         + +   +    L LI ++M  Y          + N   EK+ V WVN++ S   ++  ++NF D  I +  +  +++DA   G ++      S    + L NAKY IS A K G  +Y LPE   E     +   FA ++
Sbjct:   90 ISSEGTTHSVRLEEQLAFSDWINSNLGHDKDLQHLLPIDSEGKRLYLSIKDGILLCKIINHSCPDTIDERAINK--KNLTVYREFENLTLALVSSQAIGCNIVNIDAHDLAKGKPHLVLGLLWQIIRIGLFSHITLDSCPGLAGLLFDNERLEDLMKMSPEAILLRWVNHHLERAGISRRCTNFQSDIVDSEIYSHLLKQIAGND------ADVNLDALRESDLQSRAEIMLQQAAKLNCRSFLTPQDVVNGV------YKLNLAFVANLFNNHPG--------LDKPEQIEGLESIEETREEKTYRNWMNSMGVAPHVNWLYSDLADGLVIFQLFDVIKPGIVNWSRVHKRFSPLRKFMEKLENC--------NYAVDLGKQLKFSLVGIAGQDLNDGNATLTLALIWQLMRAYTLSILSRLANTGNPIIEKEIVQWVNNRLSEAGKQSQLRNFNDPAIADGKIVIDLIDAIKEGSINYELVRTSGTQEDNLANAKYAISMARKIGARVYALPEDITEVKPKMVMTVFACMM 592          
BLAST of Plastin-3 vs. Ensembl Fly
Match: Fim (gene:FBgn0024238 transcript:FBtr0074441)

HSP 1 Score: 244.202 bits (622), Expect = 2.637e-71
Identity = 162/533 (30.39%), Postives = 263/533 (49.34%), Query Frame = 1
Query:  328 VATKMTTGIHEPSERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINRTPKIMDYTQKIENLSLALNAARCHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAPADLKNKMVSSGTITKEKFSDMRSSS--IIENLKLLNADAFLIEDDLKNGADRKETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSG-----ECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQRVHNCTKIAKIAENYPLTIGSELD-------PEKMARFDKLTVLGLITEIMITYI---------SKNQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCLD-----RSCLSNNRLQNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLI 1842
            ++++ TT      E+ AFS WIN  L  D D + LLP+D     +Y  ++DG++LCK++N S P  IDERAIN+  K +   ++ ENL+LAL +++  G N+  ID +++  G    +L  LWQII+IG    + +   P +A L    E ++++ ++SP  I++R+VN HL ++G+      F  D  D  +Y+HL  +IA  D      +   +   + SD++S +  +++    LN  +FL   D+ NG        KL+LA +A LF N+ G          KP  + G     E  +E   RN++NS  + P  N L  D  +GL+  Q+ DV++PGI N  R    F   R   +++ NC        NY + +G +L         + +   +    L LI ++M  Y          + N   EK+ V WVN++ S   ++  ++NF D  I +  +  +++DA   G ++      S    + L NAKY IS A K G  +Y LPE   E     +   FA ++
Sbjct:  114 ISSEGTTHSVRLEEQLAFSDWINSNLGHDKDLQHLLPIDSEGKRLYLSIKDGILLCKIINHSCPDTIDERAINK--KNLTVYREFENLTLALVSSQAIGCNIVNIDAHDLAKGKPHLVLGLLWQIIRIGLFSHITLDSCPGLAGLLFDNERLEDLMKMSPEAILLRWVNHHLERAGISRRCTNFQSDIVDSEIYSHLLKQIAGND------ADVNLDALRESDLQSRAEIMLQQAAKLNCRSFLTPQDVVNGV------YKLNLAFVANLFNNHPG--------LDKPEQIEGLESIEETREEKTYRNWMNSMGVAPHVNWLYSDLADGLVIFQLFDVIKPGIVNWSRVHKRFSPLRKFMEKLENC--------NYAVDLGKQLKFSLVGIAGQDLNDGNATLTLALIWQLMRAYTLSILSRLANTGNPIIEKEIVQWVNNRLSEAGKQSQLRNFNDPAIADGKIVIDLIDAIKEGSINYELVRTSGTQEDNLANAKYAISMARKIGARVYALPEDITEVKPKMVMTVFACMM 616          
BLAST of Plastin-3 vs. Ensembl Fly
Match: Fim (gene:FBgn0024238 transcript:FBtr0074443)

HSP 1 Score: 243.817 bits (621), Expect = 3.514e-71
Identity = 162/533 (30.39%), Postives = 263/533 (49.34%), Query Frame = 1
Query:  328 VATKMTTGIHEPSERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINRTPKIMDYTQKIENLSLALNAARCHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAPADLKNKMVSSGTITKEKFSDMRSSS--IIENLKLLNADAFLIEDDLKNGADRKETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSG-----ECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQRVHNCTKIAKIAENYPLTIGSELD-------PEKMARFDKLTVLGLITEIMITYI---------SKNQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCLD-----RSCLSNNRLQNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLI 1842
            ++++ TT      E+ AFS WIN  L  D D + LLP+D     +Y  ++DG++LCK++N S P  IDERAIN+  K +   ++ ENL+LAL +++  G N+  ID +++  G    +L  LWQII+IG    + +   P +A L    E ++++ ++SP  I++R+VN HL ++G+      F  D  D  +Y+HL  +IA  D      +   +   + SD++S +  +++    LN  +FL   D+ NG        KL+LA +A LF N+ G          KP  + G     E  +E   RN++NS  + P  N L  D  +GL+  Q+ DV++PGI N  R    F   R   +++ NC        NY + +G +L         + +   +    L LI ++M  Y          + N   EK+ V WVN++ S   ++  ++NF D  I +  +  +++DA   G ++      S    + L NAKY IS A K G  +Y LPE   E     +   FA ++
Sbjct:  115 ISSEGTTHSVRLEEQLAFSDWINSNLGHDKDLQHLLPIDSEGKRLYLSIKDGILLCKIINHSCPDTIDERAINK--KNLTVYREFENLTLALVSSQAIGCNIVNIDAHDLAKGKPHLVLGLLWQIIRIGLFSHITLDSCPGLAGLLFDNERLEDLMKMSPEAILLRWVNHHLERAGISRRCTNFQSDIVDSEIYSHLLKQIAGND------ADVNLDALRESDLQSRAEIMLQQAAKLNCRSFLTPQDVVNGV------YKLNLAFVANLFNNHPG--------LDKPEQIEGLESIEETREEKTYRNWMNSMGVAPHVNWLYSDLADGLVIFQLFDVIKPGIVNWSRVHKRFSPLRKFMEKLENC--------NYAVDLGKQLKFSLVGIAGQDLNDGNATLTLALIWQLMRAYTLSILSRLANTGNPIIEKEIVQWVNNRLSEAGKQSQLRNFNDPAIADGKIVIDLIDAIKEGSINYELVRTSGTQEDNLANAKYAISMARKIGARVYALPEDITEVKPKMVMTVFACMM 617          
BLAST of Plastin-3 vs. Ensembl Zebrafish
Match: pls3 (plastin 3 (T isoform) [Source:ZFIN;Acc:ZDB-GENE-040718-10])

HSP 1 Score: 241.891 bits (616), Expect = 2.048e-70
Identity = 167/520 (32.12%), Postives = 260/520 (50.00%), Query Frame = 1
Query:  367 ERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINRTPKIMDYTQKIENLSLALNAAR---CHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAPADLKNKMVSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDD------LKNGADRKETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLR-PGICNGLRFMTEFDGSRSHPQRVHNC---TKIAKIAENYPLT-IGSELDPEKMARFDKLTVLGLITEIMITYI--------SKNQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCLD-----RSCLSN-NRLQNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLI 1842
            ER AF  WIN  L  DPDC+  LP++PN++ ++  V DG++LCK++NLS+P  IDER IN+  K+  +T + ENL+LALN+A    CH  N+GA+DL E   G    +L  LWQIIKIG   D+ +  +  +A L + GE+++++ +LSP E+++R+ NFHL  +G    +  F  D +D   Y HL N+IAP          G    E   D+  S   E   L  A+  L++ D           D    + KL+LA +A LF  Y   L+    Q      + GE  +E   RN++NS  + P  NHL  D ++ L+  Q+ + ++ P   N       +    ++ +++ NC    ++ K   N+ L  IG     + +   +    L L+ ++M  Y            + N+   V WVN   S+  +   I NF D+ I+      +++DA  P  ++     R  LS+ ++L NAKY +S A K G  +Y LPE  VE     +   FA L+
Sbjct:  121 ERFAFVNWINTALEHDPDCKHKLPMNPNTDALFKAVGDGIVLCKMINLSVPDTIDERTINKK-KLTPFTIQ-ENLNLALNSASAIGCHVVNIGALDLRE---GKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEDLMKLSPEELLLRWANFHLENAGWSK-INNFSHDIKDSRAYFHLLNQIAP---------KGQKDGESRIDIDMSGFTEKDDLKRAECMLLQADKLGCRQFVTSTDVMSGNPKLNLAFVANLFNKYPA-LTKPENQDINWGLLEGETREERTFRNWMNSLGVNPHVNHLYGDLQDALVILQLYEKIKVPVDWNNKVNKPPYPKLGANMKKLENCNYAVELGKTKANFSLVGIGG----QDLNDGNPTLTLALVWQLMRRYTLNVLENLGDGQKVNDDVIVSWVNKTLSQAGKSTKISNFKDKEISSSLAVLDLIDAIQPSSINYDLVKRGSLSDGDKLDNAKYAVSMARKIGARVYALPEDLVEVKPKMVMTVFACLM 620          
BLAST of Plastin-3 vs. Ensembl Zebrafish
Match: pls3 (plastin 3 (T isoform) [Source:ZFIN;Acc:ZDB-GENE-040718-10])

HSP 1 Score: 241.891 bits (616), Expect = 2.048e-70
Identity = 167/520 (32.12%), Postives = 260/520 (50.00%), Query Frame = 1
Query:  367 ERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINRTPKIMDYTQKIENLSLALNAAR---CHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAPADLKNKMVSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDD------LKNGADRKETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLR-PGICNGLRFMTEFDGSRSHPQRVHNC---TKIAKIAENYPLT-IGSELDPEKMARFDKLTVLGLITEIMITYI--------SKNQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCLD-----RSCLSN-NRLQNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLI 1842
            ER AF  WIN  L  DPDC+  LP++PN++ ++  V DG++LCK++NLS+P  IDER IN+  K+  +T + ENL+LALN+A    CH  N+GA+DL E   G    +L  LWQIIKIG   D+ +  +  +A L + GE+++++ +LSP E+++R+ NFHL  +G    +  F  D +D   Y HL N+IAP          G    E   D+  S   E   L  A+  L++ D           D    + KL+LA +A LF  Y   L+    Q      + GE  +E   RN++NS  + P  NHL  D ++ L+  Q+ + ++ P   N       +    ++ +++ NC    ++ K   N+ L  IG     + +   +    L L+ ++M  Y            + N+   V WVN   S+  +   I NF D+ I+      +++DA  P  ++     R  LS+ ++L NAKY +S A K G  +Y LPE  VE     +   FA L+
Sbjct:  121 ERFAFVNWINTALEHDPDCKHKLPMNPNTDALFKAVGDGIVLCKMINLSVPDTIDERTINKK-KLTPFTIQ-ENLNLALNSASAIGCHVVNIGALDLRE---GKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEDLMKLSPEELLLRWANFHLENAGWSK-INNFSHDIKDSRAYFHLLNQIAP---------KGQKDGESRIDIDMSGFTEKDDLKRAECMLLQADKLGCRQFVTSTDVMSGNPKLNLAFVANLFNKYPA-LTKPENQDINWGLLEGETREERTFRNWMNSLGVNPHVNHLYGDLQDALVILQLYEKIKVPVDWNNKVNKPPYPKLGANMKKLENCNYAVELGKTKANFSLVGIGG----QDLNDGNPTLTLALVWQLMRRYTLNVLENLGDGQKVNDDVIVSWVNKTLSQAGKSTKISNFKDKEISSSLAVLDLIDAIQPSSINYDLVKRGSLSDGDKLDNAKYAVSMARKIGARVYALPEDLVEVKPKMVMTVFACLM 620          
BLAST of Plastin-3 vs. Ensembl Zebrafish
Match: pls1 (plastin 1 (I isoform) [Source:ZFIN;Acc:ZDB-GENE-030131-6205])

HSP 1 Score: 241.506 bits (615), Expect = 3.250e-70
Identity = 155/533 (29.08%), Postives = 269/533 (50.47%), Query Frame = 1
Query:  328 VATKMTTGIHEPSERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINR--TPKIMDYTQKIENLSLALNAARCHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAP-ADLKNKM---VSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDDLKNGADRKETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQRVHNCTKIAKIAENYPLTIGSE--------LDPEKMARFDKLTVLGLITEIMITYISK--------NQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCLDRSCL------SNNRLQNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLI 1842
            ++++ T   +   E+ AF  W+N+ LA DPDC+ L+P+DP ++ ++  V+DG++LCK++NLS P  IDER IN+  TP  M      ENL LALN+A   G  +  ID  ++  G    +L  LWQIIKIG   D+ I  +  +  L    E +D +  +SP ++++R+VN+HL  +G +  ++ F ED +D   Y HL N+I+P  DL ++M   +    +T E+  +MR+  ++     L+   F+   D+  G      + KL++A +A LF  Y      T    G  Y++ GE  ++   RN++NS  + P+ NHL  D  +GLI  Q+ + ++  +         +    S+ +++ NC        NY + +G +        +  E +     +  L L+ ++M  Y  K         + +++  ++WVN    + ++  SI +F D+ I+      +++D   P  +    +      + ++L NAKY IS A K G+ +Y LP+  VE     +   FA L+
Sbjct:  110 ISSEGTQHSYSDEEKVAFVNWVNKALANDPDCKHLIPMDPGTDSLFKSVKDGILLCKMINLSQPDTIDERVINKKCTPFTM-----TENLMLALNSASAIGCTVVNIDAQDMKAGTPHLVLGLLWQIIKIGLFADIEISRNEALIALLDESEELDHLMSMSPEDLLLRWVNYHLKAAGWKQ-IRNFSEDIKDSRAYFHLLNQISPKGDLDDQMRIDIDMLGLT-ERDDEMRAELMLRQAARLDCRQFVTPKDVVAG------NHKLNMAFVANLFNMYPALNRPT--DNGIDYAIEGETREDRTFRNWMNSLGVSPYVNHLYSDLHDGLIILQLYERIQIPVDWPRVNKPPYPVLGSNMKKLENC--------NYAVALGKKEAKFSLVGIGGENINEGSPMHTLALVWQLMRRYTLKVLSDLGDGEKVSDQIIINWVNSTLKQGDKNSSISSFKDKSISTSLPVIDLIDTIVPKAIKYEMVKSGDMTAEDKLNNAKYAISVARKIGVKVYALPDDLVEVKPKMVMTVFACLM 619          
BLAST of Plastin-3 vs. Ensembl Zebrafish
Match: pls1 (plastin 1 (I isoform) [Source:ZFIN;Acc:ZDB-GENE-030131-6205])

