Chloride channel accessory 1

Overview
NameChloride channel accessory 1
Smed IDSMED30021926
Length (bp)946
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Chloride channel accessory 1 (SMED30021926) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Chloride channel accessory 1 (SMED30021926) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021926

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30021926SMESG000080918.1 SmedASXL_013589SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
parenchymal cellSMED30021926SMESG000080918.1 dd_Smed_v4_3663_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30021926SMESG000080918.1 dd_Smed_v6_3663_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Chloride channel accessory 1 vs. Ensembl Human
Match: CLCA1 (chloride channel accessory 1 [Source:HGNC Symbol;Acc:HGNC:2015])

HSP 1 Score: 117.472 bits (293), Expect = 1.436e-28
Identity = 99/314 (31.53%), Postives = 150/314 (47.77%), Query Frame = 2
Query:   38 RQYKKTNSDASIALYEATSNMGGKEYGVKFGKVSIIIPSHWKLKGD-SNSGLHC-GDAQINILPKTPK--NIPFTKQLRKCGISGEYISIPTDIL---KLT---GRGRQIMREYVKLRYGVYDEEVINNQAKVLTKDGLVNSV-CNSNI-------ELEFERPHTKMIKCTDSNDL----CHFKIKKNQNHNYSVMFDTETPSSKYFCDDKNRPHNKYAKNYQNKLCNQKSITSVILNHTDFKNVFSFPKIYYELPTFNIIQTKHRKIVLILDISGSMA--DYIATMKNAIKEFVNNLIEDTAEIGLVTFSDSA 907
            +Q K   + AS+ L EAT    GK +   F  V+I+IP  WK K D     L    +A + +   TP   + P+T+Q+  CG  GE I +  D +   KL     +GR  + E+  LR+GV+DE   NN  K    +G + +V C++ I       + +    +TK         L    C F ++  Q    S+MF     S   FC ++N  HNK A N QN+ CN +S   VI +  DFK            PTF+++Q   R + L+LD SGSMA  + +  +  A + F+   +E  + +G+VTF  +A
Sbjct:   51 QQIKDMVTQASLYLLEAT----GKRF--YFKNVAILIPETWKTKADYVRPKLETYKNADVLVAESTPPGNDEPYTEQMGNCGEKGERIHLTPDFIAGKKLAEYGPQGRAFVHEWAHLRWGVFDE--YNNDEKFYLSNGRIQAVRCSAGITGTNVVKKCQGGSCYTKRCTFNKVTGLYEKGCEFVLQSRQTEKASIMFAQHVDSIVEFCTEQN--HNKEAPNKQNQKCNLRSTWEVIRDSEDFKKTTPM-TTQPPNPTFSLLQIGQRIVCLVLDKSGSMATGNRLNRLNQAGQLFLLQTVELGSWVGMVTFDSAA 353          
BLAST of Chloride channel accessory 1 vs. Ensembl Human
Match: CLCA1 (chloride channel accessory 1 [Source:HGNC Symbol;Acc:HGNC:2015])

HSP 1 Score: 117.472 bits (293), Expect = 1.436e-28
Identity = 99/314 (31.53%), Postives = 150/314 (47.77%), Query Frame = 2
Query:   38 RQYKKTNSDASIALYEATSNMGGKEYGVKFGKVSIIIPSHWKLKGD-SNSGLHC-GDAQINILPKTPK--NIPFTKQLRKCGISGEYISIPTDIL---KLT---GRGRQIMREYVKLRYGVYDEEVINNQAKVLTKDGLVNSV-CNSNI-------ELEFERPHTKMIKCTDSNDL----CHFKIKKNQNHNYSVMFDTETPSSKYFCDDKNRPHNKYAKNYQNKLCNQKSITSVILNHTDFKNVFSFPKIYYELPTFNIIQTKHRKIVLILDISGSMA--DYIATMKNAIKEFVNNLIEDTAEIGLVTFSDSA 907
            +Q K   + AS+ L EAT    GK +   F  V+I+IP  WK K D     L    +A + +   TP   + P+T+Q+  CG  GE I +  D +   KL     +GR  + E+  LR+GV+DE   NN  K    +G + +V C++ I       + +    +TK         L    C F ++  Q    S+MF     S   FC ++N  HNK A N QN+ CN +S   VI +  DFK            PTF+++Q   R + L+LD SGSMA  + +  +  A + F+   +E  + +G+VTF  +A
Sbjct:   51 QQIKDMVTQASLYLLEAT----GKRF--YFKNVAILIPETWKTKADYVRPKLETYKNADVLVAESTPPGNDEPYTEQMGNCGEKGERIHLTPDFIAGKKLAEYGPQGRAFVHEWAHLRWGVFDE--YNNDEKFYLSNGRIQAVRCSAGITGTNVVKKCQGGSCYTKRCTFNKVTGLYEKGCEFVLQSRQTEKASIMFAQHVDSIVEFCTEQN--HNKEAPNKQNQKCNLRSTWEVIRDSEDFKKTTPM-TTQPPNPTFSLLQIGQRIVCLVLDKSGSMATGNRLNRLNQAGQLFLLQTVELGSWVGMVTFDSAA 353          
BLAST of Chloride channel accessory 1 vs. Ensembl Human
Match: CLCA4 (chloride channel accessory 4 [Source:HGNC Symbol;Acc:HGNC:2018])

HSP 1 Score: 106.301 bits (264), Expect = 8.494e-25
Identity = 91/324 (28.09%), Postives = 142/324 (43.83%), Query Frame = 2
Query:   26 RRISRQYKKTNSDASIALYEATSNMGGKEYGVKFGKVSIIIPSHWKLKGDSNSGLHCGDAQINILPKTP----KNIPFTKQLRKCGISGEYISIPTDIL------KLTGRGRQIMREYVKLRYGVYDEEVINNQAKVLTKDGLVNSVCNSNIELEFERPHTKMIKCTDSNDL----------------CHFKIKKNQNHNYSVMFDTETPSSKYFCDDKNRPHNKYAKNYQNKLCNQKSITSVILNHTDFKNVFSFPKI-YYELPTFNIIQTKHRKIVLILDISGSMA--DYIATMKNAIKEFVNNLIEDTAEIGLVTFSDSAS 910
             +I  Q +   + AS  L+EAT      E    F  VSI+IP +WK         H      +++   P    ++ P+TKQ  +CG  GEYI    D+L      +    G+  + E+  LR+GV+DE   +          +  + C++ I         ++ KC   + L                C F   K Q    S+MF     S   FC++K   HN+ A + QN  CN +S   VI N  DFKN  + P +     P F++++   R + L+LD SGSM   D +  M  A K F+   +E+ + +G+V F  +A+
Sbjct:   46 EKIIEQIEDMVTTASTYLFEAT------EKRFFFKNVSILIPENWKENPQYKRPKHENHKHADVIVAPPTLPGRDEPYTKQFTECGEKGEYIHFTPDLLLGKKQNEYGPPGKLFVHEWAHLRWGVFDEYNEDQPFYRAKSKKIEATRCSAGIS-----GRNRVYKCQGGSCLSRACRIDSTTKLYGKDCQFFPDKVQTEKASIMFMQSIDSVVEFCNEKT--HNQEAPSLQNIKCNFRSTWEVISNSEDFKN--TIPMVTPPPPPVFSLLKISQRIVCLVLDKSGSMGGKDRLNRMNQAAKHFLLQTVENGSWVGMVHFDSTAT 354          
BLAST of Chloride channel accessory 1 vs. Ensembl Human
Match: CLCA2 (chloride channel accessory 2 [Source:HGNC Symbol;Acc:HGNC:2016])

HSP 1 Score: 100.523 bits (249), Expect = 7.372e-23
Identity = 85/303 (28.05%), Postives = 140/303 (46.20%), Query Frame = 2
Query:   47 KKTNSDASIALYEATSNMGGKEYGVKFGKVSIIIPSHWKLKGDS---NSGLHCGDAQINILPKTPKNIPFTKQLRKCGISGEYISIPTDIL---KLTG----RGRQIMREYVKLRYGVYDEEVINNQAKVLTKDGLVNSVCNSNIELEF--ERPHTKMIKCTDSN---DLCHFKIKKNQNHNYSVMFDTETPSSKYFCDDKNRPHNKYAKNYQNKLCNQKSITSVILNHTDFKNVFSFPKIYYEL---PTFNIIQTKHRKIVLILDISGSM--ADYIATMKNAIKEFVNNLIEDTAEIGLVTF 895
            K+  ++AS  L+ AT         V F  + I+IP+ WK   +S          +  +        + P+T Q R CG  G+YI    + L    LT     RGR  + E+  LR+GV+DE   +    +  ++ +  + C+S+I   F  E+       C  S    + C F     QN   S+MF     S   FC+     HN+ A N QN++C+ +S   VI +  DF +  SFP    EL   PTF+++Q   + + L+LD+S  M  AD +  ++ A + ++  ++E    +G+ +F
Sbjct:   62 KEMITEASFYLFNATKRR------VFFRNIKILIPATWKANNNSKIKQESYEKANVIVTDWYGAHGDDPYTLQYRGCGKEGKYIHFTPNFLLNDNLTAGYGSRGRVFVHEWAHLRWGVFDEYNNDKPFYINGQNQIKVTRCSSDITGIFVCEKGPCPQENCIISKLFKEGCTFIYNSTQNATASIMFMQSLSSVVEFCNAST--HNQEAPNLQNQMCSLRSAWDVITDSADFHH--SFPMNGTELPPPPTFSLVQAGDKVVCLVLDVSSKMAEADRLLQLQQAAEFYLMQIVEIHTFVGIASF 354          
BLAST of Chloride channel accessory 1 vs. Ensembl Zebrafish
Match: clca1 (chloride channel accessory 1 [Source:ZFIN;Acc:ZDB-GENE-030131-6221])