HSP 1 Score: 241.506 bits (615), Expect = 6.374e-70
Identity = 155/533 (29.08%), Postives = 269/533 (50.47%), Query Frame = 1
Query:  328 VATKMTTGIHEPSERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINR--TPKIMDYTQKIENLSLALNAARCHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAP-ADLKNKM---VSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDDLKNGADRKETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQRVHNCTKIAKIAENYPLTIGSE--------LDPEKMARFDKLTVLGLITEIMITYISK--------NQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCLDRSCL------SNNRLQNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLI 1842
            ++++ T   +   E+ AF  W+N+ LA DPDC+ L+P+DP ++ ++  V+DG++LCK++NLS P  IDER IN+  TP  M      ENL LALN+A   G  +  ID  ++  G    +L  LWQIIKIG   D+ I  +  +  L    E +D +  +SP ++++R+VN+HL  +G +  ++ F ED +D   Y HL N+I+P  DL ++M   +    +T E+  +MR+  ++     L+   F+   D+  G      + KL++A +A LF  Y      T    G  Y++ GE  ++   RN++NS  + P+ NHL  D  +GLI  Q+ + ++  +         +    S+ +++ NC        NY + +G +        +  E +     +  L L+ ++M  Y  K         + +++  ++WVN    + ++  SI +F D+ I+      +++D   P  +    +      + ++L NAKY IS A K G+ +Y LP+  VE     +   FA L+
Sbjct:  147 ISSEGTQHSYSDEEKVAFVNWVNKALANDPDCKHLIPMDPGTDSLFKSVKDGILLCKMINLSQPDTIDERVINKKCTPFTM-----TENLMLALNSASAIGCTVVNIDAQDMKAGTPHLVLGLLWQIIKIGLFADIEISRNEALIALLDESEELDHLMSMSPEDLLLRWVNYHLKAAGWKQ-IRNFSEDIKDSRAYFHLLNQISPKGDLDDQMRIDIDMLGLT-ERDDEMRAELMLRQAARLDCRQFVTPKDVVAG------NHKLNMAFVANLFNMYPALNRPT--DNGIDYAIEGETREDRTFRNWMNSLGVSPYVNHLYSDLHDGLIILQLYERIQIPVDWPRVNKPPYPVLGSNMKKLENC--------NYAVALGKKEAKFSLVGIGGENINEGSPMHTLALVWQLMRRYTLKVLSDLGDGEKVSDQIIINWVNSTLKQGDKNSSISSFKDKSISTSLPVIDLIDTIVPKAIKYEMVKSGDMTAEDKLNNAKYAISVARKIGVKVYALPDDLVEVKPKMVMTVFACLM 656          
BLAST of Plastin-3 vs. Ensembl Zebrafish
Match: lcp1 (lymphocyte cytosolic protein 1 (L-plastin) [Source:NCBI gene;Acc:30583])

HSP 1 Score: 235.343 bits (599), Expect = 5.856e-68
Identity = 159/526 (30.23%), Postives = 265/526 (50.38%), Query Frame = 1
Query:  355 HEPSERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINRTPKIMDYTQKIENLSLALNAAR---CHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAPADLKNKMVS-----SGTITKEKFSDMRSSSIIENLKLLNADAFLIEDDLKNGADRKETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQRVHNCTKIAKIAENYPLTIGSE--------LDPEKMARFDKLTVLGLITEIMITYI--------SKNQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCLDRSCLS------NNRLQNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLI 1842
            +   E+ AF  W+N+ L  DPDC+ +LP+DP+++D+++ V DG++LCK++NLS+P  IDER IN+  K+  +T + ENL+LALN+A    CH  N+GA DL E   G Q  +L  LWQ+IKIG   D+ I  +  +  L + GES++++ +LSP E+++R+ N+HL ++G    +  F  D +D   Y ++ N++AP   +  + +     SG   +EK    R+  ++E    L    F+   D+  G      + KL+LA +A LF  Y   L     Q     S+ GE  +E   RN++NS  + P  NHL VD  + L+  Q+ + ++  +         +    S+ +++ NC        NY + +G +        +  + +   ++   L L+ ++M  Y            +  ++  V WVN+  ++  +  +I  F D  I+      +++DA  PG +    L         +L NAKY IS A K G  +Y LPE  VE     +   FA L+
Sbjct:  116 YSEEEKVAFVNWVNKALEKDPDCQHVLPMDPSTDDLFTAVGDGIVLCKMINLSVPDTIDERTINKK-KLTPFTIQ-ENLNLALNSASAIGCHVVNIGAEDLKE---GRQHLVLGLLWQVIKIGLFADIEISRNEALIALLRDGESLEDLVKLSPEELLLRWANYHLEEAGCPK-INNFSSDIKDSKAYYNILNQVAPKGDEEGIPAIPIDISG--IREKDDLKRAECMLEQADRLGCRQFVTATDVVRG------NPKLNLAYVANLFNKYPA-LKKPENQDIDWSSIEGETREERTFRNWMNSLGVNPRVNHLYVDLADALVIFQLYEKIKVPVDWDKVNKPPYPKLGSNMKKLENC--------NYAVELGKKEAKFSLVGIAGQDLNEGNRTLTLALLWQLMRRYTLNILEDLGDGQKIIDETIVQWVNETLTQAGKG-TISGFKDGSISSSMPVLDLIDAIQPGSIRYDLLKAEDLTDEEKLNNAKYAISMARKIGARVYALPEDLVEVKPKMVMTVFACLM 617          
BLAST of Plastin-3 vs. Ensembl Xenopus
Match: colgalt2 (collagen beta(1-O)galactosyltransferase 2 [Source:Xenbase;Acc:XB-GENE-951226])

HSP 1 Score: 248.054 bits (632), Expect = 4.544e-73
Identity = 165/530 (31.13%), Postives = 266/530 (50.19%), Query Frame = 1
Query:  328 VATKMTTGIHEPSERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINRTPKIMDYTQKIENLSLALNAAR---CHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAPADLKNKMVSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDD------LKNGADRKETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQRVHNCTKIAKIAENYPLTIG-SELDPEKMARFDKLTVLGLITEIMITYI--------SKNQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCL-------DRSCLSNNRLQNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLI 1842
            ++++ T   +   E+ AF  WIN+ L  DPDC+ +LP++PN+ND++  V DG++LCK++NLS+P  IDER IN+  K+  +T + ENL+LALN+A    CH  N+GA DL     G     L  LWQ+IKIG   D+ +  +  +A L + GE+++++ +LSP E+++R+ NFHL  +G +  +  F  D +D   Y HL N+IAP          G    E+  D+  S   E   L  A+  L + D          AD    + KL+LA +A LF  Y   L+    Q      + GE  +E   RN++NS  + P  NHL  D ++ L+  Q+ D ++  +         +    ++ +++ NC    ++ + YP       +  + +   +    L L+ ++M  Y            + N++  V+WVN   +   ++ SIQNF D+ I       +++DA  PGC+       D      ++ +NAKY IS A + G  IY LPE  VE     +   FA L+
Sbjct:   49 LSSEGTQHSYSEEEKYAFVNWINKALENDPDCKHVLPMNPNTNDLFRAVGDGIVLCKMINLSVPDTIDERVINKK-KLTPFTIQ-ENLNLALNSASAIGCHVVNIGAEDLKA---GKPHLALGLLWQVIKIGLFADIELSRNEALAALLRDGETLEDLMKLSPEELLLRWANFHLENAGWQK-ISNFSSDIKDSRAYFHLLNQIAP---------KGQKEGEERIDINMSGFSEKDDLKRAEYMLQQADRLGCRQFVTPADVVSGNPKLNLAFVANLFNKYPA-LTKPVNQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYNDLQDALVILQLYDKIKVPVDWNKVNKPPYPKLGANMKKLENCNYAVELGK-YPAKFSLVGIGGQDLNDGNPTLTLALVWQVMRRYTLNVLECLGEGQKVNDEIIVNWVNRTLADAGKKTSIQNFKDKTICTSFAVVDLIDAIQPGCINYELVKSDDGLTDEDKHENAKYAISMARRIGTRIYALPEDLVEVKPKMVMTVFACLM 561          
BLAST of Plastin-3 vs. Ensembl Xenopus
Match: colgalt2 (collagen beta(1-O)galactosyltransferase 2 [Source:Xenbase;Acc:XB-GENE-951226])

HSP 1 Score: 248.054 bits (632), Expect = 1.361e-72
Identity = 165/530 (31.13%), Postives = 266/530 (50.19%), Query Frame = 1
Query:  328 VATKMTTGIHEPSERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINRTPKIMDYTQKIENLSLALNAAR---CHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAPADLKNKMVSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDD------LKNGADRKETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQRVHNCTKIAKIAENYPLTIG-SELDPEKMARFDKLTVLGLITEIMITYI--------SKNQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCL-------DRSCLSNNRLQNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLI 1842
            ++++ T   +   E+ AF  WIN+ L  DPDC+ +LP++PN+ND++  V DG++LCK++NLS+P  IDER IN+  K+  +T + ENL+LALN+A    CH  N+GA DL     G     L  LWQ+IKIG   D+ +  +  +A L + GE+++++ +LSP E+++R+ NFHL  +G +  +  F  D +D   Y HL N+IAP          G    E+  D+  S   E   L  A+  L + D          AD    + KL+LA +A LF  Y   L+    Q      + GE  +E   RN++NS  + P  NHL  D ++ L+  Q+ D ++  +         +    ++ +++ NC    ++ + YP       +  + +   +    L L+ ++M  Y            + N++  V+WVN   +   ++ SIQNF D+ I       +++DA  PGC+       D      ++ +NAKY IS A + G  IY LPE  VE     +   FA L+
Sbjct:  106 LSSEGTQHSYSEEEKYAFVNWINKALENDPDCKHVLPMNPNTNDLFRAVGDGIVLCKMINLSVPDTIDERVINKK-KLTPFTIQ-ENLNLALNSASAIGCHVVNIGAEDLKA---GKPHLALGLLWQVIKIGLFADIELSRNEALAALLRDGETLEDLMKLSPEELLLRWANFHLENAGWQK-ISNFSSDIKDSRAYFHLLNQIAP---------KGQKEGEERIDINMSGFSEKDDLKRAEYMLQQADRLGCRQFVTPADVVSGNPKLNLAFVANLFNKYPA-LTKPVNQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYNDLQDALVILQLYDKIKVPVDWNKVNKPPYPKLGANMKKLENCNYAVELGK-YPAKFSLVGIGGQDLNDGNPTLTLALVWQVMRRYTLNVLECLGEGQKVNDEIIVNWVNRTLADAGKKTSIQNFKDKTICTSFAVVDLIDAIQPGCINYELVKSDDGLTDEDKHENAKYAISMARRIGTRIYALPEDLVEVKPKMVMTVFACLM 618          
BLAST of Plastin-3 vs. Ensembl Xenopus
Match: colgalt2 (collagen beta(1-O)galactosyltransferase 2 [Source:Xenbase;Acc:XB-GENE-951226])

HSP 1 Score: 248.054 bits (632), Expect = 1.452e-72
Identity = 165/530 (31.13%), Postives = 266/530 (50.19%), Query Frame = 1
Query:  328 VATKMTTGIHEPSERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINRTPKIMDYTQKIENLSLALNAAR---CHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAPADLKNKMVSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDD------LKNGADRKETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQRVHNCTKIAKIAENYPLTIG-SELDPEKMARFDKLTVLGLITEIMITYI--------SKNQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCL-------DRSCLSNNRLQNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLI 1842
            ++++ T   +   E+ AF  WIN+ L  DPDC+ +LP++PN+ND++  V DG++LCK++NLS+P  IDER IN+  K+  +T + ENL+LALN+A    CH  N+GA DL     G     L  LWQ+IKIG   D+ +  +  +A L + GE+++++ +LSP E+++R+ NFHL  +G +  +  F  D +D   Y HL N+IAP          G    E+  D+  S   E   L  A+  L + D          AD    + KL+LA +A LF  Y   L+    Q      + GE  +E   RN++NS  + P  NHL  D ++ L+  Q+ D ++  +         +    ++ +++ NC    ++ + YP       +  + +   +    L L+ ++M  Y            + N++  V+WVN   +   ++ SIQNF D+ I       +++DA  PGC+       D      ++ +NAKY IS A + G  IY LPE  VE     +   FA L+
Sbjct:  112 LSSEGTQHSYSEEEKYAFVNWINKALENDPDCKHVLPMNPNTNDLFRAVGDGIVLCKMINLSVPDTIDERVINKK-KLTPFTIQ-ENLNLALNSASAIGCHVVNIGAEDLKA---GKPHLALGLLWQVIKIGLFADIELSRNEALAALLRDGETLEDLMKLSPEELLLRWANFHLENAGWQK-ISNFSSDIKDSRAYFHLLNQIAP---------KGQKEGEERIDINMSGFSEKDDLKRAEYMLQQADRLGCRQFVTPADVVSGNPKLNLAFVANLFNKYPA-LTKPVNQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYNDLQDALVILQLYDKIKVPVDWNKVNKPPYPKLGANMKKLENCNYAVELGK-YPAKFSLVGIGGQDLNDGNPTLTLALVWQVMRRYTLNVLECLGEGQKVNDEIIVNWVNRTLADAGKKTSIQNFKDKTICTSFAVVDLIDAIQPGCINYELVKSDDGLTDEDKHENAKYAISMARRIGTRIYALPEDLVEVKPKMVMTVFACLM 624          
BLAST of Plastin-3 vs. Ensembl Xenopus
Match: colgalt2 (collagen beta(1-O)galactosyltransferase 2 [Source:Xenbase;Acc:XB-GENE-951226])

HSP 1 Score: 248.054 bits (632), Expect = 1.543e-72
Identity = 165/530 (31.13%), Postives = 266/530 (50.19%), Query Frame = 1
Query:  328 VATKMTTGIHEPSERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINRTPKIMDYTQKIENLSLALNAAR---CHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAPADLKNKMVSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDD------LKNGADRKETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQRVHNCTKIAKIAENYPLTIG-SELDPEKMARFDKLTVLGLITEIMITYI--------SKNQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCL-------DRSCLSNNRLQNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLI 1842
            ++++ T   +   E+ AF  WIN+ L  DPDC+ +LP++PN+ND++  V DG++LCK++NLS+P  IDER IN+  K+  +T + ENL+LALN+A    CH  N+GA DL     G     L  LWQ+IKIG   D+ +  +  +A L + GE+++++ +LSP E+++R+ NFHL  +G +  +  F  D +D   Y HL N+IAP          G    E+  D+  S   E   L  A+  L + D          AD    + KL+LA +A LF  Y   L+    Q      + GE  +E   RN++NS  + P  NHL  D ++ L+  Q+ D ++  +         +    ++ +++ NC    ++ + YP       +  + +   +    L L+ ++M  Y            + N++  V+WVN   +   ++ SIQNF D+ I       +++DA  PGC+       D      ++ +NAKY IS A + G  IY LPE  VE     +   FA L+
Sbjct:  111 LSSEGTQHSYSEEEKYAFVNWINKALENDPDCKHVLPMNPNTNDLFRAVGDGIVLCKMINLSVPDTIDERVINKK-KLTPFTIQ-ENLNLALNSASAIGCHVVNIGAEDLKA---GKPHLALGLLWQVIKIGLFADIELSRNEALAALLRDGETLEDLMKLSPEELLLRWANFHLENAGWQK-ISNFSSDIKDSRAYFHLLNQIAP---------KGQKEGEERIDINMSGFSEKDDLKRAEYMLQQADRLGCRQFVTPADVVSGNPKLNLAFVANLFNKYPA-LTKPVNQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYNDLQDALVILQLYDKIKVPVDWNKVNKPPYPKLGANMKKLENCNYAVELGK-YPAKFSLVGIGGQDLNDGNPTLTLALVWQVMRRYTLNVLECLGEGQKVNDEIIVNWVNRTLADAGKKTSIQNFKDKTICTSFAVVDLIDAIQPGCINYELVKSDDGLTDEDKHENAKYAISMARRIGTRIYALPEDLVEVKPKMVMTVFACLM 623          
BLAST of Plastin-3 vs. Ensembl Xenopus
Match: colgalt2 (collagen beta(1-O)galactosyltransferase 2 [Source:Xenbase;Acc:XB-GENE-951226])