HSP 1 Score: 118.242 bits (295), Expect = 4.350e-29
Identity = 101/316 (31.96%), Postives = 143/316 (45.25%), Query Frame = 2
Query:   47 KKTNSDASIALYEATSNMGGKEYGVKFGKVSIIIPSHWKLKGDSNSGLHCGDAQINILPKTPKNI-------PFTKQLRKCGISGEYISIPTDIL------KLTG-RGRQIMREYVKLRYGVYDEEVINNQAKVLTKDGLVN-SVCNSNIELE-FERPHTKMIKC-------TDSNDLCHFKIKKNQNHNYSVMFDTETPSSKYFCDDKNRPHNKYAKNYQNKLCNQKSITSVILNHTDFKNVFSFPKIYYELPT---FNIIQTKHRKIVLILDISGSMA--DYIATMKNAIKEFVNNLIEDTAEIGLVTFSDSAS 910
            K+  +D S  LY A       +  V     +I++PSHW  K        C  A+     K    I       P TK   +CG  GEYI    D L      ++ G RG+  + E+  LR+GVYDE   N +      +G V  + C +NIE + FE        C         S+D C F   K+QN + SVMF     +   FC  +   HN  A+  QN +CN K+  +VI   +  K+  SF       P+   F ++Q K R + LILD+SGSMA    I  M+ A    + N +E+ A +G+V FS +AS
Sbjct:   50 KEMVTDGSFYLYHAL------DKKVYLKDATILVPSHWSCKS-------CSKARTESFEKAKIKIDHAKLMEPRTKLYGECGKGGEYIHFTPDFLLNDSAIQMYGPRGKVFLHEWAHLRWGVYDE--YNEEKPFYLSNGRVEYTRCTTNIEGQIFEVNGGSPQSCRINPETFLPSSD-CKFFPNKDQNTDSSVMFSPSLEAVTTFC--RETEHNYEAETQQNIICNNKATWTVIFEDSVDKDALSFLPPLPSTPSPPIFKLLQRKKRAVCLILDVSGSMATESRILRMRQAATHLLRNYVEEQASVGIVKFSTAAS 347          
BLAST of Chloride channel accessory 1 vs. Ensembl Zebrafish
Match: clca1 (chloride channel accessory 1 [Source:ZFIN;Acc:ZDB-GENE-030131-6221])

HSP 1 Score: 108.227 bits (269), Expect = 1.085e-25
Identity = 88/307 (28.66%), Postives = 140/307 (45.60%), Query Frame = 2
Query:   59 SDASIALYEATSNMGGKEYGVKFGKVSIIIPSHWKLKGDSNSG---LHCGDAQINILPKTPKNIPFTKQLRKCGISGEYISIPTDILK------LTG-RGRQIMREYVKLRYGVYDEEVINNQAKVLTKDGLVNSVCNSNIELEFE-------RPHTKMIKCTDSNDLCHFKIKKNQNHNYSVMFDTETPSSKYFCDDKNRPHNKYAKNYQNKLCNQKSITSVILNHTDFKNVFSFPKIYYE---LPTFNIIQTKHRKIVLILDISGSM-ADYIATMKNAIKEFVNNLIEDTAEIGLVTFSDSASKL 916
            ++ S+ LY+A       +  V F +V+I++P +W  KG + +       G  +I+       + P+T Q  +CG  G+YI    + L+      L G RG+ ++ E+  LR+GVYDE              +  + C+ NIE +         +P     + +   D C F   K Q+ + S+M      S   FC  +   HN  A N QN  C+ K+  +VI   +  K+     K        P F ++Q   R + L+LD+SGSM    I  ++ A   F+ N+IED + + LVTFS  AS L
Sbjct:   59 TEGSVHLYKAL------DKKVYFKEVTILVPLNWNSKGFTKARTELFETGMIRIDNPHPAYGDEPYTNQYGECGAEGQYIHFTPNFLRDDKLIRLYGSRGKVLVHEWAHLRWGVYDEYSEKTPFYRSASGKIEATRCSKNIEGQLYDVTADPLQPCQNDPQTSLPTDGCRFIPNKYQSTDSSMMSLPSLDSVITFC--RESEHNYEAPNLQNAKCSNKATWTVIFEDSVDKDALRSLKPMASTPPAPNFKVVQRMQRTVCLVLDVSGSMKGSRILRLQQASAHFLQNIIEDQSSVALVTFSTDASTL 357          
BLAST of Chloride channel accessory 1 vs. Ensembl Zebrafish
Match: clca1 (chloride channel accessory 1 [Source:ZFIN;Acc:ZDB-GENE-030131-6221])

HSP 1 Score: 73.1738 bits (178), Expect = 7.517e-14
Identity = 48/141 (34.04%), Postives = 68/141 (48.23%), Query Frame = 2
Query:  506 DLCHFKIKKNQNHNYSVMFDTETPSSKYFCDDKNRPHNKYAKNYQNKLCNQKSITSVILNHTDFKNVFSFPKIYYE---LPTFNIIQTKHRKIVLILDISGSM-ADYIATMKNAIKEFVNNLIEDTAEIGLVTFSDSASKL 916
            D C F   K Q+ + S+M      S   FC  +   HN  A N QN  C+ K+  +VI   +  K+     K        P F ++Q   R + L+LD+SGSM    I  ++ A   F+ N+IED + + LVTFS  AS L
Sbjct:   43 DGCRFIPNKYQSTDSSMMSLPSLDSVITFC--RESEHNYEAPNLQNAKCSNKATWTVIFEDSVDKDALRSLKPMASTPPAPNFKVVQRMQRTVCLVLDVSGSMKGSRILRLQQASAHFLQNIIEDQSSVALVTFSTDASTL 181          
BLAST of Chloride channel accessory 1 vs. Ensembl Zebrafish
Match: clca1 (chloride channel accessory 1 [Source:ZFIN;Acc:ZDB-GENE-030131-6221])

HSP 1 Score: 67.0106 bits (162), Expect = 5.920e-12
Identity = 40/113 (35.40%), Postives = 57/113 (50.44%), Query Frame = 2
Query:  590 FCDDKNRPHNKYAKNYQNKLCNQKSITSVILNHTDFKNVFSFPKIYYE---LPTFNIIQTKHRKIVLILDISGSM-ADYIATMKNAIKEFVNNLIEDTAEIGLVTFSDSASKL 916
            FC  +   HN  A N QN  C+ K+  +VI   +  K+     K        P F ++Q   R + L+LD+SGSM    I  ++ A   F+ N+IED + + LVTFS  AS L
Sbjct:    9 FC--RESEHNYEAPNLQNAKCSNKATWTVIFEDSVDKDALRSLKPMASTPPAPNFKVVQRMQRTVCLVLDVSGSMKGSRILRLQQASAHFLQNIIEDQSSVALVTFSTDASTL 119          
BLAST of Chloride channel accessory 1 vs. Ensembl Zebrafish
Match: si:ch211-116o3.3 (si:ch211-116o3.3 [Source:ZFIN;Acc:ZDB-GENE-131121-462])

HSP 1 Score: 53.5286 bits (127), Expect = 6.110e-8
Identity = 33/97 (34.02%), Postives = 50/97 (51.55%), Query Frame = 2
Query:  119 VKFGKVSIIIPSHWKLKGDSNSGLHCGD-AQINILPKTPK--NIPFTKQLRKCGISGEYISIPTDIL------KLTG-RGRQIMREYVKLRYGVYDE 379
            V F + +I++P HW  K  S +     + A+I I    P   + P+T Q  +CG  G+Y     + L      KL G RG+ ++ E+  LR+GVYDE
Sbjct:   68 VYFKEATILVPPHWSTKDFSRARTETFEKAKIRIDSPHPAYGDEPYTNQYGECGAEGQYFHFTPNFLRDDKLIKLYGSRGKVLVHEWAHLRWGVYDE 164          
BLAST of Chloride channel accessory 1 vs. Ensembl Xenopus
Match: ENSXETT00000026373.1 (chloride channel accessory 1 gene 2 [Source:NCBI gene;Acc:100490932])

HSP 1 Score: 118.627 bits (296), Expect = 4.919e-29
Identity = 88/303 (29.04%), Postives = 145/303 (47.85%), Query Frame = 2
Query:   62 DASIALYEATSNMGGKEYGVKFGKVSIIIPSHWKLKGDSNSGLHCGDAQINILPKTP----KNIPFTKQLRKCGISGEYISIPTDIL------KLTG-RGRQIMREYVKLRYGVYDEEVINNQAKVLTKDGLVNSVCNSNI-----ELEFERPHTKMIKCTDSNDLCHFKIKKNQNHNYSVMFDTETPSSKYFCDDKNRPHNKYAKNYQNKLCNQKSITSVILNHTDFKNVFSFPKIYYELPTFNIIQTKHRKIVLILDISGSMAD--YIATMKNAIKEFVNNLIEDTAEIGLVTFSDSASKL 916
            +AS  L+ AT N       V    V I+IP  W     + +     D + +++  +P     + P+T Q  +CG +G+YI +  D L       + G RGR  + E+  LR+GV+DE        +     +  + C+++I     +    +P  +  +     D C F  ++NQ    S+M+    PS   FCD   + HN  A   QN++CN +S   VI+N TD K           +PTF ++Q+  R + L+LD+SGSMA    I  +  A + FV  ++E+ + +G+V+FS S + L
Sbjct:   57 EASQYLFSATKNR------VYIRSVKILIPITWPNNNYAKAKTETYD-KADVIIASPHLKFGDDPYTLQYGRCGEAGKYIHMTPDFLLNDNLISIYGPRGRVFVHEWAHLRWGVFDEYNYEKPFYIAGNKNIEATRCSADIIGTHIKQPQGQPCNRDPQTGLYEDGCVFVPEQNQAAKASIMYLQALPSVTEFCD---KNHNTEAPTLQNRICNSRSTWDVIMNSTDIKATPPQADSNLPVPTFTLLQSSDRVVTLVLDVSGSMASDGRIGRLYQAAEVFVMQIVEEGSHVGIVSFSTSTTVL 349          
BLAST of Chloride channel accessory 1 vs. Ensembl Xenopus
Match: ENSXETT00000038434.1 (chloride channel accessory 1 gene 2 [Source:NCBI gene;Acc:100490932])

HSP 1 Score: 118.627 bits (296), Expect = 4.922e-29
Identity = 88/303 (29.04%), Postives = 145/303 (47.85%), Query Frame = 2
Query:   62 DASIALYEATSNMGGKEYGVKFGKVSIIIPSHWKLKGDSNSGLHCGDAQINILPKTP----KNIPFTKQLRKCGISGEYISIPTDIL------KLTG-RGRQIMREYVKLRYGVYDEEVINNQAKVLTKDGLVNSVCNSNI-----ELEFERPHTKMIKCTDSNDLCHFKIKKNQNHNYSVMFDTETPSSKYFCDDKNRPHNKYAKNYQNKLCNQKSITSVILNHTDFKNVFSFPKIYYELPTFNIIQTKHRKIVLILDISGSMAD--YIATMKNAIKEFVNNLIEDTAEIGLVTFSDSASKL 916
            +AS  L+ AT N       V    V I+IP  W     + +     D + +++  +P     + P+T Q  +CG +G+YI +  D L       + G RGR  + E+  LR+GV+DE        +     +  + C+++I     +    +P  +  +     D C F  ++NQ    S+M+    PS   FCD   + HN  A   QN++CN +S   VI+N TD K           +PTF ++Q+  R + L+LD+SGSMA    I  +  A + FV  ++E+ + +G+V+FS S + L
Sbjct:   57 EASQYLFSATKNR------VYIRSVKILIPITWPNNNYAKAKTETYD-KADVIIASPHLKFGDDPYTLQYGRCGEAGKYIHMTPDFLLNDNLISIYGPRGRVFVHEWAHLRWGVFDEYNYEKPFYIAGNKNIEATRCSADIIGTHIKQPQGQPCNRDPQTGLYEDGCVFVPEQNQAAKASIMYLQALPSVTEFCD---KNHNTEAPTLQNRICNSRSTWDVIMNSTDIKATPPQADSNLPVPTFTLLQSSDRVVTLVLDVSGSMASDGRIGRLYQAAEVFVMQIVEEGSHVGIVSFSTSTTVL 349          
BLAST of Chloride channel accessory 1 vs. Ensembl Xenopus
Match: gnl3 (guanine nucleotide binding protein-like 3 (nucleolar) [Source:Xenbase;Acc:XB-GENE-6456133])

HSP 1 Score: 118.242 bits (295), Expect = 7.955e-29
Identity = 89/304 (29.28%), Postives = 146/304 (48.03%), Query Frame = 2
Query:   65 ASIALYEATSNMGGKEYGVKFGKVSIIIPSHWKLKGDSNSGLHCGDAQINILPKTP----KNIPFTKQLRKCGISGEYISIPTDIL------KLTG-RGRQIMREYVKLRYGVYDEEVINNQAKVLTKDGLVNSVCNSNIELEFERP-HTKMIKCTDS------NDLCHFKIKKNQNHNYSVMFDTETPSSKYFCDDKNRPHNKYAKNYQNKLCNQKSITSVILNHTDFKNVFSFPKIYYELPTFNIIQTKHRKIVLILDISGSMAD--YIATMKNAIKEFVNNLIEDTAEIGLVTFSDSASKL 916
            AS  L+ AT N       V    V I+IP  W  K  + +     + + +++  TP     + P+T Q   CG +G+YI +  D L       + G RGR  + E+  LR+GV+DE        +     +  + C+++I   + +P   +  KC          D C F  ++N     S+M+    PS   FCD   + HN  A   QN++CN +S   VI+N TD K+          +P+F+++Q+  R + L+LD+SGSMA    I  +  A + F+  ++E+ + +G++TFS S S L
Sbjct:   58 ASHYLFNATRNR------VYIKSVKILIPMTWSNKSYTKARTETYN-KADVIIATPHLKFGDDPYTLQYGGCGEAGKYIHMTPDFLLNDVLVSVYGPRGRVFVHEWAHLRWGVFDEYNYEKPFYITGDKNIEATRCSADITGTYIKPCQGQTCKCIRDPQTGLYEDDCVFVPERNGAAKASIMYLQALPSVTEFCD---KNHNTEAPTLQNRICNSRSTWDVIMNSTDIKSTPPQADSNIPVPSFSLLQSSDRVVTLVLDVSGSMASGGRIERLYQAAEVFLMQIVEEGSYVGILTFSTSISLL 351          
BLAST of Chloride channel accessory 1 vs. Ensembl Xenopus
Match: ENSXETT00000038492.1 (chloride channel accessory 4 gene 1 [Source:NCBI gene;Acc:100488301])

HSP 1 Score: 111.694 bits (278), Expect = 1.096e-26
Identity = 70/235 (29.79%), Postives = 114/235 (48.51%), Query Frame = 2
Query:  242 PFTKQLRKCGISGEYISIPTDIL-------KLTGRGRQIMREYVKLRYGVYDEEVINNQAKVLTKDGLVNSVCNSNIELEFERPHTKMIKCTDSNDL--------CHFKIKKNQNHNYSVMFDTETPSSKYFCDDKNRPHNKYAKNYQNKLCNQKSITSVILNHTDFKNVFSFPKIYYELPTFNIIQTKHRKIVLILDISGSM--ADYIATMKNAIKEFVNNLIEDTAEIGLVTF 895
            P+T Q  +CG  G YI +  D L       +   RGR  + E+  LR+GV+DE   +    +     +  + C+++I+  + + + +   C  S D         C F  +  Q+   S+M+    PS   FCD K   HN  A   QN++C  +S   VI N TD K+          +P+F+++Q   R + L+LD+SGSM  ++ I     A++ FV  +IE+ A +G+V F
Sbjct:  116 PYTLQYGRCGEPGRYIHLTPDFLVNDKMISQYGPRGRVFVHEWAHLRWGVFDEYNYDKPFYIAANGDVEATRCSADIKGTYTKRNCQGKPCNCSPDPKTGLYEDDCVFVPETYQSVKESIMYLQALPSVSEFCDSK---HNTEAPTLQNRMCESRSTWDVISNSTDIKSTVPRADFNIPVPSFSLLQFSERVVSLVLDVSGSMSSSNRIGRQLQAVELFVVQIIENGAHVGIVKF 347          
BLAST of Chloride channel accessory 1 vs. Ensembl Xenopus
Match: csnk2a2 (casein kinase 2 alpha 2 [Source:Xenbase;Acc:XB-GENE-487069])

HSP 1 Score: 107.842 bits (268), Expect = 2.296e-25
Identity = 73/243 (30.04%), Postives = 116/243 (47.74%), Query Frame = 2
Query:  242 PFTKQLRKCGISGEYISIPTDIL------KLTGRGRQIMREYVKLRYGVYDEEVINNQAKVLTKDGLVNSVCNSNI-ELEFERPHTKMIKCTDS------NDLCHFKIKKNQNHNYSVMFDTETPSSKYFCDDKNRPHNKYAKNYQNKLCNQKSITSVILNHTDFKNV-----FSFPKIYYELPTFNIIQTKHRKIVLILDISGSM--ADYIATMKNAIKEFVNNLIEDTAEIGLVTFSDSAS 910
            P+T Q  +CG  G+YI +  D L          RGR  + E+  LR+GV+DE        +     +  + C+++I     ++   K  KC          D C F   KNQ    S+M+     S   FCD   + HN  A   QN++CN +S   VI+N TD K+       + P +    P+F+++Q+  R + L+LD+SGSM   + I  +  A + FV  ++E  + +G+V F  +AS
Sbjct:  115 PYTLQYGRCGEPGKYIHMTPDFLLNDLISTYGPRGRAFVHEWAHLRWGVFDEYNYEKPFYIAGNKNIEATRCSADIIGTHIKQCQGKTCKCARDPQTGLYEDGCVFVPDKNQVPKASIMYLQALQSVTEFCD---KNHNTEAPTLQNRICNSRSTWDVIMNSTDIKSTPPQADSNIPAV----PSFSLLQSSERVVTLVLDVSGSMGGGNRIGRLYQAAEVFVMQIVEMGSYVGIVQFESTAS 350          
BLAST of Chloride channel accessory 1 vs. Ensembl Mouse
Match: Clca3a1 (chloride channel accessory 3A1 [Source:MGI Symbol;Acc:MGI:1316732])

HSP 1 Score: 117.857 bits (294), Expect = 3.387e-29
Identity = 95/319 (29.78%), Postives = 155/319 (48.59%), Query Frame = 2
Query:   29 RISRQYKKTNSDASIALYEATSNMGGKEYGVKFGKVSIIIPSHWKLKGDSNSGLHCGDAQINILPKTPK----NIPFTKQLRKCGISGEYIS-----IPTDILKLTG-RGRQIMREYVKLRYGVYDEEVINNQAKVLTKDGLVNSVCNS-----NIELEFERPHTKMIKCTDSNDL------CHFKIKKNQNHNYSVMFDTETPSSKYFCDDKNRPHNKYAKNYQNKLCNQKSITSVILNHTDFKNVFSFPKIYYEL---PTFNIIQTKHRKIVLILDISGSM--ADYIATMKNAIKEFVNNLIEDTAEIGLVTFSDSA 907
            R+    K+  + AS  L+EA+    G+ Y   F  +SI++P  WK K +          + +++   P     + P+T Q  +CG  G+YI      + TD L++ G RGR  + E+  LR+GV+DE  ++    +  K+ +  + C++     N+    ER +     C   +        C F   K Q    S+MF     S   FC +KN  HN  A N QNK+CN++S   VI    DF+N  + P    E    PTF++++++ R + L+LD SGSM   D +  M  A + ++  ++E  + +GLVTF  +A
Sbjct:   47 RLIPSIKEMVTQASTYLFEASQ---GRVY---FRNISILVPMTWKSKPEYLMPKRESYDKADVIVADPHLQHGDDPYTLQYGQCGDRGQYIHFTPNFLLTDNLRIYGPRGRVFVHEWAHLRWGVFDEYNVDQPFYMSRKNTIEATRCSTRITGTNVVHNCERGNCVTRACRRDSKTRLYEPKCTFIPDKIQTAGASIMFMQNLNSVVEFCTEKN--HNAEAPNLQNKMCNRRSTWDVIKTSADFQN--APPMRGTEAPPPPTFSLLKSRRRVVCLVLDKSGSMDKEDRLIRMNQAAELYLTQIVEKESMVGLVTFDSAA 355          
BLAST of Chloride channel accessory 1 vs. Ensembl Mouse
Match: Clca3a1 (chloride channel accessory 3A1 [Source:MGI Symbol;Acc:MGI:1316732])

HSP 1 Score: 117.087 bits (292), Expect = 1.255e-28
Identity = 95/319 (29.78%), Postives = 155/319 (48.59%), Query Frame = 2
Query:   29 RISRQYKKTNSDASIALYEATSNMGGKEYGVKFGKVSIIIPSHWKLKGDSNSGLHCGDAQINILPKTPK----NIPFTKQLRKCGISGEYIS-----IPTDILKLTG-RGRQIMREYVKLRYGVYDEEVINNQAKVLTKDGLVNSVCNS-----NIELEFERPHTKMIKCTDSNDL------CHFKIKKNQNHNYSVMFDTETPSSKYFCDDKNRPHNKYAKNYQNKLCNQKSITSVILNHTDFKNVFSFPKIYYEL---PTFNIIQTKHRKIVLILDISGSM--ADYIATMKNAIKEFVNNLIEDTAEIGLVTFSDSA 907
            R+    K+  + AS  L+EA+    G+ Y   F  +SI++P  WK K +          + +++   P     + P+T Q  +CG  G+YI      + TD L++ G RGR  + E+  LR+GV+DE  ++    +  K+ +  + C++     N+    ER +     C   +        C F   K Q    S+MF     S   FC +KN  HN  A N QNK+CN++S   VI    DF+N  + P    E    PTF++++++ R + L+LD SGSM   D +  M  A + ++  ++E  + +GLVTF  +A
Sbjct:   47 RLIPSIKEMVTQASTYLFEASQ---GRVY---FRNISILVPMTWKSKPEYLMPKRESYDKADVIVADPHLQHGDDPYTLQYGQCGDRGQYIHFTPNFLLTDNLRIYGPRGRVFVHEWAHLRWGVFDEYNVDQPFYMSRKNTIEATRCSTRITGTNVVHNCERGNCVTRACRRDSKTRLYEPKCTFIPDKIQTAGASIMFMQNLNSVVEFCTEKN--HNAEAPNLQNKMCNRRSTWDVIKTSADFQN--APPMRGTEAPPPPTFSLLKSRRRVVCLVLDKSGSMDKEDRLIRMNQAAELYLTQIVEKESMVGLVTFDSAA 355          
BLAST of Chloride channel accessory 1 vs. Ensembl Mouse
Match: Clca3a2 (chloride channel accessory 3A2 [Source:MGI Symbol;Acc:MGI:1931471])