HSP 1 Score: 248.054 bits (632), Expect = 1.559e-72
Identity = 165/530 (31.13%), Postives = 266/530 (50.19%), Query Frame = 1
Query:  328 VATKMTTGIHEPSERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINRTPKIMDYTQKIENLSLALNAAR---CHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAPADLKNKMVSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDD------LKNGADRKETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQRVHNCTKIAKIAENYPLTIG-SELDPEKMARFDKLTVLGLITEIMITYI--------SKNQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCL-------DRSCLSNNRLQNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLI 1842
            ++++ T   +   E+ AF  WIN+ L  DPDC+ +LP++PN+ND++  V DG++LCK++NLS+P  IDER IN+  K+  +T + ENL+LALN+A    CH  N+GA DL     G     L  LWQ+IKIG   D+ +  +  +A L + GE+++++ +LSP E+++R+ NFHL  +G +  +  F  D +D   Y HL N+IAP          G    E+  D+  S   E   L  A+  L + D          AD    + KL+LA +A LF  Y   L+    Q      + GE  +E   RN++NS  + P  NHL  D ++ L+  Q+ D ++  +         +    ++ +++ NC    ++ + YP       +  + +   +    L L+ ++M  Y            + N++  V+WVN   +   ++ SIQNF D+ I       +++DA  PGC+       D      ++ +NAKY IS A + G  IY LPE  VE     +   FA L+
Sbjct:  110 LSSEGTQHSYSEEEKYAFVNWINKALENDPDCKHVLPMNPNTNDLFRAVGDGIVLCKMINLSVPDTIDERVINKK-KLTPFTIQ-ENLNLALNSASAIGCHVVNIGAEDLKA---GKPHLALGLLWQVIKIGLFADIELSRNEALAALLRDGETLEDLMKLSPEELLLRWANFHLENAGWQK-ISNFSSDIKDSRAYFHLLNQIAP---------KGQKEGEERIDINMSGFSEKDDLKRAEYMLQQADRLGCRQFVTPADVVSGNPKLNLAFVANLFNKYPA-LTKPVNQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYNDLQDALVILQLYDKIKVPVDWNKVNKPPYPKLGANMKKLENCNYAVELGK-YPAKFSLVGIGGQDLNDGNPTLTLALVWQVMRRYTLNVLECLGEGQKVNDEIIVNWVNRTLADAGKKTSIQNFKDKTICTSFAVVDLIDAIQPGCINYELVKSDDGLTDEDKHENAKYAISMARRIGTRIYALPEDLVEVKPKMVMTVFACLM 622          
BLAST of Plastin-3 vs. Ensembl Mouse
Match: Pls3 (plastin 3 (T-isoform) [Source:MGI Symbol;Acc:MGI:104807])

HSP 1 Score: 249.595 bits (636), Expect = 3.724e-73
Identity = 164/531 (30.89%), Postives = 265/531 (49.91%), Query Frame = 1
Query:  328 VATKMTTGIHEPSERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINR---TPKIMDYTQKIENLSLALNAAR---CHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAPADLKNKMVSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDD------LKNGADRKETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQRVHNCTKIAKIAENYPLTIGSELDPEKMARFDKLTVLGLITEIMITYI--------SKNQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCLDRSCLSNNRL------QNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLI 1842
            ++++ T   +   E+ AF  WIN+ L  DPDCR ++P++PN++D++  V DG++LCK++NLS+P  IDERAIN+   TP I+      ENL+LALN+A    CH  N+GA DL     G    +L  LWQIIKIG   D+ +  +  +A L + GE+++E+ +LSP E+++R+ NFHL  SG +  +  F  D +D   Y HL N+IAP          G    E   D+  S   E   L  A++ L + D          AD    + KL+LA +A LF  Y   L+    Q      + GE  +E   RN++NS  + P  NHL  D ++ L+  Q+ + ++  +         +    ++ +++ NC    ++ +N        +  + +   +    L ++ ++M  Y            + N+   V+WVN   S   +  SIQ+F D+ I+      +++DA  PGC++   + +  L       NAKY +S A + G  +Y LPE  VE     +   FA L+
Sbjct:  112 LSSEGTQHSYSEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAINKKKLTPFIIQ-----ENLNLALNSASAIGCHVVNIGAEDLRA---GKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLENSGWQK-INNFSADIKDSKAYFHLLNQIAP---------KGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVVSGNPKLNLAFVANLFNKYPA-LTKPENQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYADLQDALVILQLYERIKVPVDWSKVNKPPYPKLGANMKKLENCNYAVELGKNPAKFSLVGIGGQDLNDGNPTLTLAVVWQLMRRYTLNVLEDLGEGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGNLTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLM 623          
BLAST of Plastin-3 vs. Ensembl Mouse
Match: Pls3 (plastin 3 (T-isoform) [Source:MGI Symbol;Acc:MGI:104807])

HSP 1 Score: 249.21 bits (635), Expect = 3.844e-73
Identity = 164/531 (30.89%), Postives = 265/531 (49.91%), Query Frame = 1
Query:  328 VATKMTTGIHEPSERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINR---TPKIMDYTQKIENLSLALNAAR---CHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAPADLKNKMVSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDD------LKNGADRKETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQRVHNCTKIAKIAENYPLTIGSELDPEKMARFDKLTVLGLITEIMITYI--------SKNQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCLDRSCLSNNRL------QNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLI 1842
            ++++ T   +   E+ AF  WIN+ L  DPDCR ++P++PN++D++  V DG++LCK++NLS+P  IDERAIN+   TP I+      ENL+LALN+A    CH  N+GA DL     G    +L  LWQIIKIG   D+ +  +  +A L + GE+++E+ +LSP E+++R+ NFHL  SG +  +  F  D +D   Y HL N+IAP          G    E   D+  S   E   L  A++ L + D          AD    + KL+LA +A LF  Y   L+    Q      + GE  +E   RN++NS  + P  NHL  D ++ L+  Q+ + ++  +         +    ++ +++ NC    ++ +N        +  + +   +    L ++ ++M  Y            + N+   V+WVN   S   +  SIQ+F D+ I+      +++DA  PGC++   + +  L       NAKY +S A + G  +Y LPE  VE     +   FA L+
Sbjct:  112 LSSEGTQHSYSEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAINKKKLTPFIIQ-----ENLNLALNSASAIGCHVVNIGAEDLRA---GKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLENSGWQK-INNFSADIKDSKAYFHLLNQIAP---------KGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVVSGNPKLNLAFVANLFNKYPA-LTKPENQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYADLQDALVILQLYERIKVPVDWSKVNKPPYPKLGANMKKLENCNYAVELGKNPAKFSLVGIGGQDLNDGNPTLTLAVVWQLMRRYTLNVLEDLGEGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGNLTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLM 623          
BLAST of Plastin-3 vs. Ensembl Mouse
Match: Pls3 (plastin 3 (T-isoform) [Source:MGI Symbol;Acc:MGI:104807])

HSP 1 Score: 249.21 bits (635), Expect = 3.844e-73
Identity = 164/531 (30.89%), Postives = 265/531 (49.91%), Query Frame = 1
Query:  328 VATKMTTGIHEPSERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINR---TPKIMDYTQKIENLSLALNAAR---CHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAPADLKNKMVSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDD------LKNGADRKETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQRVHNCTKIAKIAENYPLTIGSELDPEKMARFDKLTVLGLITEIMITYI--------SKNQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCLDRSCLSNNRL------QNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLI 1842
            ++++ T   +   E+ AF  WIN+ L  DPDCR ++P++PN++D++  V DG++LCK++NLS+P  IDERAIN+   TP I+      ENL+LALN+A    CH  N+GA DL     G    +L  LWQIIKIG   D+ +  +  +A L + GE+++E+ +LSP E+++R+ NFHL  SG +  +  F  D +D   Y HL N+IAP          G    E   D+  S   E   L  A++ L + D          AD    + KL+LA +A LF  Y   L+    Q      + GE  +E   RN++NS  + P  NHL  D ++ L+  Q+ + ++  +         +    ++ +++ NC    ++ +N        +  + +   +    L ++ ++M  Y            + N+   V+WVN   S   +  SIQ+F D+ I+      +++DA  PGC++   + +  L       NAKY +S A + G  +Y LPE  VE     +   FA L+
Sbjct:  112 LSSEGTQHSYSEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAINKKKLTPFIIQ-----ENLNLALNSASAIGCHVVNIGAEDLRA---GKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLENSGWQK-INNFSADIKDSKAYFHLLNQIAP---------KGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVVSGNPKLNLAFVANLFNKYPA-LTKPENQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYADLQDALVILQLYERIKVPVDWSKVNKPPYPKLGANMKKLENCNYAVELGKNPAKFSLVGIGGQDLNDGNPTLTLAVVWQLMRRYTLNVLEDLGEGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGNLTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLM 623          
BLAST of Plastin-3 vs. Ensembl Mouse
Match: Pls3 (plastin 3 (T-isoform) [Source:MGI Symbol;Acc:MGI:104807])

HSP 1 Score: 249.21 bits (635), Expect = 3.844e-73
Identity = 164/531 (30.89%), Postives = 265/531 (49.91%), Query Frame = 1
Query:  328 VATKMTTGIHEPSERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINR---TPKIMDYTQKIENLSLALNAAR---CHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAPADLKNKMVSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDD------LKNGADRKETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQRVHNCTKIAKIAENYPLTIGSELDPEKMARFDKLTVLGLITEIMITYI--------SKNQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCLDRSCLSNNRL------QNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLI 1842
            ++++ T   +   E+ AF  WIN+ L  DPDCR ++P++PN++D++  V DG++LCK++NLS+P  IDERAIN+   TP I+      ENL+LALN+A    CH  N+GA DL     G    +L  LWQIIKIG   D+ +  +  +A L + GE+++E+ +LSP E+++R+ NFHL  SG +  +  F  D +D   Y HL N+IAP          G    E   D+  S   E   L  A++ L + D          AD    + KL+LA +A LF  Y   L+    Q      + GE  +E   RN++NS  + P  NHL  D ++ L+  Q+ + ++  +         +    ++ +++ NC    ++ +N        +  + +   +    L ++ ++M  Y            + N+   V+WVN   S   +  SIQ+F D+ I+      +++DA  PGC++   + +  L       NAKY +S A + G  +Y LPE  VE     +   FA L+
Sbjct:  112 LSSEGTQHSYSEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAINKKKLTPFIIQ-----ENLNLALNSASAIGCHVVNIGAEDLRA---GKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLENSGWQK-INNFSADIKDSKAYFHLLNQIAP---------KGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVVSGNPKLNLAFVANLFNKYPA-LTKPENQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYADLQDALVILQLYERIKVPVDWSKVNKPPYPKLGANMKKLENCNYAVELGKNPAKFSLVGIGGQDLNDGNPTLTLAVVWQLMRRYTLNVLEDLGEGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGNLTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLM 623          
BLAST of Plastin-3 vs. Ensembl Mouse
Match: Pls3 (plastin 3 (T-isoform) [Source:MGI Symbol;Acc:MGI:104807])

HSP 1 Score: 243.047 bits (619), Expect = 1.217e-70
Identity = 163/539 (30.24%), Postives = 265/539 (49.17%), Query Frame = 1
Query:  328 VATKMTTGIHEPSERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINR---TPKIMDYTQKIENLSLALNAAR---CHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHM--------VKGFDEDFRDCIVYAHLTNRIAPADLKNKMVSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDD------LKNGADRKETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQRVHNCTKIAKIAENYPLTIGSELDPEKMARFDKLTVLGLITEIMITYI--------SKNQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCLDRSCLSNNRL------QNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLI 1842
            ++++ T   +   E+ AF  WIN+ L  DPDCR ++P++PN++D++  V DG++LCK++NLS+P  IDERAIN+   TP I+      ENL+LALN+A    CH  N+GA DL     G    +L  LWQIIKIG   D+ +  +  +A L + GE+++E+ +LSP E+++R+ NFHL  SG + +        +  F    +D   Y HL N+IAP          G    E   D+  S   E   L  A++ L + D          AD    + KL+LA +A LF  Y   L+    Q      + GE  +E   RN++NS  + P  NHL  D ++ L+  Q+ + ++  +         +    ++ +++ NC    ++ +N        +  + +   +    L ++ ++M  Y            + N+   V+WVN   S   +  SIQ+F D+ I+      +++DA  PGC++   + +  L       NAKY +S A + G  +Y LPE  VE     +   FA L+
Sbjct:  112 LSSEGTQHSYSEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAINKKKLTPFIIQ-----ENLNLALNSASAIGCHVVNIGAEDLRA---GKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLENSGWQKINNFSADIKLIDFSNSVKDSKAYFHLLNQIAP---------KGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVVSGNPKLNLAFVANLFNKYPA-LTKPENQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYADLQDALVILQLYERIKVPVDWSKVNKPPYPKLGANMKKLENCNYAVELGKNPAKFSLVGIGGQDLNDGNPTLTLAVVWQLMRRYTLNVLEDLGEGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGNLTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLM 632          
BLAST of Plastin-3 vs. UniProt/SwissProt
Match: sp|Q63598|PLST_RAT (Plastin-3 OS=Rattus norvegicus OX=10116 GN=Pls3 PE=1 SV=2)

HSP 1 Score: 251.136 bits (640), Expect = 6.031e-73
Identity = 166/531 (31.26%), Postives = 266/531 (50.09%), Query Frame = 1
Query:  328 VATKMTTGIHEPSERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINR---TPKIMDYTQKIENLSLALNAAR---CHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAPADLKNKMVSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDD------LKNGADRKETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQRVHNCTKIAKIAENYPLTIGSELDPEKMARFDKLTVLGLITEIMITY-------ISKNQWNEKD-AVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCLDRSCLSNNRL------QNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLI 1842
            ++++ T   +   E+ AF  WIN+ L  DPDCR ++P++PN++D++  V DG++LCK++NLS+P  IDERAIN+   TP I+      ENL+LALN+A    CH  N+GA DL     G    +L  LWQIIKIG   D+ +  +  +A L + GE+++E+ +LSP E+++R+ NFHL  SG +  +  F  D +D   Y HL N+IAP          G    E   D+  S   E   L  A++ L + D          AD    + KL+LA +A LF  Y   L+    Q      + GE  +E   RN++NS  + P  NHL VD ++ L+  Q+ + ++  +         +    ++ +++ NC    ++ +N        +  + +   +    L ++ ++M  Y       + + Q    D  V+WVN   S   +  SIQ+F D+ I+      +++DA  PGC++   +    L       NAKY +S A + G  +Y LPE  VE     +   FA L+
Sbjct:  112 LSSEGTQHSYSEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAINKKKLTPFIIQ-----ENLNLALNSASAIGCHVVNIGAEDLRA---GKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLENSGWQK-INNFSADIKDSKAYFHLLNQIAP---------KGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVVSGNPKLNLAFVANLFNKYPA-LTKPENQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYVDLQDALVILQLYERIKVPVDWSKVNKPPYPKLGANMKKLENCNYAVELGKNQAKFSLVGIGGQDLNDGNPTLTLAVVWQLMRRYTLNVMEDLGEGQKATDDIIVNWVNGTLSEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKTGNLTEEDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLM 623          
BLAST of Plastin-3 vs. UniProt/SwissProt
Match: sp|P13797|PLST_HUMAN (Plastin-3 OS=Homo sapiens OX=9606 GN=PLS3 PE=1 SV=4)

HSP 1 Score: 249.98 bits (637), Expect = 1.799e-72
Identity = 164/531 (30.89%), Postives = 266/531 (50.09%), Query Frame = 1
Query:  328 VATKMTTGIHEPSERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINR---TPKIMDYTQKIENLSLALNAAR---CHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAPADLKNKMVSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDD------LKNGADRKETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQRVHNCTKIAKIAENYPLTIGSELDPEKMARFDKLTVLGLITEIMITYI--------SKNQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCLDRSCLSNNRL------QNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLI 1842
            ++++ T   +   E+ AF  WIN+ L  DPDCR ++P++PN++D++  V DG++LCK++NLS+P  IDERAIN+   TP I+      ENL+LALN+A    CH  N+GA DL     G    +L  LWQIIKIG   D+ +  +  +A L + GE+++E+ +LSP E+++R+ NFHL  SG +  +  F  D +D   Y HL N+IAP          G    E   D+  S   E   L  A++ L + D          AD    + KL+LA +A LF  Y   L+    Q      + GE  +E   RN++NS  + P  NHL  D ++ L+  Q+ + ++  +         +    ++ +++ NC    ++ ++        +  + +   ++   L L+ ++M  Y            + N+   V+WVN   S   +  SIQ+F D+ I+      +++DA  PGC++   + +  L       NAKY +S A + G  +Y LPE  VE     +   FA L+
Sbjct:  112 LSSEGTQHSYSEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAINKKKLTPFIIQ-----ENLNLALNSASAIGCHVVNIGAEDLRA---GKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLENSGWQK-INNFSADIKDSKAYFHLLNQIAP---------KGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVVSGNPKLNLAFVANLFNKYPA-LTKPENQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYADLQDALVILQLYERIKVPVDWSKVNKPPYPKLGANMKKLENCNYAVELGKHPAKFSLVGIGGQDLNDGNQTLTLALVWQLMRRYTLNVLEDLGDGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGNLTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLM 623          
BLAST of Plastin-3 vs. UniProt/SwissProt
Match: sp|Q99K51|PLST_MOUSE (Plastin-3 OS=Mus musculus OX=10090 GN=Pls3 PE=1 SV=3)