HSP 1 Score: 116.701 bits (291), Expect = 1.575e-28
Identity = 95/319 (29.78%), Postives = 154/319 (48.28%), Query Frame = 2
Query:   29 RISRQYKKTNSDASIALYEATSNMGGKEYGVKFGKVSIIIPSHWKLKGDSNSGLHCGDAQINILPKTPK----NIPFTKQLRKCGISGEYIS-----IPTDILKLTG-RGRQIMREYVKLRYGVYDEEVINNQAKVLTKDGLVNSVCNSNIE-----LEFERPHTKMIKCTDSNDL------CHFKIKKNQNHNYSVMFDTETPSSKYFCDDKNRPHNKYAKNYQNKLCNQKSITSVILNHTDFKNVFSFPKIYYEL---PTFNIIQTKHRKIVLILDISGSM--ADYIATMKNAIKEFVNNLIEDTAEIGLVTFSDSA 907
            R+    K+  + AS  L+EA+    G+ Y   F  +SI++P  WK K +          + +++   P     + P+T Q  +CG  G+YI      + TD L++ G RGR  + E+  LR+GV+DE  ++    +  K+ +  + C+++I       E +R       C   +        C F   K Q    S+MF     S   FC + N  HN  A N QNK+CN++S   VI    DF+N  S P    E    PTF++++++ R + L+LD SGSM   D +  M  A + ++  ++E  + +GLVTF  +A
Sbjct:   47 RLIPSIKEMVTQASTYLFEASQ---GRVY---FRNISILVPMTWKSKSEYLMPKRESYDKADVIVADPHLQHGDDPYTLQYGQCGDRGQYIHFTPNFLLTDNLRIYGPRGRVFVHEWAHLRWGVFDEYNVDRPFYISRKNTIEATRCSASITGKKVVHECQRGSCVTRACRRDSKTRLYEPKCTFIPDKIQTAGASIMFMQNLNSVVEFCTENN--HNAEAPNLQNKMCNRRSTWDVIKASADFQN--SPPMRGTEAPPPPTFSLLKSRRRVVCLVLDKSGSMDKEDRLIRMNQAAELYLTQIVEKESMVGLVTFDSAA 355          
BLAST of Chloride channel accessory 1 vs. Ensembl Mouse
Match: Clca3b (chloride channel accessory 3B [Source:MGI Symbol;Acc:MGI:2181989])

HSP 1 Score: 112.464 bits (280), Expect = 5.873e-27
Identity = 97/323 (30.03%), Postives = 152/323 (47.06%), Query Frame = 2
Query:   29 RISRQYKKTNSDASIALYEATSNMGGKEYGVKFGKVSIIIPSHWKLKGDSNSGLHCGDAQINILPKTPK----NIPFTKQLRKCGISGEYISIP-----TDILKLTG-RGRQIMREYVKLRYGVYDEEVINNQAKVLTKDGLVNSVCNSNI-------ELE----FERPHTKMIKCTDSNDLCHFKIKKNQNHNYSVMFDTETPSSKYFCDDKNRPHNKYAKNYQNKLCNQKSITSVILNHTDFKNVFSFPKIYYE---LPTFNIIQTKHRKIVLILDISGSM-----ADYIATMKNAIKEFVNNLIEDTAEIGLVTFSDSAS 910
            R+    K+  + AS  L+EAT      E    F  VSI++P  WK K +  +       Q +++   P     + P+T Q  +CG  G+YI        TD L + G RGR  + E+  LR+GV+DE  ++    +  K+ +  + C+++I       E +      R   +  K       C F   K+Q    S+MF     S   FC +K   HN  A N QNK+CN +S   VI    DF+N  + P    E   LPTF++++++ R + L+LD SGSM        +  M  A + ++  +IE  + +GLVTF  +A+
Sbjct:   47 RLIPSIKEMVTQASTYLFEAT------ERRFYFRNVSILVPITWKSKTEYLTPKQESYDQADVIVADPHLQHGDDPYTLQYGQCGDRGQYIHFTPNFLLTDNLGIYGPRGRVFVHEWAHLRWGVFDEYNMDRPFYMSRKNTVEATRCSTDITGTSVVRECQGGSCVSRRCRRDAKTGMQEAKCTFIPNKSQTARGSIMFMQSLDSVVEFCTEKT--HNVEAPNLQNKMCNLRSTWDVIKASADFQN--ASPMTGTEAPPLPTFSLLKSRQRVVCLVLDKSGSMRLGSPITRLTLMNQAAELYLIQIIEKESLVGLVTFDSTAT 359          
BLAST of Chloride channel accessory 1 vs. Ensembl Mouse
Match: Clca1 (chloride channel accessory 1 [Source:MGI Symbol;Acc:MGI:1346342])

HSP 1 Score: 106.686 bits (265), Expect = 4.031e-25
Identity = 92/308 (29.87%), Postives = 137/308 (44.48%), Query Frame = 2
Query:   59 SDASIALYEATSNMGGKEYGVKFGKVSIIIPSHWKLKGDSN----SGLHCGDAQINILPKTPKNIPFTKQLRKCGISGEYISIPTDIL---KLTGRG---RQIMREYVKLRYGVYDEEVINNQAKVLTKDGLVNSV-CNSNIELEFERPHTKMIKCTDSN------------DLCHFKIKKNQNHNYSVMFDTETPSSKYFCDDKNRPHNKYAKNYQNKLCNQKSITSVILNHTDFKNVFSFPKIYYELPTFNIIQTKHRKIVLILDISGSMA--DYIATMKNAIKEFVNNLIEDTAEIGLVTFSDSA 907
            + AS  L+EAT    GK +   F  V+I+IP  WK K +            D  ++       + P+T+ +  CG  G  I +  D L   KLT  G   R  + E+   R+GV++E   NN  K     G   +V C++ I  + +    +   C  +             D C F    +QN   S+MF+    S   FC +KN  HN+ A N QN+ CN +S   VI    DFK            PTF+++Q   R + L+LD SGSM   D +  M  A + F+   +E  + +G+VTF  +A
Sbjct:   58 TQASPYLFEAT----GKRF--YFKNVAILIPESWKAKPEYTRPKLETFKNADVLVSTTSPLGNDEPYTEHIGACGEKGIRIHLTPDFLAGKKLTQYGPQDRTFVHEWAHFRWGVFNE--YNNDEKFYLSKGKPQAVRCSAAITGKNQVRRCQGGSCITNGKCVIDRVTGLYKDNCVFVPDPHQNEKASIMFNQNINSVVEFCTEKN--HNQEAPNDQNQRCNLRSTWEVIQESEDFKQTTPM-TAQPPAPTFSLLQIGQRIVCLVLDKSGSMLNDDRLNRMNQASRLFLLQTVEQGSWVGMVTFDSAA 354          
BLAST of Chloride channel accessory 1 vs. UniProt/SwissProt
Match: sp|P54281|CLCA1_BOVIN (Calcium-activated chloride channel regulator 1 OS=Bos taurus OX=9913 PE=1 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 1.469e-28
Identity = 95/321 (29.60%), Postives = 156/321 (48.60%), Query Frame = 2
Query:   26 RRISRQYKKTNSDASIALYEATSNMGGKEYGVKFGKVSIIIPSHWKLKGDSNSGLHCGDAQINILPKTP----KNIPFTKQLRKCGISGEYIS-----IPTDILKLTG-RGRQIMREYVKLRYGVYDEEVINNQAKVLTKDGLVNSVCNSNIELE-----------FERPHTKMIKCTDSNDLCHFKIKKNQNHNYSVMFDTETPSSKYFCDDKNRPHNKYAKNYQNKLCNQKSITSVILNHTDFKNVFSFPKIYYEL-PTFNIIQTKHRKIVLILDISGSMA--DYIATMKNAIKEFVNNLIEDTAEIGLVTFSDSASKL 916
             ++ +  K+  ++AS  L+ AT         V F  VSI+IP  WK K +          Q  ++   P     + P+T Q  +CG  G+YI      + T+ L + G RGR  + E+  LR+G++DE   +    +  ++ +  + C+++I                RP  +  +       C F  +K+Q    S+MF     S   FC +K   HN  A N QNK+CN KS   VI+N TDF+N     ++     PTF+++++K R + L+LD SGSM+  D +  M  A + F+  +IE  + +G+VTF DS +++
Sbjct:   46 EKLIQNIKEMVTEASTYLFHATKRR------VYFRNVSILIPMTWKSKSEYLMPKQESYDQAEVIVANPYLKHGDDPYTLQYGRCGEKGQYIHFTPNFLLTNNLPIYGSRGRAFVHEWAHLRWGIFDEYNGDQPFYISRRNTIEATRCSTHITGTNVIVKCQGGSCITRPCRRDSQTGLYEAKCTFIPEKSQTARESIMFMQSLHSVTEFCTEKT--HNVEAPNLQNKMCNGKSTWDVIMNSTDFQNTSPMTEMNPPTQPTFSLLKSKQRVVCLVLDKSGSMSSEDRLFRMNQAAELFLIQIIEKGSLVGMVTF-DSVAEI 357          
BLAST of Chloride channel accessory 1 vs. UniProt/SwissProt
Match: sp|A8K7I4|CLCA1_HUMAN (Calcium-activated chloride channel regulator 1 OS=Homo sapiens OX=9606 GN=CLCA1 PE=1 SV=3)