HSP 1 Score: 249.21 bits (635), Expect = 2.689e-72
Identity = 164/531 (30.89%), Postives = 265/531 (49.91%), Query Frame = 1
Query:  328 VATKMTTGIHEPSERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINR---TPKIMDYTQKIENLSLALNAAR---CHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAPADLKNKMVSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDD------LKNGADRKETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQRVHNCTKIAKIAENYPLTIGSELDPEKMARFDKLTVLGLITEIMITYI--------SKNQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCLDRSCLSNNRL------QNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLI 1842
            ++++ T   +   E+ AF  WIN+ L  DPDCR ++P++PN++D++  V DG++LCK++NLS+P  IDERAIN+   TP I+      ENL+LALN+A    CH  N+GA DL     G    +L  LWQIIKIG   D+ +  +  +A L + GE+++E+ +LSP E+++R+ NFHL  SG +  +  F  D +D   Y HL N+IAP          G    E   D+  S   E   L  A++ L + D          AD    + KL+LA +A LF  Y   L+    Q      + GE  +E   RN++NS  + P  NHL  D ++ L+  Q+ + ++  +         +    ++ +++ NC    ++ +N        +  + +   +    L ++ ++M  Y            + N+   V+WVN   S   +  SIQ+F D+ I+      +++DA  PGC++   + +  L       NAKY +S A + G  +Y LPE  VE     +   FA L+
Sbjct:  112 LSSEGTQHSYSEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAINKKKLTPFIIQ-----ENLNLALNSASAIGCHVVNIGAEDLRA---GKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLENSGWQK-INNFSADIKDSKAYFHLLNQIAP---------KGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVVSGNPKLNLAFVANLFNKYPA-LTKPENQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYADLQDALVILQLYERIKVPVDWSKVNKPPYPKLGANMKKLENCNYAVELGKNPAKFSLVGIGGQDLNDGNPTLTLAVVWQLMRRYTLNVLEDLGEGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGNLTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLM 623          
BLAST of Plastin-3 vs. UniProt/SwissProt
Match: sp|A7E3Q8|PLST_BOVIN (Plastin-3 OS=Bos taurus OX=9913 GN=PLS3 PE=2 SV=1)

HSP 1 Score: 247.669 bits (631), Expect = 1.069e-71
Identity = 163/531 (30.70%), Postives = 265/531 (49.91%), Query Frame = 1
Query:  328 VATKMTTGIHEPSERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINR---TPKIMDYTQKIENLSLALNAAR---CHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAPADLKNKMVSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDD------LKNGADRKETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQRVHNCTKIAKIAENYPLTIGSELDPEKMARFDKLTVLGLITEIMITYI--------SKNQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCLDRSCLSNNRL------QNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLI 1842
            ++++ T   +   E+ AF  WIN+ L  DPDCR ++P++PN++D++  V DG++LCK++NLS+P  IDERAIN+   TP I+      ENL+LALN+A    CH  N+GA DL     G    +L  LWQIIKIG   D+ +  +  +A L + GE+++E+ +LSP E+++R+ NFHL  SG +  +  F  D +D   Y HL N+IAP          G    E   D+  S   E   L  A++ L + D          AD    + KL+LA +A LF  Y   L+    Q      + GE  +E   RN++NS  + P  NHL  D ++ L+  Q+ + ++  +         +    ++ +++ NC    ++ ++        +  + +   ++   L L+ ++M  Y            + N+   V WVN   +   +  SIQ+F D+ I+      +++DA  PGC++   + +  L       NAKY +S A + G  +Y LPE  VE     +   FA L+
Sbjct:  112 LSSEGTQHSYSEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAINKKKLTPFIIQ-----ENLNLALNSASAIGCHVVNIGAEDLRA---GKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLENSGWQK-INNFSADIKDSKAYFHLLNQIAP---------KGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVVSGNPKLNLAFVANLFNKYPA-LTKPENQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYADLQDALVILQLYERIKVPVDWSKVNKPPYPKLGANMKKLENCNYAVELGKHPAKFSLVGIGGQDLNDGNQTLTLALVWQLMRRYTLNVLEDLGDGQKANDDIIVSWVNRTLNEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGTLTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLM 623          
BLAST of Plastin-3 vs. UniProt/SwissProt
Match: sp|O88818|PLST_CRIGR (Plastin-3 OS=Cricetulus griseus OX=10029 GN=PLS3 PE=2 SV=3)

HSP 1 Score: 247.669 bits (631), Expect = 1.185e-71
Identity = 163/531 (30.70%), Postives = 265/531 (49.91%), Query Frame = 1
Query:  328 VATKMTTGIHEPSERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINR---TPKIMDYTQKIENLSLALNAAR---CHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAPADLKNKMVSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDD------LKNGADRKETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQRVHNCTKIAKIAENYPLTIGSELDPEKMARFDKLTVLGLITEIMITYI--------SKNQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCLDRSCLSNNRL------QNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLI 1842
            ++++ T   +   E+ AF  WIN+ L  DPDCR ++P++PN++D++  V DG++LCK++NLS+P  IDERAIN+   TP I+      ENL+LALN+A    CH  N+GA DL     G    +L  LWQIIKIG   D+ +  +  +A L + GE+++E+ +LSP E+++R+ NFHL  SG +  +  F  D +D   Y HL N+IAP          G    E   D+  S   E   L  A++ L + D          AD    + KL+LA +A LF  Y   L+    Q      + GE  +E   RN++NS  + P  NHL  D ++ L+  Q+ + ++  +         +    ++ +++ NC    ++ ++        +  + +   +    L ++ ++M  Y            + N+   V+WVN   S   +  SIQ+F D+ I+      +++DA  PGC++   + +  L       NAKY +S A + G  +Y LPE  VE     +   FA L+
Sbjct:  112 LSSEGTQHSYSEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDERAINKKKLTPFIIQ-----ENLNLALNSASAIGCHVVNIGAEDLRA---GKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLENSGWQK-INNFSADIKDSKAYFHLLNQIAP---------KGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVVSGNPKLNLAFVANLFNKYPA-LTKPENQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLYADLQDALVILQLYERIKVPVDWSKVNKPPYPKLGANMKKLENCNYAVELGKHPAKFSLVGIGGQDLNDGNPTLTLAVVWQLMRRYTLNVLEDLGEGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGNLTEDDKHNNAKYAVSMARRIGARVYALPEDLVEVKPKMVMTVFACLM 623          
BLAST of Plastin-3 vs. TrEMBL
Match: A0A504YR62 (Plastin-1 OS=Fasciola gigantica OX=46835 GN=FGIG_08553 PE=4 SV=1)

HSP 1 Score: 391.734 bits (1005), Expect = 1.524e-125
Identity = 190/504 (37.70%), Postives = 310/504 (61.51%), Query Frame = 1
Query:  337 KMTTGIHEPSERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINRTPKIMDYTQKIENLSLALNAARCHGANLGAIDLNEVYNGN---QTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAPADLKNKMVSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDDLKNGADRKETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQRVHNCTKIAKIAENYPLTIGSELDPEKMARFDKLTVLGLITEIMITYISKNQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCLDRSCLSNNRLQNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANL 1839
            K    I+E  E+ A+ R+IN+ L  DPDCR  LPLDP ++D+Y   ++G++LCKLVN++ PR IDERA+++   I   +Q ++N+ LAL AA+C+G  +    ++++ N +   +  ILE +WQII+ GF + +N+H HPE+  LK   E + ++K + P ++++RYVN+HL   G+   +     +  DC++YAHL   IAP  ++ +++SS  +  +   + R+ ++++NL+ + AD FL  +D  +     E+ A+LHLAT+AYLF  + G+L +       P     E + E   RNF+NS  + PF+ H+  + R+GL+  Q+ +VLR G   GL+F+ EF   R   Q ++N T I ++ + YPL +   LD EK++R D+   L ++ EI+  YI+++ ++E + + W N+Q  R  R + +++F DR+I E+NLFA +L+    G  D   L++ +L NA Y IS A KAG P+YT PEHFV  N  F+++AFA L
Sbjct:    7 KFAYLIYETGEKMAYCRYINKMLKQDPDCRPYLPLDPLNDDLYRTTKNGILLCKLVNIAFPRAIDERAVHKNAIIFYPSQMVDNVLLALTAAQCNGCPVSDFTVDDLTNNSALSRCVILEVVWQIIRCGFFRAMNLHEHPELCKLKLLEEEVGDLKCVPPEDLLMRYVNYHLKHVGVDKRLNDIGIELADCVIYAHLLPAIAPVTIRGRLISSAQVLLDDNIENRAKAVLQNLREMEADMFLCLNDFVDSKVHLESRARLHLATIAYLFSKFPGELVNPRRSNESP---KAEPMSESSSRNFVNSMAVTPFSTHVCDNLRDGLMSRQLFEVLRSGCTKGLKFIVEFQSIRRLAQFIYNNTNIVRLVQGYPLPL-PHLDAEKLSRTDEPCCLSMLLEILRAYITRDHYDEVELLQWTNEQLYRAGRSVELRSFNDRVIAEDNLFAVVLNRLTNGMADSRYLTSKKLDNAAYSISVAHKAGYPVYTKPEHFVGCNGAFVSLAFATL 506          
BLAST of Plastin-3 vs. TrEMBL
Match: A0A2H1C7H0 (Plastin-1 OS=Fasciola hepatica OX=6192 GN=D915_006389 PE=4 SV=1)

HSP 1 Score: 385.571 bits (989), Expect = 1.913e-123
Identity = 186/491 (37.88%), Postives = 304/491 (61.91%), Query Frame = 1
Query:  376 AFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINRTPKIMDYTQKIENLSLALNAARCHGANLGAIDLNEVYNGN---QTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAPADLKNKMVSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDDLKNGADRKETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQRVHNCTKIAKIAENYPLTIGSELDPEKMARFDKLTVLGLITEIMITYISKNQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCLDRSCLSNNRLQNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANL 1839
            A+ R+IN+ L  DPDCR  LPLDP ++D+Y   ++G++LCKLVN++ PR IDERA+++   I   +Q ++N+ LAL AA+C+G  +    ++++ N +   +  ILE +WQII+ GF + +N+H HPE+  LK   E + ++K + P ++++RYVN+HL   G+   +     +  DC++YAHL   IAP  ++ +++SS  +  +   + R+ ++++NL+ + AD FL  +D  +     E+ A+LHLAT+AYLF  + G+L +       P     E + E   RNF+NS  + PF+ H+  + R+GL+  Q+ +VLR G   GL+F+ EF   R   Q ++N T I ++ + YPL +   LD EK++R D+   L ++ EI+  YI+++ ++E + + W N+Q  R  R + +++F DR+I E+NLFA +L+    G  D   L++ +L NA Y IS A KAG P+YT PEHFV  N  F+++AFA L
Sbjct:    2 AYCRYINKMLKQDPDCRPYLPLDPLNDDLYRTTKNGILLCKLVNIAFPRAIDERAVHKNAIIFYPSQMVDNVLLALTAAQCNGCPVSDFTVDDLTNNSALSRCVILEVVWQIIRCGFFRAMNLHEHPELCKLKLLEEEVGDLKCVPPEDLLMRYVNYHLKHVGVDKRLNDIGIELADCVIYAHLLPAIAPVTIRGRLISSAQVLLDDNIENRAKAVLQNLREMEADMFLCLNDFVDSKVHLESRARLHLATIAYLFSKFPGELVNPRRSNESP---KAEPMSESSSRNFVNSMAVTPFSTHVCDNLRDGLVSRQLFEVLRSGCTKGLKFIVEFQSIRRLAQFIYNNTNIVRLVQGYPLPL-PHLDAEKLSRTDEPCCLSMLLEILRAYITRDHYDEVELLQWTNEQLYRAGRSVELRSFNDRVIAEDNLFAVVLNRLTNGMADSRYLTSKKLDNAAYSISVAHKAGYPVYTKPEHFVGCNGAFVSLAFATL 488          
BLAST of Plastin-3 vs. TrEMBL
Match: A0A0V0J8E5 (Plastin-3 OS=Schistocephalus solidus OX=70667 GN=PLST PE=4 SV=1)

HSP 1 Score: 385.956 bits (990), Expect = 2.126e-123
Identity = 192/500 (38.40%), Postives = 309/500 (61.80%), Query Frame = 1
Query:  352 IHEPSERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINRTPKIMDYTQKIENLSLALNAARCHGANLGAIDLNEVYNGNQTTI----LEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAPADLKNKMVSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDDLKNGADRKETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQRVHNCTKIAKIAENYPLTIGSELDPEKMARFDKLTVLGLITEIMITYISKNQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCLDRSCLSNNRLQNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANL 1839
            ++E   R AF R+IN+ L  DPDCR  +PLDP S+ +Y  V+DG++LCK+VN   P  IDERA+N++  I   + ++EN+ LAL AARC+G  + +I ++++  G++T      LEF  Q+I  G+ + +NIH HPE+  LK   E + +++ LSP +I+ RYVNFHL  +G+   +  FD D  DC+VYA+L  +IAP  ++ +++    +  +     R+ ++++NL+ L A+ FL EDD  N    +ET   LHL T+A+LF  ++G++ + G    +P   S E ++E   RNF+NS D++PF+ H++ + R+G I  Q+ ++LRPG   G++F  EFD  R   Q + N T I ++ + YP  + S LD E++ R D      L+ E++ ++++++ ++E + + W N+Q SR    I +++F+DR I +ENLFA +L+    G   +  L   RL NA+YYIS A KAG  +YT PEHF   +  ++A+AFA L
Sbjct:   12 VYEAGFRQAFCRYINKNLTGDPDCRAYMPLDPYSDKLYDAVKDGVVLCKIVNKLFPDAIDERAVNKSTNIFYASHRVENIQLALTAARCNGCAVRSIAVDDLM-GSRTHFKLASLEFFKQVILKGYFRKINIHEHPEMFTLKLAHEDLHDIRCLSPQDILTRYVNFHLKSAGVTKTLTSFDYDLSDCVVYAYLLYKIAPVTVRPRLLPPDQVLLDNQLLNRAKAVLQNLRELGAEMFLCEDDFINSFTNRETRGVLHLITVAFLFNRFAGEMKTYGAG-DRP--ASKESINELSSRNFVNSVDVRPFSTHVISNLRDGHIARQMFEILRPGFTTGVKFTYEFDLVRREAQFLQNNTCIVRLVQGYPFKLPS-LDAERLTRSDLAICEALLLEMLRSFLTRDAYDEYELLRWTNEQLSRAGIPIELRSFSDRAIADENLFAAVLNNLTNGMASKDFLRGKRLDNARYYISVAHKAGYRVYTRPEHFETCSPRWVAIAFAAL 506          
BLAST of Plastin-3 vs. TrEMBL
Match: A0A448WGW6 (Uncharacterized protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS4928 PE=4 SV=1)

HSP 1 Score: 383.259 bits (983), Expect = 2.156e-122
Identity = 194/497 (39.03%), Postives = 304/497 (61.17%), Query Frame = 1
Query:  358 EPSERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINRTPKIMDYTQKIENLSLALNAARCHGANLGAIDLNEVYNGNQ---TTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAPADLKNKMVSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDDLKNGADRKETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQRVHNCTKIAKIAENYPLTIGSELDPEKMARFDKLTVLGLITEIMITYISKNQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCLDRSCLSNNRLQNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANL 1839
            E  E++A+SR+IN+ L  D DCR  LPLDP + D+Y  ++ GLI CKLVN S P  IDER I+++  I + TQ++ NL L + AA C+G  + ++ + ++ +  +      LEF++Q+I  G+ + +N++ HPEI +LK  GE   ++K +SP E+++RYVN HL  +G+   +  F ED  D IVYA+L   IAP  L+++++S   I  +     R+ ++++NL+ L AD FL   D  +     +   +LHLAT+A+LF  + G L + G       S   E +D  V RNF+NSF + PF+ H  V+ R+GL+  Q+ +VLRPG   GL+F+ EFD  R   Q +HN T I ++ ++YPL +   +D E++++ D+   + L+ EI   YIS + ++E   + WVN+Q  R  R + +++F+DR I EENLFA +L+    G   +  ++  R +NA+YYIS A KAG P++T PEHF   N+ F+ +AFA L
Sbjct:    6 ESREKSAYSRYINKCLGFDADCRPYLPLDPYNEDLYDAIRQGLIPCKLVNNSFPEAIDERCIHKSLNITNITQRVANLQLGVTAALCNGCAIRSVQVEDLVSDTKEGKCNSLEFVYQVIINGYFRQINVYQHPEICNLKFVGEDTRDIKCISPQELLLRYVNVHLLHAGISKQICSF-EDLCDGIVYAYLLYHIAPMTLRSRLISPDQIISDADLSNRAKAVLQNLRELEADMFLCHADFMDSRTELDLVTRLHLATIAHLFCMFPGILVTMG---NHSRSRLQEDIDHLVTRNFVNSFGVTPFSTHTCVNLRDGLLGCQLFEVLRPGSSIGLKFIREFDPERIESQYIHNNTNIVRLVQSYPLHL-PHIDSERLSKTDEACCMSLLLEIKRAYISNDHYDEAALLRWVNEQLHRAGRSVELRSFSDRAIPEENLFAIVLNNLTNGMARKEMMTGKRTENARYYISIAHKAGYPVFTSPEHFASCNSKFVTLAFATL 497          
BLAST of Plastin-3 vs. TrEMBL
Match: A0A4S2LJL1 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007108 PE=4 SV=1)

HSP 1 Score: 381.333 bits (978), Expect = 1.916e-121
Identity = 196/504 (38.89%), Postives = 308/504 (61.11%), Query Frame = 1
Query:  337 KMTTGIHEPSERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINRTPKIMDYTQKIENLSLALNAARCHGANLGAIDLNEVYNGN---QTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAPADLKNKMVSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDDLKNGADRKETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQRVHNCTKIAKIAENYPLTIGSELDPEKMARFDKLTVLGLITEIMITYISKNQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCLDRSCLSNNRLQNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANL 1839
            K    I+E  E+ A+ R+IN+ L  DPDCR  LPLDP ++D+Y   ++G++LCKLVN++ PR IDERA+++   I   +Q ++N+ LAL AA+C+G  +    ++++ N +   +  ILE +WQIIK GF + +N+H HPE+  LK+T E I +VK + P ++++RYVNFHL  +G+   +     +  DC++YAHL   IAP  ++ +++  G +  ++    R+ ++++NL+ + AD FL  +D  +     ++ A+LHLAT+AYLF  + G+L +       P     E + E   RNF NS  + PF  H     R+GLI  Q+ +VLR G   GL+F+TEF   R   Q ++N T + ++ + YPL +   LD EK++R D+   L L+ E++  YI+K+ ++E + + W N+Q  R  R + +++F DR I EENLFA +L+    G  D   L++ +L NA Y IS A KAG P+YT PEHF+  N  F+A+AFA L
Sbjct:    7 KFAYLIYEAGEKMAYCRYINKMLKNDPDCRPYLPLDPFNDDLYKTTKNGVVLCKLVNIAFPRAIDERAVHKNTIIFYPSQMVDNVLLALTAAQCNGCPVSDFLVDDLTNNSALSRCIILEVVWQIIKCGFFRRMNLHEHPELCKLKQTEEDILDVKCVPPEDLLMRYVNFHLKWAGVDKRLTDIGIELADCVIYAHLLPAIAPVTIRGRLIPPGQVLVDENIANRAKAVLQNLREMEADMFLCLNDFTDSHIHLQSRARLHLATIAYLFLQFPGELVNPRRMNEHP---EQEGVSELSSRNFENSCAVTPFVTHSCASLRDGLISRQLFEVLRTGSTKGLKFITEFQQVRKIAQYIYNNTNVVRLVQGYPLPL-PHLDSEKLSRTDEPCCLSLLLELLRGYIAKDHYDEVELLRWTNEQLYRAGRSVELRSFNDRAIVEENLFAVVLNNLTNGMADSRHLTSKKLDNAAYSISVAHKAGYPVYTRPEHFISCNGAFVALAFATL 506          
BLAST of Plastin-3 vs. Ensembl Cavefish
Match: lcp1 (lymphocyte cytosolic protein 1 (L-plastin) [Source:NCBI gene;Acc:30583])

HSP 1 Score: 241.891 bits (616), Expect = 1.328e-70
Identity = 161/524 (30.73%), Postives = 265/524 (50.57%), Query Frame = 1
Query:  355 HEPSERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINRTPKIMDYTQKIENLSLALNAAR---CHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAPADLKN---KMVSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDDLKNGADRKETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQRVHNCTKIAKIAENYPLTIGSE--------LDPEKMARFDKLTVLGLITEIMITYI--------SKNQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCLDRSCLS------NNRLQNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLI 1842
            +   E+ AF  WIN+ L  DPDC+ +LP+DP+SND+++ V DG++LCK++NLS+P  IDER IN+  K+  +T + ENL+LALN++    CH  N+GA DL E   G Q  +L  LWQIIKIG + D+ I  +  +  L + GES++++ +LSP E+++R+ N+HL ++G    +  F  D +D   Y ++ N++AP         ++   T  +EK    R+  +++    L    F++  D+  G      + KL+LA +A LF  Y   L     Q     S+ GE  +E   RN++NS  + P  NHL  D  + LI  Q+ + ++  +         +    S+ +++ NC        NY + +G +        +  + +   ++   L L+ ++M  Y            + N+   V WVND   + +++ +I  F D  I+      +++DA  PG +    +         +L NAKY IS A K G  +Y LPE  VE     +   FA L+
Sbjct:  114 YSEEEKVAFVNWINKALEKDPDCKHVLPMDPSSNDLFTAVGDGIVLCKMINLSVPDTIDERTINKK-KLTPFTIQ-ENLNLALNSSSAIGCHVVNIGAEDLKE---GRQHLVLGLLWQIIKIGLLADIEISRNEALIALLRDGESLEDLMKLSPEELLLRWANYHLEQAGCSK-INNFSSDIKDSKAYYNILNQVAPKGDDEGIPPIIIDMTGLREKEDLKRAECMLDQADRLGCRQFVMPPDVVRG------NPKLNLAFVANLFNKYPA-LKKPENQDIDWSSIEGETREERTFRNWMNSLGVNPRVNHLYGDLADALIIFQLYEKIKVPVDWDKVNKPPYPKLGSNMKKLENC--------NYAVELGKKEAKFSLVGIAGQDLNEGNRTLTLALLWQLMRRYTLNILEDLGDGQKVNDDTIVGWVNDTLKQADKK-TISGFKDGSISSSMPVLDLIDAIQPGSIRYDLIKAEDLSDEEKLNNAKYAISMARKIGARVYALPEDLVEVKPKMVMTVFACLM 615          
BLAST of Plastin-3 vs. Ensembl Cavefish
Match: pls3 (plastin 3 (T isoform) [Source:ZFIN;Acc:ZDB-GENE-040718-10])

HSP 1 Score: 201.445 bits (511), Expect = 3.896e-56
Identity = 151/534 (28.28%), Postives = 251/534 (47.00%), Query Frame = 1
Query:  328 VATKMTTGIHEPSERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYS-KVQDGLILCKLVNLSLPRIIDERAINRTPKIMDYTQKIENLSLALNAAR---CHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAPADLKNKMVSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDD------LKNGADRKETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLR-PGICNGLRFMTEFDGSRSHPQRVHNC---TKIAKIAENYPLT-IGSELDPEKMARFDKLTVLGLITEIMITYI--------SKNQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCL------DRSCLSNNRLQNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLI 1842
            +++  T   +   E+ AF  WIN  L  DPDC+ +LP++PN++ ++   + DG++   +V            +N     +++    ENL+LALN+A    CH  N+GA+DL E   G    +L  LWQIIKIG   D+ +  +  +A L + GE+++++ +LSP E+++R+ NFHL  +G  H +  F  D +D   Y HL N+IAP  LK           E   D+  +   E   L  A+A L++ D          AD    + KL+LA +A LF  Y   L+    Q      + GE  +E   RN++NS  + P  NHL  D ++ L+  Q+ + ++ P   N       +    ++ +++ NC     + K    + L  IG     + +   +    L L+ ++M  Y            + N+   V+WVN   +   +   I +F D+ I+      +++DA  PG +        S    ++L+NAKY +S A K G  +Y LP+  VE     +   FA L+
Sbjct:   52 LSSAGTQHSYSEEEKFAFVNWINTALEKDPDCKHVLPMNPNTDSLFKFAIFDGIVFLDIV-----------LLNICNTNVNFELNYENLNLALNSASAIGCHVVNIGALDLRE---GKPHLVLGLLWQIIKIGLFADIELSRNEALAALLREGETLEDLMKLSPEELLLRWANFHLDNAGW-HKINNFSSDIKDSKAYFHLLNQIAPKGLK---------ENEDRIDINMAGFNEKDDLKRAEAMLVQADRLGCRQFVTPADVVSGNPKLNLAFVANLFNKYPA-LTKPENQDIDWGLLEGETREERTFRNWMNSLGVNPHVNHLYGDLQDALVILQLYERIKVPVDWNNKVNKPPYPKLGANMKKLENCNYAVDLGKTTAKFSLVGIGG----QDLNDGNPTLTLALVWQLMRRYTLNVLEDLGDGEKVNDDIIVNWVNKTLAGAGKSTKISSFKDKEISSSLPVLDLIDAIQPGSVHYDLVKTGSLSDQDKLENAKYAVSMARKIGARVYALPDDLVEVKPKMVMTVFACLM 556          
BLAST of Plastin-3 vs. Ensembl Cavefish
Match: pls1 (plastin 1 (I isoform) [Source:ZFIN;Acc:ZDB-GENE-030131-6205])

HSP 1 Score: 176.792 bits (447), Expect = 4.906e-47
Identity = 151/531 (28.44%), Postives = 252/531 (47.46%), Query Frame = 1
Query:  328 VATKMTTGIHEPSERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINRTPKIMDYTQKIENLSLALNAARCHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKS---GLRHMVKG--FDEDFRDCIVYAHLTNRIAP-ADLKNKMVSSGTIT--KEKFSDMRSSSIIENLKLLNADAFLIEDDLKNGADRKETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQRVHNC---TKIAKIAENYPLT-IGSELDPEKMARFDKLTVLGLITEIMITYISK--------NQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCLDRSCLS------NNRLQNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLI 1842
            ++++ T   +   E+ AF  WIN+ LA DPDC+ L+P+DP ++ + ++    L+  K++NLS P  IDER IN T K   +T   ENL LALN+A   G  +  ID  ++  G    +L  LWQIIKIG   D+ I              S +E ++L+  +        H+++S   G  H ++   F +D R    Y HL ++I+P  D  ++M  S  ++   E+  + R+  ++     L+   F+   D+  G      + KL++A +A LF  +   LS           + GE  ++   RN++NS  + P+ NHL  D  +GLI  Q+ + ++  +         +    S+ +++ NC    ++ K    + L  IG E   E  A    +  L L+ ++M  Y  K         + N++  VDWVN    +  +  SI+NF D+ I+      +++D  APG +    +        ++L NAKY IS + K G  +Y LP+  VE N   +   FA L+
Sbjct:  110 ISSEGTQHSYADEEKVAFVNWINKALANDPDCKHLIPMDPTTDSLCAQFYT-LVELKMINLSQPDTIDERVIN-TKKRTTFTM-TENLILALNSASAIGCTVVNIDSQDMIAGTPHLVLGLLWQIIKIGLFADIEI--------------SRNEGQKLTTIQ--------HISQSCPWGSIHDLQCLFFSQDSR---AYFHLLDQISPKGDGDDEMRISIDMSGLNERDDERRAELMLRQAARLDCRQFVTPQDVVAG------NHKLNMAFVANLFNMFPA-LSRPANNGIDLAMLEGESREDRTFRNWMNSLGVNPYVNHLYSDLMDGLIILQLYERIQVPVDWRKVNRPPYSILGSNMKKLENCNYAVELGKREAKFSLVGIGGENINEGSA----MHTLALVWQLMRRYTVKVLADIGHGEKVNDQIIVDWVNSTLQKGQKDSSIKNFKDKSISTSLPVIDLIDTIAPGAIKSEMVKRGDMSPEDKLNNAKYAISVSRKIGAKVYALPDDLVEVNPKMVMTVFACLM 601          
BLAST of Plastin-3 vs. Ensembl Sea Lamprey
Match: lcp1 (lymphocyte cytosolic protein 1 (L-plastin) [Source:NCBI gene;Acc:30583])

HSP 1 Score: 83.1889 bits (204), Expect = 1.609e-17
Identity = 78/336 (23.21%), Postives = 138/336 (41.07%), Query Frame = 1
Query:  886 DFRDCIVYAHLTNRIAPADLKNKMVSSGTITKEKFSD---MRSSSIIENLKLLNADAFLIEDDLKNGADRKETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQRVHNCTKIAKIAENYPLTIGSELDPEKMARFDKLTVLGLITEIMITYI--------SKNQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCL------DRSCLSNNRLQNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLI 1842
            D +D   Y HL N+IAP   K        I    F+D   +R + ++     L    F+   D+ +G      + KL+LA +A LF  Y                 +GE  +E   RN++NS  + PF NHL  D  + L+  Q+ + ++  +         +    ++ +++ NC    ++ +    ++   +  + +   +    L L+ ++M  Y            + N++  V+WVN       +  SI +F            +++DA  PG +      +     ++RL NAKY IS A K G  +Y LP+  VE     +   FA L+
Sbjct:    1 DPQDSRAYFHLLNQIAPKGDKEGQPRV-DIDFSGFNDKDELRRAEMLVQADKLGCRQFVTPADVVSG------NPKLNLAFVANLFNKYPALHKPANQDIDWGLLEAGESREERTFRNWMNSLGVNPFVNHLYSDLVDALVIIQLFEKIKTRVDWNKVNKPPYPKLGANMKKLENCNYAVELGKTTKFSLVG-IGGQDLNDGNPTLTLALVWQLMRKYTIQVLEDLGEGEKVNDEIIVNWVNHTLRDAGKSSSIASFKVPPTALSTPCWDLIDAIQPGSIRYDLVKEEPLTDDDRLDNAKYAISMARKIGARVYALPDDLVEVKPKMVMTMFACLM 328          

HSP 2 Score: 47.7506 bits (112), Expect = 4.643e-6
Identity = 55/240 (22.92%), Postives = 100/240 (41.67%), Query Frame = 1
Query:  358 EPSERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINRTP--KIMDYTQKIENLSLALNAARCHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGFDEDFRDCIVYA-HLTNRIAPADLKNKMVSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDDL 1068
            E  E   F  W+N            L ++P  N +YS + D L++ +L      R+ D   +N+ P  K+    +K+EN + A+   +    +L  I   ++ +GN T  L  +WQ+++   IQ         + DL + GE +++       EII+ +VN  L  +G    +  F             L + I P  ++  +V    +T +   D  +   I   + + A  + + DDL
Sbjct:  102 ESREERTFRNWMNS-----------LGVNPFVNHLYSDLVDALVIIQLFEKIKTRV-DWNKVNKPPYPKLGANMKKLENCNYAVELGKTTKFSLVGIGGQDLNDGNPTLTLALVWQLMRKYTIQ--------VLEDLGE-GEKVND-------EIIVNWVNHTLRDAGKSSSIASFKVPPTALSTPCWDLIDAIQPGSIRYDLVKEEPLTDDDRLD-NAKYAISMARKIGARVYALPDDL 312          
BLAST of Plastin-3 vs. Ensembl Yeast
Match: SAC6 (Fimbrin, actin-bundling protein; cooperates with Scp1p in organization and maintenance of the actin cytoskeleton; phosphorylated by Cdc28p/Clb2p in metaphase on T103, to regulate conformation, and modulate actin filament binding affinity and actin cable dynamics; relocalizes from the plasma membrane to the cytoplasm upon DNA replication stress; human homologs PLS3 and LCP1 implicated in spinocerebellar ataxia type 2 (SCA2) can each complement yeast null mutant [Source:SGD;Acc:S000002536])