HSP 1 Score: 117.472 bits (293), Expect = 6.898e-28
Identity = 99/314 (31.53%), Postives = 150/314 (47.77%), Query Frame = 2
Query:   38 RQYKKTNSDASIALYEATSNMGGKEYGVKFGKVSIIIPSHWKLKGD-SNSGLHC-GDAQINILPKTPK--NIPFTKQLRKCGISGEYISIPTDIL---KLT---GRGRQIMREYVKLRYGVYDEEVINNQAKVLTKDGLVNSV-CNSNI-------ELEFERPHTKMIKCTDSNDL----CHFKIKKNQNHNYSVMFDTETPSSKYFCDDKNRPHNKYAKNYQNKLCNQKSITSVILNHTDFKNVFSFPKIYYELPTFNIIQTKHRKIVLILDISGSMA--DYIATMKNAIKEFVNNLIEDTAEIGLVTFSDSA 907
            +Q K   + AS+ L EAT    GK +   F  V+I+IP  WK K D     L    +A + +   TP   + P+T+Q+  CG  GE I +  D +   KL     +GR  + E+  LR+GV+DE   NN  K    +G + +V C++ I       + +    +TK         L    C F ++  Q    S+MF     S   FC ++N  HNK A N QN+ CN +S   VI +  DFK            PTF+++Q   R + L+LD SGSMA  + +  +  A + F+   +E  + +G+VTF  +A
Sbjct:   51 QQIKDMVTQASLYLLEAT----GKRF--YFKNVAILIPETWKTKADYVRPKLETYKNADVLVAESTPPGNDEPYTEQMGNCGEKGERIHLTPDFIAGKKLAEYGPQGRAFVHEWAHLRWGVFDE--YNNDEKFYLSNGRIQAVRCSAGITGTNVVKKCQGGSCYTKRCTFNKVTGLYEKGCEFVLQSRQTEKASIMFAQHVDSIVEFCTEQN--HNKEAPNKQNQKCNLRSTWEVIRDSEDFKKTTPM-TTQPPNPTFSLLQIGQRIVCLVLDKSGSMATGNRLNRLNQAGQLFLLQTVELGSWVGMVTFDSAA 353          
BLAST of Chloride channel accessory 1 vs. UniProt/SwissProt
Match: sp|Q9QX15|CA3A1_MOUSE (Calcium-activated chloride channel regulator 3A-1 OS=Mus musculus OX=10090 GN=Clca3a1 PE=1 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 8.781e-28
Identity = 95/319 (29.78%), Postives = 155/319 (48.59%), Query Frame = 2
Query:   29 RISRQYKKTNSDASIALYEATSNMGGKEYGVKFGKVSIIIPSHWKLKGDSNSGLHCGDAQINILPKTPK----NIPFTKQLRKCGISGEYIS-----IPTDILKLTG-RGRQIMREYVKLRYGVYDEEVINNQAKVLTKDGLVNSVCNS-----NIELEFERPHTKMIKCTDSNDL------CHFKIKKNQNHNYSVMFDTETPSSKYFCDDKNRPHNKYAKNYQNKLCNQKSITSVILNHTDFKNVFSFPKIYYEL---PTFNIIQTKHRKIVLILDISGSM--ADYIATMKNAIKEFVNNLIEDTAEIGLVTFSDSA 907
            R+    K+  + AS  L+EA+    G+ Y   F  +SI++P  WK K +          + +++   P     + P+T Q  +CG  G+YI      + TD L++ G RGR  + E+  LR+GV+DE  ++    +  K+ +  + C++     N+    ER +     C   +        C F   K Q    S+MF     S   FC +KN  HN  A N QNK+CN++S   VI    DF+N  + P    E    PTF++++++ R + L+LD SGSM   D +  M  A + ++  ++E  + +GLVTF  +A
Sbjct:   47 RLIPSIKEMVTQASTYLFEASQ---GRVY---FRNISILVPMTWKSKPEYLMPKRESYDKADVIVADPHLQHGDDPYTLQYGQCGDRGQYIHFTPNFLLTDNLRIYGPRGRVFVHEWAHLRWGVFDEYNVDQPFYMSRKNTIEATRCSTRITGTNVVHNCERGNCVTRACRRDSKTRLYEPKCTFIPDKIQTAGASIMFMQNLNSVVEFCTEKN--HNAEAPNLQNKMCNRRSTWDVIKTSADFQN--APPMRGTEAPPPPTFSLLKSRRRVVCLVLDKSGSMDKEDRLIRMNQAAELYLTQIVEKESMVGLVTFDSAA 355          
BLAST of Chloride channel accessory 1 vs. UniProt/SwissProt
Match: sp|Q2TU62|CLCA1_HORSE (Calcium-activated chloride channel regulator 1 OS=Equus caballus OX=9796 GN=CLCA1 PE=1 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 8.145e-26
Identity = 92/314 (29.30%), Postives = 142/314 (45.22%), Query Frame = 2
Query:   38 RQYKKTNSDASIALYEATSNMGGKEYGVKFGKVSIIIPSHWKLKGDSNSGLHCGDAQINIL---PKTPKN-IPFTKQLRKCGISGEYISIPTDIL------KLTGRGRQIMREYVKLRYGVYDEEVINNQAKVLTKDGLVNSV-CNSNIELEFERPHTKMIKCTDS-----------NDLCHFKIKKNQNHNYSVMFDTETPSSKYFCDDKNRPHNKYAKNYQNKLCNQKSITSVILNHTDFKNVFSFPKIYYELPTFNIIQTKHRKIVLILDISGSMA--DYIATMKNAIKEFVNNLIEDTAEIGLVTFSDSA 907
            +Q K   + AS  L+EAT      E    F  V+I++P +WK K +            ++L   P  P N  P+T+Q+ KCG  GE I    D L      +   +GR  + E+  LR+G+++E   N+  K    +  +  V C+++I  +    H +   C                 C F   + Q    S+MF     S   FC ++N  HN+ A N QN+ CN +S   VI +  DFK            PTF+++Q   R + L+LD SGSMA  D +  +  A K F+   +E  + +G+VTF  +A
Sbjct:   51 QQIKDMVTQASPYLFEAT------EKRFYFKNVAILVPENWKTKPEYERPKLETYKNADVLVAEPNPPGNDQPYTEQMGKCGEKGERIYFTPDFLAGKRLDEYGPQGRVFVHEWAHLRWGLFNE--YNDDQKFYLSNKEIKPVKCSADIAGKNVVNHCQGGSCATKPCRRDRVTGLYAQECEFIPDEQQTEKASIMFSQSIDSVVEFCTEEN--HNREAPNMQNQRCNLRSTWEVIRDSEDFKKTTPM-TAQPPQPTFSLLQIGQRIVCLVLDKSGSMAIGDRLKRLTQAGKLFLLQTVEQGSWVGMVTFDSAA 353          
BLAST of Chloride channel accessory 1 vs. UniProt/SwissProt
Match: sp|Q6PT52|CLCA1_MACMU (Calcium-activated chloride channel regulator 1 OS=Macaca mulatta OX=9544 GN=CLCA1 PE=2 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 9.562e-26
Identity = 99/314 (31.53%), Postives = 146/314 (46.50%), Query Frame = 2
Query:   38 RQYKKTNSDASIALYEATSNMGGKEYGVKFGKVSIIIPSHWKLKGD-SNSGLHC-GDAQINILPKTPK--NIPFTKQLRKCGISGEYISIPTDIL------KLTGRGRQIMREYVKLRYGVYDEEVINNQAKVLTKDGLVNSV-CNSNIELEFE-------RPHTKMIKCTDSNDL----CHFKIKKNQNHNYSVMFDTETPSSKYFCDDKNRPHNKYAKNYQNKLCNQKSITSVILNHTDFKNVFSFPKIYYELPTFNIIQTKHRKIVLILDISGSMA--DYIATMKNAIKEFVNNLIEDTAEIGLVTFSDSA 907
            +Q K   + AS  L+EAT    GK +   F  V+I+IP  WK K D     L    +A + +   TP   + P+T+ + KCG  GE I +    L      +   +GR  + E+  LR+GV+DE   NN  K    +G + +V C+  I  + E         +TK      +  L    C F     Q    S+MF     S   FC ++N  HNK A N QN  CN +S   VI +  DFK            PTF+++Q   R + L+LD SGSMA  + +  +  A + F+  +IE  + +G+VTF  +A
Sbjct:   51 QQIKDMVTQASPYLFEAT----GKRF--YFKNVAILIPETWKTKADYVRPKLETYKNADVLVAESTPSGGDEPYTEHIGKCGDQGERIHLTPHFLAGKQLKEYGPQGRAFVHEWAHLRWGVFDE--YNNDEKFYLSNGRIQAVRCSVGITGKIEVNKCQGGSCYTKRCTFNKATGLYEKGCEFIPHSQQTEKASIMFAQHVDSVVEFCTEQN--HNKEAPNMQNTKCNLRSTWEVIRDSEDFKKTTPT-TTQPPNPTFSLLQIGQRIVCLVLDKSGSMATGNRLNRLNQAGQLFLLQIIELRSWVGMVTFDSAA 353          
BLAST of Chloride channel accessory 1 vs. TrEMBL
Match: V3ZDR8 (VWFA domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_229148 PE=4 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 4.861e-28
Identity = 100/317 (31.55%), Postives = 157/317 (49.53%), Query Frame = 2
Query:   62 DASIALYEATSNMGGKEYGVKFGKVSIIIPSHWKLKGDSNSGLHCGDAQINILPKTPKNIPFTKQLRK---CGISGEYISIPT-----------DILKLTGRGRQIMREYVKLRYGVYDEEVINNQAKVL--TKDG-LVNSVCNSNIE-LEFERPHTKMIKCTDSN-------DLCHFKI--KKNQNHNYSVMFDTETPSSKYFCDDKN----RPHNKYAKNYQNKLCNQKSITSVILNHTDFKNVFSFPK-IYYELPTFNIIQ-TKHRKIVLILDISGSMADYIAT--MKNAIKEFVNNLIEDTAEIGLVTFSDSA 907
            + S  LYEAT      E    F  V+I++P+ W L  D+ S ++  +A I     T      T+Q R    CG  G  I               DI  +  RGR ++ E+   R+GVYDE   + + +     K G +V   CNSNI  + +   + +++ C + +       D C +    ++N   + S+M     PS KYFC+D +    R HN  A N QN+LC Q+S  SVI +  DFKN  + P+ I    PTF +++  K R++VL LD SGSM +  A+  ++ A  ++++N I +  E+G+V+F+  A
Sbjct:   60 EGSSYLYEAT------EKRAYFKDVTILVPASWSLTSDTASEVY-DNADIEFTTSTYLTSGHTRQTRSYSGCGSPGIRIHFAPELFDTNRSKVYDIDTIGPRGRLLVHEWAHFRWGVYDEYAKDGEQQFYDSPKTGKVVGVACNSNIRGINYRLENGQLVFCRNVDPATGRFPDECRYLPYNRRNTRVSASIMHRVYVPSIKYFCNDDDLDSKRIHNYEAPNKQNRLCGQRSTWSVIQDSPDFKNNNNPPRDIPDTTPTFKVVKAAKTRRVVLALDTSGSMMNDDASNRLRQATADYIHNGISEDTEVGIVSFNHKA 369          
BLAST of Chloride channel accessory 1 vs. TrEMBL
Match: H0VS77 (Chloride channel accessory 1 OS=Cavia porcellus OX=10141 GN=CLCA1 PE=4 SV=2)