HSP 1 Score: 181.8 bits (460), Expect = 1.705e-49
Identity = 139/538 (25.84%), Postives = 248/538 (46.10%), Query Frame = 1
Query:  313 QIFILVATKMTTGIH--EPSERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAIN--RTPKIMDYTQKIENLSLALNAARCHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAPADLKNKMVSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDDLKNGADRKETSAKLHLATLAYLFRNYSG--DLSSTGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQRVHNCTKIAKIAE-NYPLTIGSE-------LDPEKMARFDKLTVLGLITEIMITYI---------SKNQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCLDRSCLS-----NNRLQNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLI 1842
            Q  I+VA   T   H     ER  F++ IN  LA D D   LLP   ++  ++ + +DGL+L KL+N S+P  ID R +N  +  K ++  Q  EN ++ +N+A+  G  +  +   ++  G +  IL  +WQII+ G +  ++I  HPE+  L +  E++++   L P +I++R+ N+HL ++     V  F +D  D   Y  L N++ PA     + S   +      + R+  +++N + L+   +L    L  G      + KL+LA +A+LF  + G   +        + +   GE  +  V   +LNS D+ P    L  D ++GLI  Q  + + PG         +F      P      ++   +   NY + +G         ++   +   +KL  LGL+ ++M   I         S    ++   + W  DQ ++  +  +I++F D+ ++  +   ++L+  APG +D   ++       R  NA+  IS A K G  I+ +PE   E  A  I    A+L+
Sbjct:  121 QAKIIVAGSQTGTTHTINEEERREFTKHINSVLAGDQDIGDLLPFPTDTFQLFDECRDGLVLSKLINDSVPDTIDTRVLNWPKKGKELNNFQASENANIVINSAKAIGCVVVNVHSEDIIEGREHLILGLIWQIIRRGLLSKIDIKLHPELYRLLEDDETLEQFLRLPPEQILLRWFNYHLKQANWNRRVTNFSKDVSDGENYTILLNQLDPA-----LCSKAPLQTTDLME-RAEQVLQNAEKLDCRKYLTPSSLVAG------NPKLNLAFVAHLFNTHPGLEPIQEEEKPEIEEFDAEGER-EARVFTLWLNSLDVDPPVISLFDDLKDGLILLQAYEKVMPGAV-------DFKHVNKRPASGAEISRFKALENTNYAVDLGRAKGFSLVGIEGSDIVDGNKLLTLGLVWQLMRRNISITMKTLSSSGRDMSDSQILKWAQDQVTKGGKNSTIRSFKDQALSNAHFLLDVLNGIAPGYVDYDLVTPGNTEEERYANARLAISIARKLGALIWLVPEDINEVRARLIITFIASLM 638          
BLAST of Plastin-3 vs. Ensembl Nematostella
Match: EDO32484 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUX1])

HSP 1 Score: 199.904 bits (507), Expect = 8.883e-56
Identity = 146/511 (28.57%), Postives = 242/511 (47.36%), Query Frame = 1
Query:  367 ERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINRTPKIMDYTQKIENLSLALNAARCHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAPADLKNKMVSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDDLKNGADRKETSAKLHLATLAYLFRNYSG----DLSSTGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRF-MTEFDGSRSHPQRVHNCTKIAKIAENYPLTIGSELDPEKMARFDKLTVLGLITEIMITYI---------SKNQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCLDRSCLSNNRLQ-----NAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLI 1842
            ER  F+ WIN  L  D D ++        + +++ V+DG+++CKL+N S+P  IDERAIN   K+  YT   EN +L LN+A   G N+  I   ++  G    +L  +WQ+I+IG    + I   P +  L    E +D+++ L+P +I++R+ NF L  +G    V  F  D  D   Y+ L N+IAP +L         I     S+   + + E L L NAD       ++   D  + +AKL+LA +  LF  +      +   T ++         E  +E   RN++NS  I+PF  +L +D  +G+I  Q+ D ++PGI N  +     F    +  +++ NC     +A+    ++   +  + +   +K+ +L L+ + M  Y          S+    E + V WVN++ S   +  +I    D  I       +++DA  P  ++ S ++    Q     NAKY IS A K G  +Y LPE  VE  +  +   FA L+
Sbjct:  106 ERIGFTDWINSCLGDDEDLKEA------QDGLFNAVKDGVVMCKLINWSVPHTIDERAIN-MKKLNVYTIH-ENQTLVLNSAMAIGCNIVNIGAEDLIEGKPHLVLGLMWQVIRIGLFAKITIQNCPGLVQLLHDHEELDDLRRLAPEDILLRWFNFQLEDAGHHRRVNNFSSDISDAENYSVLLNKIAPPEL--------GIDTPHVSESDPTKLAE-LVLTNADKMACRKFVR-AKDVVKGNAKLNLAFVCNLFNTFPCLEPVEHEMTDIE---------ETREEKTFRNWINSLGIKPFVQNLYLDLDDGMILFQLFDQVQPGIVNYDKVNKPPFKKMGAKMKKLENCNYAISVADLLKFSLVG-VGGKDINDGNKMLILALLWQTMRAYTLTVLQKCAGSEKPVTEAEIVVWVNEKLSSAGKATTITGMKDPEIKTSKCVLDLIDAIKPKAINYSMVNAGECQEDAFLNAKYAISMARKVGARVYALPEDLVEGKSKMVMTVFACLM 588          
BLAST of Plastin-3 vs. Ensembl Nematostella
Match: EDO40382 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7E1])

HSP 1 Score: 187.193 bits (474), Expect = 7.777e-51
Identity = 148/540 (27.41%), Postives = 249/540 (46.11%), Query Frame = 1
Query:  355 HEPSERAAFSRWINQKLAADPDCRQLLPLDP--NSNDVYSKVQDGLILCKLVNLSLPRIIDERAINRTPKIMDYTQKIENLSLALNAARCHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAK----------SGLRHMVKGFDEDFRDCIVYAHLTNRIAPADLKNKMVSSGTITKEKF-----SDMRSSSIIENLKLLNADAFLIEDDLKNGADRKETSAKLHLATLAYLFRNYSG--DL-SSTGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQR------VHNCTKIAKIAENYPLTIGSELDPEKMARFDKLTVLGLITEIMITYI---------SKNQWNEKDAVDWVNDQFSRNNRRISI---QNFADRIITEENLFAEILDAAAPGCLDRSCLS------NNRLQNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLI 1842
            H   E+ AF+ WIN  L  D    + LP+D   +S+D+Y KV+DG++LCK++NLS P  IDER IN+ P  +      EN +L +N+A   G NL  I   ++  G +  +L  LWQ+I+IG    + +   P +A L + GE+I+ +  LSP E+++R+VNFHL K             R +V  F +D +D   Y+ L  +IAP        SSG    + +     +  ++  ++ N + +    F+   D+ +G      + KL++A +A LF  +    +L    G + G       E  +E   RN++NS     + N L  D  +G+I  ++ + +RPG C         +G   + +       + NC     + + +  ++      +       LT LGLI ++M  Y            +   E+  V+WVN       +   I     F D  I+      +++D  +P  ++ + ++       ++L NA+Y IS A K G  +Y LPE  VE     +   FA+L+
Sbjct:  119 HSKEEQVAFADWINSSLKEDESVHKYLPIDASEDSSDLYEKVKDGILLCKMINLSAPGTIDERVINKPP--LKVFTIHENQTLVINSALAIGCNLVNIGAGDLAEGKKHLVLGVLWQVIRIGLFSKITLTNVPGLARLLQEGETIEGLHHLSPEELLLRWVNFHLGKYYDGQNYPPDDSRRKVVHNFSDDIKDSEAYSILLYQIAPQ-------SSGVDHPQSYYSTTDNSKKAEKMLRNAEKIGCRKFVRAKDVVSG------NQKLNMAFVANLFSTFPNLPELDDDEGKEVGLDEEYQEETREELTYRNWINSMGCGRYVNWLYSDFFDGIILFKMFEHIRPG-CVDWEKKVNPEGKCKNARMGGKVKCIENCNYAVDLGKQFNFSLIGIQGQDIHEGVQNLT-LGLIWQMMRAYTYTLLARLSPDDDHMTEEKIVEWVNKTLQSKKKTHLINKGHGFKDPDISTSLAVLDLIDCISPKMINPALINPDPLSDEDKLPNAQYAISMARKIGAVVYALPEDLVEVKPKMVLTVFASLM 641          
BLAST of Plastin-3 vs. Ensembl Nematostella
Match: EDO32486 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUX4])

HSP 1 Score: 53.5286 bits (127), Expect = 5.783e-9
Identity = 31/98 (31.63%), Postives = 46/98 (46.94%), Query Frame = 1
Query: 1564 VDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCLDRSCLSNNRLQ-----NAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLI 1842
            V WVN++ S   +  +I    D  I       +++DA  P  ++ S ++    Q     NAKY IS A K G  +Y LPE  VE  +  +   FA L+
Sbjct:    2 VVWVNEKLSSAGKATTITGMKDPEIKTSKCVLDLIDAIKPKAINYSMVNAGECQEDAFLNAKYAISMARKVGARVYALPEDLVEGKSKMVMTVFACLM 99          
BLAST of Plastin-3 vs. Ensembl Medaka
Match: pls3 (plastin-3 [Source:NCBI gene;Acc:101161915])

HSP 1 Score: 239.58 bits (610), Expect = 1.249e-69
Identity = 159/514 (30.93%), Postives = 268/514 (52.14%), Query Frame = 1
Query:  367 ERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINRTPKIMDYTQKIENLSLALNAAR---CHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAPADLKNKMVSSGTITKEKFSD----MRSSSIIENLKLLNADAFLIEDDLKNGADRKETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLR-PGICNGLRFMTEFDGSRSHPQRVHNCTKIAKIAENYPLTIGSELDPEKMARFDKLTVLGLITEIMITYI--------SKNQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCLD-----RSCLSN-NRLQNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLI 1842
            ER AF  WIN  L  DPDC+ +LP++PN++ +++ V DG++LCK++NLS P  IDER IN+  K+  +T + ENL+LALN+A    CH  N+GA+DL E   G    +L  LWQIIKIG   D+ +  +  +A L + GE+++++ +LSP E+++R+ N+HL  +G +  +  F  D +D   Y HL N+I+P   K++      I    F++     R+ ++++    L    F+   D+ NG      + KL+LA +A LF  Y   L+    Q      + GE  +E   RN++NS  + P  NHL  D ++ L+  Q+ + ++ P   N       +    ++ +++ NC    ++  +   ++   +  + +   +    L ++ ++M  Y           ++ N+   V WVN   +   +   I +F D+ I+      E++DA  PG ++      S LS+ ++L+NAKY IS A K G  +Y LPE  VE     +   FA L+
Sbjct:  117 ERFAFVNWINTALEKDPDCQHVLPMNPNTDSLFTSVGDGIVLCKMINLSAPDTIDERTINKK-KLTPFTIQ-ENLNLALNSASAIGCHVVNIGALDLKE---GKPHLVLGLLWQIIKIGLFADIELSRNEALAALLRDGETLEDLMKLSPEELLLRWANYHLENAGYKK-INNFSSDIKDSKAYFHLLNQISPKG-KDEGQPCIDINMAGFNEKDDLKRAEAMLQQADRLGCRQFVTPTDVVNG------NPKLNLAFVANLFNKYPA-LTKPENQDIDWGLLEGETREERTFRNWMNSLGVNPHVNHLYGDLQDALVILQLYEKIKIPVDWNNKVNKPPYPKLGTNMKKLENCNYAVELGRSAKFSLVG-IGGQDLNDGNPTLTLAVVWQLMRRYTLNVLEDLGDGDKVNDDIIVKWVNKTLADAEKSTKISSFKDKEISTSLSVLELIDAIQPGSVNYELIKTSSLSDADKLENAKYAISMARKIGARVYALPEDLVEVKPKMVMTVFACLM 615          
BLAST of Plastin-3 vs. Ensembl Medaka
Match: lcp1 (plastin-2 [Source:NCBI gene;Acc:101162720])

HSP 1 Score: 238.81 bits (608), Expect = 2.107e-69
Identity = 157/518 (30.31%), Postives = 262/518 (50.58%), Query Frame = 1
Query:  355 HEPSERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINRTPKIMDYTQKIENLSLALNAAR---CHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAPADLKNKMVS-----SGTITKEKFSDMRSSSIIENLKLLNADAFLIEDDLKNGADRKETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQRVHNCTKIAKIAENYPLTIGSELDPEKMARFDKLTVLGLITEIMITYI--------SKNQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCLDRSCL------SNNRLQNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLI 1842
            +   E+ AF  WIN+ L  DPDC+ +LP+DP+S+D+++ + DG+ILCK++NLS+P  IDER IN+  K+  +T + ENL+LALN+A    CH  N+GA DL E   G Q  +L  LWQ+IKIG   D+ +  +  +  L + GES++++ +LSP E+++R+ N+HL ++G    +  F  D +D   Y +L N++AP   +  + +     SG   KE     R+  +++    L+   F++  D+  G      + KL+LA +A LF  Y   L     Q     S+ GE  +E   RN++NS  + P  NHL  D  + L+  Q+ + ++  +         +    S+ +++ NC    ++ +N        +  + +   ++   L L+ ++M  Y            +  +   V WVND  +   +  +I +F D  I+      +++DA  PG +    +         +L NAKY IS A K G  +Y LPE  VE     +   FA L+
Sbjct:  111 YSEEEKVAFVNWINKALEKDPDCKHVLPMDPDSDDLFTAMGDGIILCKMINLSVPDTIDERTINKK-KLTPFTIQ-ENLNLALNSASAIGCHVVNIGAEDLKE---GRQHLVLGLLWQVIKIGLFADIELSRNEALIALLRDGESLEDLMKLSPEELLLRWANYHLEEAGCGK-INNFSSDIKDSKAYYNLLNQVAPKGDEEGIAAIIVDMSGIREKEDLK--RAECMLDQADRLSCRQFVMPADVVRG------NPKLNLAFVANLFNKYPA-LKKPENQDIDWSSIEGETREERTFRNWMNSLGVNPRVNHLYADIDDALVIFQLYEKIKVPVNWDRVNKPPYPKLGSNMKKLENCNYAVELGKNEAKFSLVGIAGQDLNAGNRTLTLALLWQLMRRYTLNILEDLGDGQKVTDDTIVSWVNDTLTHAEKN-TISSFKDMSISSSMPVLDLIDAIQPGSIRYDLVKAEDLTEEEKLNNAKYAISMARKIGARVYALPEDLVEVKPKMVMTVFACLM 612          
BLAST of Plastin-3 vs. Ensembl Medaka
Match: pls1 (plastin-1 [Source:NCBI gene;Acc:101168586])

HSP 1 Score: 231.491 bits (589), Expect = 1.453e-66
Identity = 148/528 (28.03%), Postives = 269/528 (50.95%), Query Frame = 1
Query:  328 VATKMTTGIHEPSERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINRTPKIMDYTQKIENLSLALNAARCHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAPAD-LKNK---MVSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDDLKNGADRKETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQRVHNCTKIAKIAENYPLTIGSELDPEKMARFDKLTVLGLITEIMITYI--------SKNQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCLD--------RSCLSN-NRLQNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLIPY 1848
            ++++ T   +   E+ AF  WIN+ L  DPDC  +LP++PN   ++S ++DG++LCK++N S P  IDER IN T K+  + +  ENL LALN+A   G  +  +D +++  G    +L  LWQ+IK+G   D+ +  + ++  L + GE ++ +  LSP E+++R+VN+HL  +  +  ++ F +D +D   Y HL N++A  + L+NK    +  G +++    + R+  +++    ++   F+   D+  G      ++KL+LA +A LF  + G L      +G   S+  E  +E   RN++NS  + P  NHL  D  +GL+  Q+++ ++  +         F     + +++ NC    ++ +N        +  E +    ++  L L+ ++M  Y            +  ++  ++WVN    +  +   I NF D++I+      +++D   PG +         R  +SN ++L NAKY IS A K G  +Y LP+  VE N   +   FA L+ Y
Sbjct:  110 ISSEGTQHSYADEEKVAFVNWINKALKNDPDCHHVLPMNPNDESLFSSLRDGILLCKMINFSQPDTIDERVIN-TKKLTTF-KMTENLILALNSASAIGCRVVNVDAHDLKAGKPHLVLGLLWQVIKVGLFADIELSKNEDLIALLEDGEKLEHLMSLSPEELLLRWVNYHLQNAKTQK-IRNFSDDIKDSRAYFHLLNQLAIEEMLENKRGIRIDMGGLSEFNL-ERRAELMLQQAAKMDCRQFVSPRDITAG------NSKLNLAFVANLFNMHPG-LRGAKANKGNWDSIEAETREEKTFRNWMNSLGVSPSVNHLYWDLCDGLVILQLMEKVKVPVNWKKVNNPPFSMLGGNMKKLENCNYAVQLGKNVAHFSLVGVGGENLNEGSRVHTLALVWQLMRRYTVMVLSDLGDGEKIGDQIILNWVNTTLGQKKKASQISNFKDKLISTSMPVFDLIDCIVPGAVKWDMVKKDARGKMSNEDKLDNAKYAISLARKIGARVYALPDDLVEVNPKMVMTLFACLMGY 626          
BLAST of Plastin-3 vs. Ensembl Medaka
Match: pls1 (plastin-1 [Source:NCBI gene;Acc:101168586])