HSP 1 Score: 124.79 bits (312), Expect = 6.752e-28
Identity = 103/317 (32.49%), Postives = 152/317 (47.95%), Query Frame = 2
Query:   38 RQYKKTNSDASIALYEATSNMGGKEYGVKFGKVSIIIPSHWKLKGD-SNSGLHC-GDAQINILP-KTPKNIPFTKQLRKCGISGEYISIPTDIL------KLTGRGRQIMREYVKLRYGVYDEEVINNQAKVLTKDGLVNSV-CNSNIELEFERPHTKMIKCTDS-----------NDLCHFKIKKNQNHNYSVMFDTETPSSKYFCDDKNRPHNKYAKNYQNKLCNQKSITSVILNHTDFKNVFSF----PKIYYELPTFNIIQTKHRKIVLILDISGSMA--DYIATMKNAIKEFVNNLIEDTAEIGLVTFSDSA 907
            +Q K   ++AS  L+EAT      E    F  VSI+IP +W  K + +   L    +A + + P +   + P+T+Q  KCG  GE I +  D L      +   +GR  + E+  L++GV+DE   NN+ K     G   +V C+++I  +++    +   CT             N  C    +K Q    S+MF     S   FC++KN  HNK A N QN+ CN +S   VI    DFK         PK     PTF+++Q   R + L+LD SGSMA  + +  M  A K F+   +ED + +GLVTF  SA
Sbjct:   51 QQIKDMVTEASPYLFEAT------EKRFYFKSVSILIPENWNAKPEYTKPKLETYKNADVVVEPNQLSTDEPYTEQFGKCGERGEKIHLTPDFLAGKALKQYGPQGRVFVHEWAHLQWGVFDE--YNNEEKFYLSRGRPQAVRCSTDITGQYKTIKCQGGSCTVGPCRLNKLTGLYNKECVLIPQKQQIAKASIMFAQSIESVVGFCNEKN--HNKEAPNLQNQKCNLRSTWEVISESEDFKKTTPMTTNPPK-----PTFSLLQIAQRVVCLVLDKSGSMASDNRLDRMNQAAKFFLLQTVEDRSWVGLVTFDGSA 352          
BLAST of Chloride channel accessory 1 vs. TrEMBL
Match: A0A1L8GMX5 (VWFA domain-containing protein OS=Xenopus laevis OX=8355 GN=XELAEV_18023372mg PE=4 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 9.160e-28
Identity = 95/310 (30.65%), Postives = 149/310 (48.06%), Query Frame = 2
Query:   62 DASIALYEATSNMGGKEYGVKFGKVSIIIPSHWKLKGDSNSGLHCGDAQINILPKTP----KNIPFTKQLRKCGISGEYISIPTD------ILKLTG-RGRQIMREYVKLRYGVYDE----------EVINNQAKVLTKD--GLVNSVCNSNIELEFERPHTKMIKCTDSNDLCHFKIKKNQNHNYSVMFDTETPSSKYFCDDKNRPHNKYAKNYQNKLCNQKSITSVILNHTDFKNVFSFPKIYYELPTFNIIQTKHRKIVLILDISGSMA--DYIATMKNAIKEFVNNLIEDTAEIGLVTFSDSASKL 916
            DA+  L+ AT N       V    V I+IP  W  K  + +     D + +++  +P     + P+T Q   CG  G+YI +  D      ++ + G RGR  + E+  LR+GV+DE             N +A   + D  G    +C   I      P T + +     D C F  ++NQ    S+M+    PS   FC+ KN  HN  A   QN++CN +S   VI+N TD K+          +PTF+++Q+  R + L+LD+SGSMA  D I  +  A + FV  ++E+ + +G+VTFS + + L
Sbjct:   57 DATPYLFSATRNR------VYIRSVKILIPITWPNKNYTKARTETYD-KADVIIASPHVKFGDDPYTLQYGGCGEPGKYIHMTPDFFLDDNLISIYGPRGRVFVHEWAHLRWGVFDEYNYEKPFYVTGTKNIEATRCSADIIGTYMKLCQGRICNCIRDPQTGLYE-----DGCVFVPERNQAAKSSIMYSQALPSVTEFCE-KN--HNTEAPTLQNRICNSRSTWDVIMNSTDIKSTPPKADSNLPVPTFSLLQSSDRVVTLVLDVSGSMASGDRIGRLYQAAEVFVMQIVEEGSHVGIVTFSTTTTVL 351          
BLAST of Chloride channel accessory 1 vs. TrEMBL
Match: F7IYU5 (Calcium activated chloride channel OS=Xenopus laevis OX=8355 GN=clca1.2 PE=2 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 3.202e-27
Identity = 94/310 (30.32%), Postives = 148/310 (47.74%), Query Frame = 2
Query:   62 DASIALYEATSNMGGKEYGVKFGKVSIIIPSHWKLKGDSNSGLHCGDAQINILPKTP----KNIPFTKQLRKCGISGEYISIPTD------ILKLTG-RGRQIMREYVKLRYGVYDE----------EVINNQAKVLTKD--GLVNSVCNSNIELEFERPHTKMIKCTDSNDLCHFKIKKNQNHNYSVMFDTETPSSKYFCDDKNRPHNKYAKNYQNKLCNQKSITSVILNHTDFKNVFSFPKIYYELPTFNIIQTKHRKIVLILDISGSM--ADYIATMKNAIKEFVNNLIEDTAEIGLVTFSDSASKL 916
            DA+  L+ AT N       V    V I+IP  W  K  + +     D + +++  +P     + P+T Q   CG  G+YI +  D      ++ + G RGR  + E+  LR+GV+DE             N +A   + D  G    +C   I      P T + +     D C F  ++NQ    S+M+    PS   FC+ KN  HN  A   QN++CN +S   VI+N TD K+          +PTF+++Q+  R + L+LD+SGSM   D I  +  A + FV  ++E+ + +G+VTFS + + L
Sbjct:   57 DATPYLFSATRNR------VYIRSVKILIPITWPNKNYTKARTETYD-KADVIIASPHVKFGDDPYTLQYGGCGEPGKYIHMTPDFFLDDNLISIYGPRGRVFVHEWAHLRWGVFDEYNYEKPFYVTGTKNIEATRCSADIIGTYMKLCQGRICNCIRDPQTGLYE-----DGCVFVPERNQAAKSSIMYSQALPSVTEFCE-KN--HNTEAPTLQNRICNSRSTWDVIMNSTDIKSTPPKADSNLPVPTFSLLQSSDRVVTLVLDVSGSMTSGDRIGRLYQAAEVFVMQIVEEGSHVGIVTFSTTTAVL 351          
BLAST of Chloride channel accessory 1 vs. TrEMBL
Match: A0A4W2HA85 (VWFA domain-containing protein OS=Bos indicus x Bos taurus OX=30522 GN=LOC113889664 PE=4 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 4.483e-27
Identity = 99/316 (31.33%), Postives = 156/316 (49.37%), Query Frame = 2
Query:   47 KKTNSDASIALYEATSNMGGKEYGVKFGKVSIIIPSHWKLKGDSNSGLHCGDAQINILPKTP----KNIPFTKQLRKCGISGEYISIPTDILKLT-------GRGRQIMREYVKLRYGVYDEEVINNQAKVLTKDGLVNSVCNSNI---ELEFER-PHTKMIKCTDSNDL--------CHFKIKKNQNHNYSVMFDTETPSSKYFCDDKNRPHNKYAKNYQNKLCNQKSITSVILNHTDFKNVFSFPKIYYEL-PTFNIIQTKHRKIVLILDISGSMA--DYIATMKNAIKEFVNNLIEDTAEIGLVTFSDSASKL 916
            K+  ++AS  L+ AT         V F  VSI+IP  WK K +          Q +++   P     + P+T Q  +CG  G+YI    + L LT        RGR  + E+  LR+G++DE  ++    +  K+ +  + C+++I    + F++ P    I      D         C F  KK+Q    S+MF     S   FC +K   HN  A N QNK+CN KS   VI+N TDF+N     ++     PTF+++++K R + L+LD SGSM+  D +  M  A + F+  +IE  + +G+VTF DS +++
Sbjct:   53 KEMVTEASTYLFHATKRR------VYFRNVSILIPMTWKSKSEYFIPKQESYDQADVIVANPYLKYGDDPYTLQYGRCGEKGKYIHFTPNFL-LTNNFHIYGSRGRVFVHEWAHLRWGIFDEYNVDQPFYISRKNTIEATRCSTHITGINVVFKKCPGGSCITSLCRRDSQTGLYEAKCTFLPKKSQTAKESIMFMPSLHSVTEFCTEKT--HNVEAPNLQNKMCNGKSTWDVIMNSTDFQNTSPMTEMNPPTQPTFSLLKSKQRVVCLVLDKSGSMSSEDRLFRMNQAAELFLIQIIEKGSLVGMVTF-DSVAEI 358          
BLAST of Chloride channel accessory 1 vs. Ensembl Cavefish
Match: ENSAMXT00000037970.1 (calcium-activated chloride channel regulator 1 [Source:NCBI gene;Acc:103026350])

HSP 1 Score: 103.99 bits (258), Expect = 2.745e-24
Identity = 87/283 (30.74%), Postives = 136/283 (48.06%), Query Frame = 2
Query:  119 VKFGKVSIIIPSHWKLKGDSNSGLHCGDAQINILPKTP--KNIPFTKQLRKCGISGEYISIPTDILKLTG-------RGRQIMREYVKLRYGVYDEEVINNQAKVLTKDGLVNSVCNSNIE-LEFERPHTKMIKC-TD-SNDL----CHFKIKKNQNHNYSVMFDTETPSSKYFCDDKNRPHNKYAKNYQNKLCNQKSITSVILNHT---DFKNVFSFPKIYYELPTFNIIQTKHRKIVLILDISGSM-ADYIATMKNAIKEFVNNLIEDTAEIGLVTFSDSA 907
            V F +V I++P  WK   +         A + I    P   + P+TKQ++ CG  GEYI    D L           R +  + E+  LR+GV+DE     +   L  + +  + C  +I    ++  + K + C TD +  L    C F   + Q ++ S+M+     S K FC   +  HN  A N QNK C+ +S +SVI   +   D  N           PTF +IQ +HR I LILD+SGSM  + I  ++ A   F++ ++E+ A++G+V FS +A
Sbjct:   17 VFFKEVKILVPPTWKGNYERAKRETYDKASVFIDRPNPIFGDEPYTKQMKGCGEEGEYIHFTPDFLLDDDLLDAYGTREKVFVHEWAHLRWGVFDE-YSEEEPFYLFGNNIEPTRCIKDIRGRNYKVTNGKHVHCPTDVATGLPIKGCQFFPDREQENSASIMYMQSLDSVKAFCGFMD--HNYEAPNMQNKKCDYRSTSSVIFGSSVDSDALNTLQPLPSPPPPPTFTVIQRQHRVICLILDVSGSMKGERILRLQQAATLFLSEIVEEGAQVGIVKFSTNA 296          
BLAST of Chloride channel accessory 1 vs. Ensembl Cavefish
Match: ENSAMXT00000007776.2 (calcium-activated chloride channel regulator 1 [Source:NCBI gene;Acc:103026350])

HSP 1 Score: 103.99 bits (258), Expect = 3.257e-24
Identity = 87/283 (30.74%), Postives = 136/283 (48.06%), Query Frame = 2
Query:  119 VKFGKVSIIIPSHWKLKGDSNSGLHCGDAQINILPKTP--KNIPFTKQLRKCGISGEYISIPTDILKLTG-------RGRQIMREYVKLRYGVYDEEVINNQAKVLTKDGLVNSVCNSNIE-LEFERPHTKMIKC-TD-SNDL----CHFKIKKNQNHNYSVMFDTETPSSKYFCDDKNRPHNKYAKNYQNKLCNQKSITSVILNHT---DFKNVFSFPKIYYELPTFNIIQTKHRKIVLILDISGSM-ADYIATMKNAIKEFVNNLIEDTAEIGLVTFSDSA 907
            V F +V I++P  WK   +         A + I    P   + P+TKQ++ CG  GEYI    D L           R +  + E+  LR+GV+DE     +   L  + +  + C  +I    ++  + K + C TD +  L    C F   + Q ++ S+M+     S K FC   +  HN  A N QNK C+ +S +SVI   +   D  N           PTF +IQ +HR I LILD+SGSM  + I  ++ A   F++ ++E+ A++G+V FS +A
Sbjct:   68 VFFKEVKILVPPTWKGNYERAKRETYDKASVFIDRPNPIFGDEPYTKQMKGCGEEGEYIHFTPDFLLDDDLLDAYGTREKVFVHEWAHLRWGVFDE-YSEEEPFYLFGNNIEPTRCIKDIRGRNYKVTNGKHVHCPTDVATGLPIKGCQFFPDREQENSASIMYMQSLDSVKAFCGFMD--HNYEAPNMQNKKCDYRSTSSVIFGSSVDSDALNTLQPLPSPPPPPTFTVIQRQHRVICLILDVSGSMKGERILRLQQAATLFLSEIVEEGAQVGIVKFSTNA 347          
BLAST of Chloride channel accessory 1 vs. Ensembl Cavefish
Match: ENSAMXT00000007818.2 (pep primary_assembly:Astyanax_mexicanus-2.0:1:5630898:5645307:1 gene:ENSAMXG00000007608.2 transcript:ENSAMXT00000007818.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.5153 bits (236), Expect = 1.235e-21
Identity = 80/282 (28.37%), Postives = 131/282 (46.45%), Query Frame = 2
Query:  131 KVSIIIPSHWKLKGDSNSGLHCGDAQINILPKTPKNI----PFTKQLRKCGISGEYIS------IPTDILKLTG-RGRQIMREYVKLRYGVYDEEVINNQAKVLTKDGLVNSVCNSNIELEF-------ERPHTKMIKCTDSNDLCHFKIKKNQNHNYSVMFDTETPSSKYFCDDKNRPHNKYAKNYQNKLCNQKSITSVILNHT---DFKNVFSFPKIYYELPTFNIIQTKHRKIVLILDISGSMA-DYIATMKNAIKEFVNNLIEDTAEIGLVTFSDSAS 910
            +V+I++P  W     + +     D + N++   P       P+TKQ++ CG  GE+I       +  D+LK+ G R +  + E+  LR+GV+DE              L ++ C+  I  +          P +   K       C F   K+Q  + S+MF     + K FC+D +  HN  A N QNK CN +S  ++I  H+         +  K     P F ++Q K R   LILD+SGSM+ + I   + A   F++ ++E+ A + +V FS+ AS
Sbjct:   72 EVNILVPPTWTGYSFTKARRETYD-KANVIVGHPNTAFGDEPYTKQMKGCGEEGEHIHFTPDFLLKDDLLKVFGPREKVFVHEWAHLRWGVFDEYNKKQPFYWSKNQQLEHTRCSGKIAGKLYDVSSGSPLPCSYDPKTGLPTKGCKFIPNKDQKTSSSIMFMPSLDAVKTFCEDGD--HNTEAPNRQNKECNFRSTRTIIYKHSVDSAALKTLTPLKTKPPPPKFRVVQRKSRATCLILDVSGSMSGERIRRQQQAAALFLSEIVEEGASVAIVQFSNDAS 350          
BLAST of Chloride channel accessory 1 vs. Ensembl Cavefish
Match: ENSAMXT00000054901.1 (pep primary_assembly:Astyanax_mexicanus-2.0:1:5707968:5721043:-1 gene:ENSAMXG00000007580.2 transcript:ENSAMXT00000054901.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.0409 bits (214), Expect = 1.013e-18
Identity = 89/299 (29.77%), Postives = 136/299 (45.48%), Query Frame = 2
Query:   59 SDASIALYEATSNMGGKEYGVKFGKVSIIIPSHWKLKGDSNSGLHCGDAQINILPKTPKNIPFTKQLRKCGISGEYISIPTDIL------KLTG-RGRQIMREYV----KLRYGVYDE-EVINNQAKVLTKDGLVNSVCNSNIELEFERPHTKMIKCTDSNDLCHFKIKKNQNHNYSVMFDTETPSSKYFCDDKNRPHNKYAKNYQNKLCNQKSITSVILNHT-DFKNVFSFPKIYYELPT-FNIIQTKHRKIVLILDISGSMA-DYIATMKNAIKEFVNNLIEDTAEIGLVTFSDSAS 910
            +D S  L++A  N       V   +V I++P +W   G           ++    +  +  P+TKQ++ CG  GEY+ +  + L      K  G RG   +  YV    KL +  Y          ++  K  LV  V  S +   ++ P T +       + C F   K Q  N S+M+     S K FC D+   HN  A N QNK CN +S  SVI  H+ D   + +   +    P  F  +Q ++R I LILD+SGSMA   I   + A   F++ ++E+ A +G+V FS+ AS
Sbjct:   54 TDGSEYLHQALDNK------VFIKEVKILVPPNWN--GSYEKARRETYDKVQHFNQILRLRPYTKQMKGCGEEGEYVHLTPNFLLDDSFLKSYGPRGETSVHVYVHVAQKLSWQHYSPTRPFQCSGRIAGK--LVEVVNGSALPCYYD-PKTSL-----PTEGCQFLPDKYQQTNASIMYIQSLDSVKTFCGDEE--HNTEAPNQQNKECNFRSTRSVIYKHSVDSAALQTLTPVPSPSPPTFREVQRRNRVICLILDVSGSMAGGRILRQQQAATLFLSEIVEEGAYVGIVQFSNDAS 334          
BLAST of Chloride channel accessory 1 vs. Ensembl Cavefish
Match: ENSAMXT00000007808.2 (pep primary_assembly:Astyanax_mexicanus-2.0:1:5707968:5721043:-1 gene:ENSAMXG00000007580.2 transcript:ENSAMXT00000007808.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.4185 bits (202), Expect = 3.632e-17
Identity = 72/237 (30.38%), Postives = 113/237 (47.68%), Query Frame = 2
Query:  242 PFTKQLRKCGISGEYISIPTDIL------KLTGRGRQIMREYVKLRYGVYDEEVIN-----NQAKVLTKDGLVNSVCNSNIELEFERPHTKMIKCTDSNDLCHFKIKKNQNHNYSVMFDTETPSSKYFCDDKNRPHNKYAKNYQNKLCNQKSITSVILNHT-DFKNVFSFPKIYYELPT-FNIIQTKHRKIVLILDISGSMA-DYIATMKNAIKEFVNNLIEDTAEIGLVTFSDSAS 910
            P+TKQ++ CG  GEY+ +  + L      K  G   +     +   + ++ +  +N        ++  K  LV  V  S +   ++ P T +       + C F   K Q  N S+M+     S K FC D+   HN  A N QNK CN +S  SVI  H+ D   + +   +    P  F  +Q ++R I LILD+SGSMA   I   + A   F++ ++E+ A +G+V FS+ AS
Sbjct:  110 PYTKQMKGCGEEGEYVHLTPNFLLDDSFLKSYGPRGETSVHGIDSHWNLFRDFRVNFCLCTCSGRIAGK--LVEVVNGSALPCYYD-PKTSL-----PTEGCQFLPDKYQQTNASIMYIQSLDSVKTFCGDEE--HNTEAPNQQNKECNFRSTRSVIYKHSVDSAALQTLTPVPSPSPPTFREVQRRNRVICLILDVSGSMAGGRILRQQQAATLFLSEIVEEGAYVGIVQFSNDAS 336          
BLAST of Chloride channel accessory 1 vs. Ensembl Sea Lamprey
Match: CLCA1 (chloride channel accessory 1 [Source:HGNC Symbol;Acc:HGNC:2015])

HSP 1 Score: 104.375 bits (259), Expect = 4.948e-25
Identity = 86/309 (27.83%), Postives = 139/309 (44.98%), Query Frame = 2
Query:   62 DASIALYEATSNMGGKEYGVKFGKVSIIIPSHWKLKGDSNSGLH--CGDAQINI--LPKTPKNIPFTKQLRKCGISGEYISIPTDIL-------KLTGRGRQIMREYVKLRYGVYDE--------------EVINNQAKVLTKDGLVNSVCNSNIELEFERPHTKMIKCTDSNDLCHFKIKKNQNHNYSVMFDTETPSSKYFCDDKNRPHNKYAKNYQNKLCNQKSITSVILNHTDFKNVFSFPKIYYELPTFNIIQTKHRKIVLILDISGSMA--DYIATMKNAIKEFVNNLIEDTAEIGLVTFSDSA 907
            DAS  L++AT+ +        F  VSI+IPS W  + +     +   G A++ I  L     + P+T+Q  +CG  G+YI +  + L           RGR  + E+  LR+G++DE              E       V    G+V+  C+S    + +     +    +    C F   K Q    S+M      + + FC   +  HN+ A N QN+LC+  S   ++  H DF N    P      PTF++++  HR I L+LD SGSM+    +  ++ A   F+  ++E+   +G+VTF  SA
Sbjct:   63 DASAYLFKATNRL------AYFKHVSILIPSFWSSQSNYTRPKYESYGKAEVRIASLDDPEDDSPYTQQYGQCGEPGQYIQLTPNFLLADKNLDAYCPRGRAFVHEWGHLRWGLFDEYNEDEPFYLHGNNVEFTRCSRGVTGGTGVVS--CSSIGSCKVQACKIGINGLPEQG--CMFFPDKVQMARESIMALQWLDNVEEFCTVNS--HNRNAPNLQNRLCSSSSAWDIMQKHEDFNNNEPPPADVPTQPTFSLLRPSHRVITLVLDKSGSMSGGSRLQRLRQAADIFIMQILEEGEMVGIVTFDSSA 359          
BLAST of Chloride channel accessory 1 vs. Ensembl Sea Lamprey
Match: CLCA1 (chloride channel accessory 1 [Source:HGNC Symbol;Acc:HGNC:2015])