HSP 1 Score: 231.106 bits (588), Expect = 3.558e-66
Identity = 148/528 (28.03%), Postives = 269/528 (50.95%), Query Frame = 1
Query:  328 VATKMTTGIHEPSERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINRTPKIMDYTQKIENLSLALNAARCHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAPAD-LKNK---MVSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDDLKNGADRKETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQRVHNCTKIAKIAENYPLTIGSELDPEKMARFDKLTVLGLITEIMITYI--------SKNQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCLD--------RSCLSN-NRLQNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLIPY 1848
            ++++ T   +   E+ AF  WIN+ L  DPDC  +LP++PN   ++S ++DG++LCK++N S P  IDER IN T K+  + +  ENL LALN+A   G  +  +D +++  G    +L  LWQ+IK+G   D+ +  + ++  L + GE ++ +  LSP E+++R+VN+HL  +  +  ++ F +D +D   Y HL N++A  + L+NK    +  G +++    + R+  +++    ++   F+   D+  G      ++KL+LA +A LF  + G L      +G   S+  E  +E   RN++NS  + P  NHL  D  +GL+  Q+++ ++  +         F     + +++ NC    ++ +N        +  E +    ++  L L+ ++M  Y            +  ++  ++WVN    +  +   I NF D++I+      +++D   PG +         R  +SN ++L NAKY IS A K G  +Y LP+  VE N   +   FA L+ Y
Sbjct:  147 ISSEGTQHSYADEEKVAFVNWINKALKNDPDCHHVLPMNPNDESLFSSLRDGILLCKMINFSQPDTIDERVIN-TKKLTTF-KMTENLILALNSASAIGCRVVNVDAHDLKAGKPHLVLGLLWQVIKVGLFADIELSKNEDLIALLEDGEKLEHLMSLSPEELLLRWVNYHLQNAKTQK-IRNFSDDIKDSRAYFHLLNQLAIEEMLENKRGIRIDMGGLSEFNL-ERRAELMLQQAAKMDCRQFVSPRDITAG------NSKLNLAFVANLFNMHPG-LRGAKANKGNWDSIEAETREEKTFRNWMNSLGVSPSVNHLYWDLCDGLVILQLMEKVKVPVNWKKVNNPPFSMLGGNMKKLENCNYAVQLGKNVAHFSLVGVGGENLNEGSRVHTLALVWQLMRRYTVMVLSDLGDGEKIGDQIILNWVNTTLGQKKKASQISNFKDKLISTSMPVFDLIDCIVPGAVKWDMVKKDARGKMSNEDKLDNAKYAISLARKIGARVYALPDDLVEVNPKMVMTLFACLMGY 663          
BLAST of Plastin-3 vs. Ensembl Medaka
Match: ENSORLT00000011106.2 (plastin-3-like [Source:NCBI gene;Acc:101157305])

HSP 1 Score: 224.172 bits (570), Expect = 5.333e-64
Identity = 159/522 (30.46%), Postives = 262/522 (50.19%), Query Frame = 1
Query:  367 ERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINRTPKIMDYTQKIENLSLALNAAR---CHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAPADLKN---KMVSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDDLKNGADRKETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGI-CNGLRFMTEFDG-SRSHPQRVHNCTKIAKIAENYPLTIGSE--------LDPEKMARFDKLTVLGLITEIMITY-------ISKNQWNEKD-AVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCLD-----RSCLSN-NRLQNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLI 1842
            ER AF+ +IN  L  DPDC   +P++PN+  ++  V DG++LCKL+NLS+P  IDER IN+  K+  +T + ENL+LALN+A    C   N+GA DL E   G    +L  LWQIIKIG    + +  +  IA L + GES+D + +LSP E+++R+VNFHL   G+   +  F  D +D  VY HL  +IAP   K    ++    T   EK    R+  +++  + L    F+   D+  G      +AKL+LA +A LF  +     +      + + V  E  +E   RN++NS  + P  +++  D ++ ++  Q+ + ++  +  N       F G    H +++ NC        NY + +G +        +  + +   +++  L L+ ++M  Y       +   +    D  + WVN   +  ++  SI++F D+ I+      +++DA  P  ++     R   SN ++L NAKY +S A K G  +Y LPE  VE     +   FA L+
Sbjct:  117 ERFAFTNYINTALGEDPDCSHFVPINPNTGALFKAVADGILLCKLINLSVPDTIDERTINKK-KLTPFTTQ-ENLNLALNSASAIGCQVVNIGAQDLKE---GKPHLVLGLLWQIIKIGLFAKIQLSRNKAIAALLQDGESLDVLMKLSPEELLLRWVNFHLKTVGMS--ITNFSADIKDSKVYFHLLEQIAPDGSKEDVPRVEIDMTGLYEKDLKKRAELMLQQAERLGCREFVTATDVVTG------NAKLNLAFVATLFNKH----PALTKPENQEWIVEDESREERTFRNWMNSLGVTPHVHYIYGDLQDAMVILQLYEKIKVKVDWNNRVNHPPFKGVGGGHLKKIENC--------NYAVELGKQKAGFSLVGIGGQDLYDGNEMLTLALMWQLMRRYTLNLLEDLGHGEVAGDDLIISWVNKTLAEADKSSSIKSFKDKSISTSLPVLDLIDAIQPESVNFELVKRDAESNADKLDNAKYAVSMARKIGAKVYALPEDLVEVKPKMVMTIFACLM 613          
BLAST of Plastin-3 vs. Planmine SMEST
Match: SMESG000042101.1 (SMESG000042101.1)

HSP 1 Score: 1041.95 bits (2693), Expect = 0.000e+0
Identity = 502/503 (99.80%), Postives = 502/503 (99.80%), Query Frame = 1
Query:  340 MTTGIHEPSERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINRTPKIMDYTQKIENLSLALNAARCHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAPADLKNKMVSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDDLKNGADRKETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQRVHNCTKIAKIAENYPLTIGSELDPEKMARFDKLTVLGLITEIMITYISKNQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCLDRSCLSNNRLQNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLIPY 1848
            MTTGIHEPSERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINRTPKIMDYTQKIENLSLALNAARCHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAPADLKNKMVSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDDLKNGADRKETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQRVHNCTKIAKIAENYPLTIGSELDPEKMARFDKL VLGLITEIMITYISKNQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCLDRSCLSNNRLQNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLIPY
Sbjct:    1 MTTGIHEPSERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINRTPKIMDYTQKIENLSLALNAARCHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAPADLKNKMVSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDDLKNGADRKETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQRVHNCTKIAKIAENYPLTIGSELDPEKMARFDKLIVLGLITEIMITYISKNQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCLDRSCLSNNRLQNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLIPY 503          
BLAST of Plastin-3 vs. Planmine SMEST
Match: SMESG000048251.1 (SMESG000048251.1)

HSP 1 Score: 598.586 bits (1542), Expect = 0.000e+0
Identity = 273/501 (54.49%), Postives = 381/501 (76.05%), Query Frame = 1
Query:  349 GIHEPSERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINRTPKIMDYTQKIENLSLALNAARCHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAPADLKNKMVSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDDLKNGADRKETSAKLHLATLAYLFRNYSGDLS-STGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQRVHNCTKIAKIAENYPLTIGSELDPEKMARFDKLTVLGLITEIMITYISKNQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCLDRSCLSNNRLQNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLIPY 1848
             IHE SE+ A+SRWIN+ LA DPDCRQ LPLDP  +D+Y KVQDG+ILCKL+N+SLP  IDER +NR  ++++Y QK+ENL+L LNAARC G ++G  D+N++Y G +   ++F+WQII+IGF+ DV  H HPEI +LKK G+S+D+++E S  +IIIRY N+HL+KSG+R+ V  +D+DF+DC+VYAHLT R+APA ++ KM+S   IT+E+  + R+ +II NL+ L A++FL EDD+ NG +R+++ +KLHL T+ YLF++++GDLS    V R K  S +GECL+E  CRNFLNSFD+ PF NH+L DCRNG I  ++ +VLRPG  +G++F+ +FD +R H QRVHNCTKI K+A+NY L     LD EK+A  DK ++LGLI E+M  Y+ ++ + EK+ +DW N Q  ++ ++  +++F DRII E+NLFA +L++ APG +DRSCL NN+L NA YY+S A KAG+P+YTLPEHFVE NA F+A+AFA L+ Y
Sbjct:   11 AIHELSEKRAYSRWINKVLANDPDCRQYLPLDPYGDDIYDKVQDGVILCKLLNISLPGAIDERTMNRGQRLLNYAQKMENLALVLNAARCRGCSMGNADINDIYAGVKYATIDFIWQIIRIGFLHDVTFHNHPEIVELKKVGDSLDDLREQSSHDIIIRYANYHLSKSGMRNFVNDYDDDFKDCLVYAHLTYRVAPATIRGKMISPTNITRERCVEARARNIIRNLEELGAESFLTEDDIINGFERRDSCSKLHLCTIGYLFKHFNGDLSVHRPVYRTKNNSGNGECLEELTCRNFLNSFDVYPFCNHVLNDCRNGWILGELFEVLRPGYTSGVKFILDFDSNRIHAQRVHNCTKIVKLAQNYVLNT-PNLDAEKIADSDKSSILGLIVEMMRAYVCRDNYIEKEILDWANCQLRKSGKQSMMRSFGDRIIAEDNLFAVVLESVAPGLVDRSCLGNNKLLNAYYYVSIAHKAGIPVYTLPEHFVEGNAKFVALAFATLMVY 510          
BLAST of Plastin-3 vs. Planmine SMEST
Match: SMESG000036396.1 (SMESG000036396.1)

HSP 1 Score: 552.747 bits (1423), Expect = 0.000e+0
Identity = 261/502 (51.99%), Postives = 363/502 (72.31%), Query Frame = 1
Query:  349 GIHEPSERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINRTPKIMD-YTQKIENLSLALNAARCHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAPADLKNKMVSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDDLKNGADRKETSAKLHLATLAYLFRNYSGDLSSTG-VQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQRVHNCTKIAKIAENYPLTIGSELDPEKMARFDKLTVLGLITEIMITYISKNQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCLDRSCLSNNRLQNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLIPY 1848
             IHE SER A+ +WIN+ LA D D    LPLDP ++D+Y K+QDG +LCKLV +SLP  IDERAINR   +   Y+QK++NL L LNAARC G N+G +D+NE+ +GN+ TIL+ +WQII+IGF   +N + HPEI DLKK  ESID++KELSP +I++RYVN HLAKSGLRH +  FD++F+DC++YAHLT R AP +L+ KM    TIT EK  + R+  I+ NL +LN ++FL EDDL NG  R+E+S KLH++T++YLF  ++GDL       R K +  +GECL+E  CRNFLNSFD+ PF+NHLL DCRNG I+S++ ++L+PGI +G++F+  FD  R +PQRVHN  KI K+ ++        LD EK+A  DK ++L +I E+M  Y +K+  N K+ V+ +N +  +  R+  I +F+DR I ++NL A I+D+ APG +D +CL+ ++L+N++Y IS A KAG+PIYTLPEHFV+ NA+FIA+AFA L+ Y
Sbjct:   11 SIHEESERRAYCKWINKVLADDKDSSLYLPLDPYNDDIYHKLQDGFLLCKLVQVSLPESIDERAINRGEDLSKTYSQKMDNLCLMLNAARCRGGNMGNVDINEIIDGNKFTILDTIWQIIRIGFFNQINFYHHPEIVDLKKINESIDDLKELSPSDIVLRYVNLHLAKSGLRHFINDFDDNFKDCLLYAHLTYRAAPVNLRMKMTDPTTITNEKCVETRARDIVSNLAVLNIESFLTEDDLLNGHKRRESSCKLHISTMSYLFIYFNGDLPIINPSHRTKSFGAAGECLEELTCRNFLNSFDVYPFSNHLLTDCRNGWIFSEMFEILQPGITSGIKFILNFDLERFYPQRVHNNMKIIKLCQSLSFNC-QNLDAEKLADSDKSSILSIILEMMRYYFAKDGINTKEMVEIINCEVKKKKRKGIINSFSDRAIVDDNLLAVIIDSKAPGLVDMACLNKDKLKNSRYLISIAHKAGIPIYTLPEHFVDGNASFIAIAFATLLTY 511          
BLAST of Plastin-3 vs. Planmine SMEST
Match: SMESG000070679.1 (SMESG000070679.1)

HSP 1 Score: 280.411 bits (716), Expect = 5.143e-86
Identity = 166/509 (32.61%), Postives = 277/509 (54.42%), Query Frame = 1
Query:  364 SERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINRTPKIMDYTQKIENLSLALNAAR---CHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAPADLKNKMVSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDDLKNGADRKETSAKLHLATLAYLFRNYSG-DLSSTGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQRVHNCTKIAKIAENYPLTIGSELDPEKMARFDKLTVLGLITEIMITY-------ISKNQWN----EKDAVDWVNDQFSRNNRRIS-IQNFADRIITEENLFAEILDAAAPGCLDRSCLSNNRLQNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLI 1842
            +E  ++S WINQ L  +  C++ LP+D   N +Y    DG++LCK++N S+P  ID RA+N   K+     K ENLSLA+ +A    C   N+G IDL    NG +  +L  LWQII+IG I  +N+  H E+  L + GES++++K+LSP EI+IR+VN+H+ K+ +   +  F+ D  D  +Y +L N+IAP++ ++KM+    I +   +  R+ +++ N   +NA AF+  +D+     + +   KL++A +A+LF NY   +++   +Q    + +  E L+E   RN++NS  ++P+ N+L  D RNG+    ++DV++P   N     T+F+  R   Q   NC      A+   L +   L  E +   +   VLGL  +++  Y       +  N +N    +KD ++W N +     +  S I++F D  I        ++D+  P  +D S ++NN L +AKY I+ A K G  +Y LP+H V+ N   I   +A L+
Sbjct:   34 AEERSYSDWINQALRNEEICQKYLPID--YNKLYEACSDGVLLCKMINYSVPDTIDMRAVNVGKKLETIFCKNENLSLAVQSASSIGCCVVNIGPIDLG---NGVKHIVLGLLWQIIRIGLIGKINLANHAELVALLRDGESLEDLKQLSPEEILIRWVNYHMEKANVSRRISNFNTDIMDSEIYTYLINQIAPSECRSKMMPPNEILRSNDNVQRAENVLSNASAMNAKAFVEANDIAMVTQKGKNREKLNMAFVAHLFNNYPALNITEKVIQE---FDIVEETLEEKTYRNWMNSMGVEPYLNYLYSDLRNGIALLHLIDVIQPKTVNWETVTTKFNPMRKLFQMQDNCLAFINYAKKLNLKLVG-LSAENIRETETTLVLGLCFQLLRKYTFQLLQKLQPNNFNKSVEDKDIIEWANKKCQSTGKSESVIRSFKDLNIRSSKPILHLIDSIKPNSVDYSMITNNPLDDAKYAITVARKIGANVYALPQHVVDLNQKMILTIYACLM 533          
BLAST of Plastin-3 vs. Planmine SMEST
Match: SMESG000081113.1 (SMESG000081113.1)

HSP 1 Score: 269.626 bits (688), Expect = 5.205e-81
Identity = 157/500 (31.40%), Postives = 275/500 (55.00%), Query Frame = 1
Query:  364 SERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLILCKLVNLSLPRIIDERAINRTPKIMDYTQKIENLSLALNAARCHGANLGAIDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDEVKELSPFEIIIRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAPADLKNKMVSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDDLKNGADRKETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSGECLDEYVCRNFLNSFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQRVHNCTKIAKIAENYPLTIGSELDPEKMARFDKLTVLGLITEIMITYISK-------NQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGCLDRSCLSNNRLQNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANLI 1842
            SE   FS WI++ L+ DP C   LP+    +++Y+K+QDG++LCKL+N ++P  +DER +N    +    +K ENL LA+N+A   G  +  I   ++  G +  IL  +WQ+I+IG +  VN+  H E+  L +  E++D++K+L+P E+++R+VN+HL K+G+   +  F ED +D  +Y+HL  +IAPAD +++M+   +I K   +  R+  ++ N  +L+A  F+  +D+     R +   KL+LA +A LF  Y   +  + ++      +  E L+E   RN++NS  + P+   +  D +NGL+  Q++D+L+PGI    + +  FD  +   Q + NC+ + + A+     I + L  + +       VLGL  +++ +Y  K        + ++KD + W N +    N+   I +F D  I       +++DA  P  +D   L+N  LQ+AK+ IS A + G  IY LP+H V+ N   +   +A L+
Sbjct:  121 SEERGFSNWISRVLSKDPLCAPYLPI--KHDELYNKLQDGVLLCKLINSAVPDTVDERVMNTGASLKSVFKKNENLCLAVNSAEAIGCCMVNIGPEDIDKGTKHLILGLVWQVIRIGLLGLVNLLHHAELVALLREDETLDDLKQLTPEELLLRWVNYHLEKAGITKRITNFKEDIQDSEIYSHLLYQIAPADKRDEMLPPISILKNTDNMKRAELMLGNASILDARVFIEPEDVAMVTQRGQNREKLNLAFVANLFNTYPALIVDSDIE------IREETLEEKTYRNWMNSMGVTPYVKDIYSDLKNGLVLLQLIDLLQPGIVEWKKIVRVFDPKKKVFQILGNCSYVIEYAKKLNFNIVN-LSADNIKDATPNMVLGLCFQMLRSYTMKLLSKVLPGKKDDKDIIGWANKKTEAANKTSKISSFKDPSIATSKPILDLIDAIVPNSVDFKLLTNEPLQDAKFTISQARRIGARIYALPQHLVDVNQKMVMTVYACLM 611          
The following BLAST results are available for this feature:
BLAST of Plastin-3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLS33.746e-7330.89plastin 3 [Source:HGNC Symbol;Acc:HGNC:9091][more]
PLS33.746e-7330.89plastin 3 [Source:HGNC Symbol;Acc:HGNC:9091][more]
PLS31.412e-7030.24plastin 3 [Source:HGNC Symbol;Acc:HGNC:9091][more]
PLS31.517e-7030.24plastin 3 [Source:HGNC Symbol;Acc:HGNC:9091][more]
LCP16.604e-6730.43lymphocyte cytosolic protein 1 [Source:HGNC Symbol... [more]
back to top
BLAST of Plastin-3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
plst-12.242e-3326.17PLaSTin (Actin bundling protein) homolog [Source:... [more]
plst-13.103e-3326.23PLaSTin (Actin bundling protein) homolog [Source:... [more]
Y73B3B.11.138e-1031.37pep chromosome:WBcel235:X:209108:211241:-1 gene:WB... [more]
back to top
BLAST of Plastin-3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Fim2.572e-7130.39gene:FBgn0024238 transcript:FBtr0074442[more]
Fim2.637e-7130.39gene:FBgn0024238 transcript:FBtr0074441[more]
Fim3.514e-7130.39gene:FBgn0024238 transcript:FBtr0074443[more]
back to top
BLAST of Plastin-3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pls32.048e-7032.12plastin 3 (T isoform) [Source:ZFIN;Acc:ZDB-GENE-04... [more]
pls32.048e-7032.12plastin 3 (T isoform) [Source:ZFIN;Acc:ZDB-GENE-04... [more]
pls13.250e-7029.08plastin 1 (I isoform) [Source:ZFIN;Acc:ZDB-GENE-03... [more]
pls16.374e-7029.08plastin 1 (I isoform) [Source:ZFIN;Acc:ZDB-GENE-03... [more]
lcp15.856e-6830.23lymphocyte cytosolic protein 1 (L-plastin) [Source... [more]
back to top
BLAST of Plastin-3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
colgalt24.544e-7331.13collagen beta(1-O)galactosyltransferase 2 [Source:... [more]
colgalt21.361e-7231.13collagen beta(1-O)galactosyltransferase 2 [Source:... [more]
colgalt21.452e-7231.13collagen beta(1-O)galactosyltransferase 2 [Source:... [more]
colgalt21.543e-7231.13collagen beta(1-O)galactosyltransferase 2 [Source:... [more]
colgalt21.559e-7231.13collagen beta(1-O)galactosyltransferase 2 [Source:... [more]
back to top
BLAST of Plastin-3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pls33.724e-7330.89plastin 3 (T-isoform) [Source:MGI Symbol;Acc:MGI:1... [more]
Pls33.844e-7330.89plastin 3 (T-isoform) [Source:MGI Symbol;Acc:MGI:1... [more]
Pls33.844e-7330.89plastin 3 (T-isoform) [Source:MGI Symbol;Acc:MGI:1... [more]
Pls33.844e-7330.89plastin 3 (T-isoform) [Source:MGI Symbol;Acc:MGI:1... [more]
Pls31.217e-7030.24plastin 3 (T-isoform) [Source:MGI Symbol;Acc:MGI:1... [more]
back to top
BLAST of Plastin-3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q63598|PLST_RAT6.031e-7331.26Plastin-3 OS=Rattus norvegicus OX=10116 GN=Pls3 PE... [more]
sp|P13797|PLST_HUMAN1.799e-7230.89Plastin-3 OS=Homo sapiens OX=9606 GN=PLS3 PE=1 SV=... [more]
sp|Q99K51|PLST_MOUSE2.689e-7230.89Plastin-3 OS=Mus musculus OX=10090 GN=Pls3 PE=1 SV... [more]
sp|A7E3Q8|PLST_BOVIN1.069e-7130.70Plastin-3 OS=Bos taurus OX=9913 GN=PLS3 PE=2 SV=1[more]
sp|O88818|PLST_CRIGR1.185e-7130.70Plastin-3 OS=Cricetulus griseus OX=10029 GN=PLS3 P... [more]
back to top
BLAST of Plastin-3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504YR621.524e-12537.70Plastin-1 OS=Fasciola gigantica OX=46835 GN=FGIG_0... [more]
A0A2H1C7H01.913e-12337.88Plastin-1 OS=Fasciola hepatica OX=6192 GN=D915_006... [more]
A0A0V0J8E52.126e-12338.40Plastin-3 OS=Schistocephalus solidus OX=70667 GN=P... [more]
A0A448WGW62.156e-12239.03Uncharacterized protein OS=Protopolystoma xenopodi... [more]
A0A4S2LJL11.916e-12138.89Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of Plastin-3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
lcp11.328e-7030.73lymphocyte cytosolic protein 1 (L-plastin) [Source... [more]
pls33.896e-5628.28plastin 3 (T isoform) [Source:ZFIN;Acc:ZDB-GENE-04... [more]
pls14.906e-4728.44plastin 1 (I isoform) [Source:ZFIN;Acc:ZDB-GENE-03... [more]
back to top
BLAST of Plastin-3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
lcp11.609e-1723.21lymphocyte cytosolic protein 1 (L-plastin) [Source... [more]
back to top
BLAST of Plastin-3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SAC61.705e-4925.84Fimbrin, actin-bundling protein; cooperates with S... [more]
back to top
BLAST of Plastin-3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO324848.883e-5628.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO403827.777e-5127.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO324865.783e-931.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Plastin-3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pls31.249e-6930.93plastin-3 [Source:NCBI gene;Acc:101161915][more]
lcp12.107e-6930.31plastin-2 [Source:NCBI gene;Acc:101162720][more]
pls11.453e-6628.03plastin-1 [Source:NCBI gene;Acc:101168586][more]
pls13.558e-6628.03plastin-1 [Source:NCBI gene;Acc:101168586][more]
ENSORLT00000011106.25.333e-6430.46plastin-3-like [Source:NCBI gene;Acc:101157305][more]
back to top
BLAST of Plastin-3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000042101.10.000e+099.80SMESG000042101.1[more]
SMESG000048251.10.000e+054.49SMESG000048251.1[more]
SMESG000036396.10.000e+051.99SMESG000036396.1[more]
SMESG000070679.15.143e-8632.61SMESG000070679.1[more]
SMESG000081113.15.205e-8131.40SMESG000081113.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021934 ID=SMED30021934|Name=Plastin-3|organism=Schmidtea mediterranea sexual|type=transcript|length=2034bp
ATGCAATGCTTCCTATAAAATGACTCTGTCAATTTCTACTCAGTTTCCTT
TGACAAGGTCTGTGACTTCTCAGACCTATGAAAAAGATTTCTTATGATCC
TTTCTGGATAGTGTTTCAGCTTCAATTATAAAAGGTTTTGTTTTTTATTA
AAAAATTGTATGTCTTGTTTATTTTGCACAACAGTAAAAAAAATTACTTT
TTACTAAAAGTGTACAAAAATTAAATTAAGTGATAAAAATTGAATTCTTT
TAATAGATCGCTTTTAAACGTAAATATAAATTTACCATAATCAATAATAA
AGAAGTTACTTTCAAATTTTTATACTCGTAGCAACAAAGATGACTACTGG
AATTCACGAACCCTCAGAAAGAGCTGCTTTTTCTCGATGGATTAATCAAA
AATTAGCAGCAGATCCTGATTGCCGGCAGCTGCTTCCATTAGATCCAAAC
AGCAATGATGTCTATTCGAAAGTTCAAGACGGCTTAATTTTATGTAAACT
TGTTAATCTAAGCTTGCCACGAATTATTGACGAAAGAGCCATTAATAGAA
CTCCAAAAATAATGGATTACACACAAAAAATTGAAAACCTTTCATTGGCC
TTGAATGCTGCCCGATGTCATGGTGCCAATCTTGGTGCCATCGATTTGAA
TGAAGTTTATAATGGCAATCAAACTACAATTTTGGAATTTTTGTGGCAAA
TAATCAAAATCGGATTCATTCAAGATGTTAATATTCATTTTCATCCAGAA
ATTGCTGATCTTAAAAAGACAGGAGAATCGATCGACGAAGTGAAAGAATT
GTCTCCGTTTGAAATAATTATTAGATATGTAAATTTTCATTTGGCTAAAA
GCGGTCTCAGACACATGGTAAAAGGTTTTGATGAAGATTTTCGAGATTGT
ATTGTCTATGCTCACTTAACAAATCGTATAGCTCCCGCAGACCTAAAAAA
CAAAATGGTATCATCAGGAACAATAACGAAAGAAAAGTTTTCCGATATGA
GGTCATCTAGCATCATTGAAAATTTAAAATTGTTAAACGCGGATGCTTTT
CTAATAGAAGACGATTTAAAAAATGGCGCCGATCGCAAAGAAACTTCAGC
AAAACTTCATTTAGCGACTTTGGCGTATTTATTCCGTAATTATTCCGGTG
ATTTGTCATCAACTGGAGTTCAGCGTGGAAAGCCGTATTCCGTCAGTGGG
GAATGTCTCGATGAATATGTTTGTAGAAATTTTCTCAACTCATTCGATAT
CCAGCCTTTTACTAATCATTTGCTTGTTGATTGTAGAAATGGATTGATAT
ATAGTCAAATACTTGACGTGTTACGACCGGGAATCTGCAATGGATTGCGT
TTCATGACAGAATTCGATGGCAGCAGATCTCATCCTCAACGAGTTCACAA
TTGTACAAAAATCGCCAAAATAGCTGAAAACTATCCATTAACAATTGGCA
GTGAATTAGATCCGGAAAAAATGGCGAGATTTGATAAATTGACTGTATTA
GGGTTAATCACAGAAATCATGATAACGTATATCAGTAAGAATCAATGGAA
TGAAAAGGATGCAGTTGATTGGGTGAATGATCAATTTTCTAGAAACAATA
GGAGAATTTCAATTCAGAATTTTGCAGATAGAATAATTACTGAAGAAAAT
CTTTTTGCAGAAATTCTCGATGCTGCTGCTCCCGGTTGTCTGGATCGTTC
ATGCTTGAGTAACAATAGACTGCAAAATGCAAAATATTATATTTCTACTG
CTTGGAAAGCTGGCTTGCCGATTTATACACTCCCAGAGCATTTCGTTGAA
AATAATGCGACTTTTATTGCAATGGCCTTTGCTAACTTGATTCCATATTA
AATTGATTTCCGCGTTTCAATGACACAAAAAAACAATTTTTTAATTTTCT
AAACTTATTTATGGTAATCTAAATGACTGTCGGAAATTGTGTAGAATGGA
TATTATTCTTTCGCAATATTATTTAAGATTTTCTTAATTACAGATTCTCC
ATGTAACTGTATGTTTGATAAATGTAAGCGAATA
back to top

protein sequence of SMED30021934-orf-1

>SMED30021934-orf-1 ID=SMED30021934-orf-1|Name=SMED30021934-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=504bp
MTTGIHEPSERAAFSRWINQKLAADPDCRQLLPLDPNSNDVYSKVQDGLI
LCKLVNLSLPRIIDERAINRTPKIMDYTQKIENLSLALNAARCHGANLGA
IDLNEVYNGNQTTILEFLWQIIKIGFIQDVNIHFHPEIADLKKTGESIDE
VKELSPFEIIIRYVNFHLAKSGLRHMVKGFDEDFRDCIVYAHLTNRIAPA
DLKNKMVSSGTITKEKFSDMRSSSIIENLKLLNADAFLIEDDLKNGADRK
ETSAKLHLATLAYLFRNYSGDLSSTGVQRGKPYSVSGECLDEYVCRNFLN
SFDIQPFTNHLLVDCRNGLIYSQILDVLRPGICNGLRFMTEFDGSRSHPQ
RVHNCTKIAKIAENYPLTIGSELDPEKMARFDKLTVLGLITEIMITYISK
NQWNEKDAVDWVNDQFSRNNRRISIQNFADRIITEENLFAEILDAAAPGC
LDRSCLSNNRLQNAKYYISTAWKAGLPIYTLPEHFVENNATFIAMAFANL
IPY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0051017actin filament bundle assembly
GO:0006260DNA replication
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000208testis
PLANA:0000220spermatogonium
PLANA:0000221spermatocyte
PLANA:0000222spermatid
PLANA:0000419prepharyngeal region
PLANA:0002109X1 cell
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR036872CH_dom_sf
IPR039959Fimbrin/Plastin
IPR001715CH-domain
IPR003133T_Ag_DNA-bd
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003688DNA replication origin binding
GO:0003779actin binding
GO:0051015actin filament binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001715Calponin homology domainSMARTSM00033ch_5coord: 404..503
e-value: 1.1
score: 6.3
coord: 10..124
e-value: 3.0E-14
score: 63.3
coord: 291..396
e-value: 1.6
score: 4.2
IPR001715Calponin homology domainPFAMPF00307CHcoord: 9..124
e-value: 2.4E-17
score: 63.1
coord: 404..501
e-value: 3.0E-6
score: 27.4
coord: 158..267
e-value: 2.0E-6
score: 27.9
IPR001715Calponin homology domainPROSITEPS50021CHcoord: 289..398
score: 10.439
IPR001715Calponin homology domainPROSITEPS50021CHcoord: 8..126
score: 18.999
IPR001715Calponin homology domainPROSITEPS50021CHcoord: 154..269
score: 10.432
IPR001715Calponin homology domainPROSITEPS50021CHcoord: 402..503
score: 11.543
IPR001715Calponin homology domainCDDcd00014CHcoord: 9..125
e-value: 4.00987E-15
score: 69.2619
IPR036872CH domain superfamilyGENE3DG3DSA:1.10.418.10coord: 400..502
e-value: 1.0E-14
score: 56.4
IPR036872CH domain superfamilyGENE3DG3DSA:1.10.418.10coord: 129..265
e-value: 6.1E-19
score: 70.3
IPR036872CH domain superfamilyGENE3DG3DSA:1.10.418.10coord: 5..128
e-value: 2.7E-32
score: 113.2
IPR036872CH domain superfamilyGENE3DG3DSA:1.10.418.10coord: 290..399
e-value: 2.6E-7
score: 32.6
IPR036872CH domain superfamilySUPERFAMILYSSF47576Calponin-homology domain, CH-domaincoord: 8..500
NoneNo IPR availablePANTHERPTHR19961:SF18FI19014P1coord: 8..501
IPR039959Fimbrin/PlastinPANTHERPTHR19961FIMBRIN/PLASTINcoord: 8..501