HSP 1 Score: 98.5969 bits (244), Expect = 4.119e-23
Identity = 91/312 (29.17%), Postives = 139/312 (44.55%), Query Frame = 2
Query:   59 SDASIALYEATSNMGGKEYGVKFGKVSIIIPSHWKLKGDSNSGL-HCGDAQINILP--KTPKNIPFTKQLRKCGISGEYISIPTDIL------KLTG-RGRQIMREYVKLRYGVYDEEV------INNQAKVLTKDGLVNSVCNSNIELEFERPHTKMI-KCT------DSNDL----CHFKIKKNQNHNYSVMFDTETPSSKYFCDDKNRPHNKYAKNYQNKLCNQKSITSVILNHTDFKNVFSFPKIYYELPTFNIIQTKHRKIVLILDISGSM--ADYIATMKNAIKEFVNNLIEDTAEIGLVTFSDSA 907
            +DAS  L+ AT+        V F  VSI+IPS W  K  +     + G A + + P      + P+T+Q  +CG  G+YI +  + L      K  G RGR  + E+   R+G++DE        +N +    T+       C+ +I     + + ++   CT      +S  L    C F   + Q    S+M      S   FC  K   HN+ A N QN+LC   S   V+L H D  N  + P      PTF ++Q   R I L+LD SGSM  A  +  +  A + F+  ++++    G+VTF   A
Sbjct:   61 TDASAYLHAATNRR------VFFKNVSILIPSSWTSKNYTRPTYEYYGKADVLVHPWDDPEDDSPYTQQYGQCGEPGQYIQLTPNFLLDDKNLKAYGPRGRAFVHEWGHFRWGLFDEYSEEEPFYVNGKNPEFTR-------CSRDITGGIGKVNCRVGGACTVDKCKIESTGLPEKGCSFFPDEVQTAKESIMGLQWINSVNTFCTAKT--HNRLAPNRQNRLCGLSSAWEVMLKHDDINN--TSPASVPTQPTFTLLQPSARVITLVLDKSGSMGGAMRLPRLLQAAEIFIMQILQEGDTAGIVTFESGA 355          
BLAST of Chloride channel accessory 1 vs. Ensembl Sea Lamprey
Match: CLCA1 (chloride channel accessory 1 [Source:HGNC Symbol;Acc:HGNC:2015])

HSP 1 Score: 98.2117 bits (243), Expect = 5.125e-23
Identity = 84/317 (26.50%), Postives = 132/317 (41.64%), Query Frame = 2
Query:   59 SDASIALYEATSNMGGKEYGVKFGKVSIIIPSHWKLKGDSNS--GLHCGDAQINILPK--TPKNIPFTKQLRKCGISGEYISIPTDIL-------KLTGRGRQIMREYVKLRYGVYDE---------------------EVINNQAKVLTKDGLVNSVCNSNIELEFERPHTKMIKCTDSNDLCHFKIKKNQNHNYSVMFDTETPSSKYFCDDKNRPHNKYAKNYQNKLCNQKSITSVILNHTDFKNVFSFPKIYYELPTFNIIQTKHRKIVLILDISGSM--ADYIATMKNAIKEFVNNLIEDTAEIGLVTFSDSA 907
            ++AS  L+ AT      +Y + F  VSI+IP+ WK     N       G A + I+ +     N P+T Q   CG  G+YI +  + L           RG+  + E+  LR+G+YDE                     ++      V+  D +    CN +       P T +       + C F     Q    S+M      + K FC      HNK A    N+LC  KS   ++  H DFK     P      P+F ++Q   R + L+LD+SGSM  A+ +  M+ A + F+  +++    IG++ F+  A
Sbjct:   59 TNASSDLFRAT------KYRLYFRNVSILIPASWKTNSIYNRPKSESYGAADVLIVSRDDPTDNSPYTHQFGLCGEPGQYIHLTPNFLLTDHYLEAYGPRGKVFVHEWGHLRWGLYDEYNDQVPFYLDKGKIEFTRCSKDLTGGHVMVMRNDSVSTRNCNID-------PKTGL-----PEEGCTFFPDVVQTATSSIMSIQALDNVKEFCSVNQ--HNKAAPTLHNRLCASKSTWQIMQRHNDFKVKTKLPVGTDTQPSFTLLQPTARVVTLVLDVSGSMNGANRLQRMRQASENFIMKILDAGTLIGIIVFNSKA 355          
BLAST of Chloride channel accessory 1 vs. Planmine SMEST
Match: SMESG000080918.1 (SMESG000080918.1)

HSP 1 Score: 568.54 bits (1464), Expect = 0.000e+0
Identity = 272/273 (99.63%), Postives = 272/273 (99.63%), Query Frame = 2
Query:   98 MGGKEYGVKFGKVSIIIPSHWKLKGDSNSGLHCGDAQINILPKTPKNIPFTKQLRKCGISGEYISIPTDILKLTGRGRQIMREYVKLRYGVYDEEVINNQAKVLTKDGLVNSVCNSNIELEFERPHTKMIKCTDSNDLCHFKIKKNQNHNYSVMFDTETPSSKYFCDDKNRPHNKYAKNYQNKLCNQKSITSVILNHTDFKNVFSFPKIYYELPTFNIIQTKHRKIVLILDISGSMADYIATMKNAIKEFVNNLIEDTAEIGLVTFSDSASKL 916
            MGGKEYGVKFGKVSIIIPSHWKLKGDSNSGLHCGDAQINILPKTPKNIPFTKQLRKCGISGEYISIPTDILKLTGRGRQIMREYVKLRYGVYDEEVINNQAKVLTKDGLVNSVCNSNIELEFERPHTKMIKCTDSNDLCHFKIKKNQNHNYSVMFDTETPSSKYFCDDKNRPHNKYAKNYQNKLCNQKSITSVILNHTDFKNVFSFPKIYYE PTFNIIQTKHRKIVLILDISGSMADYIATMKNAIKEFVNNLIEDTAEIGLVTFSDSASKL
Sbjct:    1 MGGKEYGVKFGKVSIIIPSHWKLKGDSNSGLHCGDAQINILPKTPKNIPFTKQLRKCGISGEYISIPTDILKLTGRGRQIMREYVKLRYGVYDEEVINNQAKVLTKDGLVNSVCNSNIELEFERPHTKMIKCTDSNDLCHFKIKKNQNHNYSVMFDTETPSSKYFCDDKNRPHNKYAKNYQNKLCNQKSITSVILNHTDFKNVFSFPKIYYEPPTFNIIQTKHRKIVLILDISGSMADYIATMKNAIKEFVNNLIEDTAEIGLVTFSDSASKL 273          
BLAST of Chloride channel accessory 1 vs. Planmine SMEST
Match: SMESG000080916.1 (SMESG000080916.1)

HSP 1 Score: 214.157 bits (544), Expect = 5.527e-63
Identity = 124/296 (41.89%), Postives = 178/296 (60.14%), Query Frame = 2
Query:   59 SDASIALYEATSNMGGKEYGVKFGKVSIIIPSHWKLKGDSNSGLHCGDA----QINILPKTPKNIPFTKQLRKCGISGEYISIPTDILKLTG------RGRQIMREYVKLRYGVYDEEVINNQAKVLTKDGLVNSVCNSNIELEFERPHTKMIKCTDSNDLCHFKIKKNQNHNYSVMFDTETPSSKYFCDDKNRPHNKYAKNYQNKLCNQKSITSVILNHTDFKNVFSFPKIYYELPTFNIIQTKHRKIVLILDISGSMADYIATMKNAIKEFVNNLIEDTAEIGLVTFSDSASKL 916
            S+AS +L++ATS+M     GV+FG V I +PS W    +  +   C +A     ++ + K  K  P TKQL KCG  G +   P    K T       RG++ MRE+VKLRYGVY EE + N+         + +VC ++I+    +   +   C +SN  C ++I KNQ+HN+S+MFDTET +S+YFCDD++R HNKYA N  NK CN++S+T+VILNH DFK+      I YE   FNI++ +  KIVL+LD SGSM + I  MK A   F+ + + ++A +G+V F  SA+ L
Sbjct:   53 SNASKSLWKATSHMESNIAGVQFGTVHIRVPSTWSNHLNPITWHQCNNALFFVAVDNIDKNEK--PITKQLGKCGDPGNFTRFPESFFKATKLNDTFKRGKEFMREFVKLRYGVYSEEPLRNRLLAFDGKNHIQAVCGNDIKWNVVKDRHQ---CMESNTECKYEIIKNQHHNHSIMFDTETFTSEYFCDDRHRLHNKYAYNLHNKKCNKRSVTNVILNHKDFKS--GKTSIIYENVKFNIVKGQTEKIVLVLDTSGSMVNIIENMKLATIAFLES-VGNSAYVGIVRFDSSATIL 340          
BLAST of Chloride channel accessory 1 vs. Planmine SMEST
Match: SMESG000080919.1 (SMESG000080919.1)

HSP 1 Score: 211.46 bits (537), Expect = 3.843e-62
Identity = 116/309 (37.54%), Postives = 177/309 (57.28%), Query Frame = 2
Query:    5 ENIG*KGRRISRQYKKTNSDASIALYEATSNMGGKEYGVKFGKVSIIIPSHWKLKGDSNSGLHCGDAQINILPKTPK---NIPFTKQLRKCGISGEYISIPTDILKLTG--------RGRQIMREYVKLRYGVYDEEVINNQAKVLTKDGLVNSVCNSNIELEFERPHTKMIKCTDSNDLCHFKIKKNQNHNYSVMFDTETPSSKYFCDDKNRPHNKYAKNYQNKLCNQKSITSVILNHTDF-KNVFSFPKIYYELPTFNIIQTKHRKIVLILDISGSMADYIATMKNAIKEFVNNLIEDTAEIGLVTF 895
            E I    R++    K +   AS +LY+ATSN+   + G+KFGK+ I +P+ W+ +   +       A   I+P+  K   + P+TKQ  KCG  G+Y    ++              +G++IM+E+VKLRYGV+ E    N   V     L+  +CN NI+ +      K   C+D N +C + I  NQNHNYS+MFD+++ +S YFC+DK+RPHN  A N  N  C  KS++SVI+ H DF KN   F    Y++PTF I+  + R+IVL+LD SGSM ++   +K+ + +F+    E++AEI +VT+
Sbjct:   41 EKISKYDRKLIENIKISMEQASKSLYKATSNLDKSQPGIKFGKIFISVPNQWQTEIQVSPKKFTDKAHFKIVPRKNKKNSDKPWTKQYPKCGKPGKYSRFSSEFFNEKSLNEKDSLKKGKRIMKEFVKLRYGVFSERPYKNVLFVHNNFSLIKGICNQNIQWKVNNSPEK---CSDENSVCKYTIDGNQNHNYSIMFDSDSHTSDYFCNDKDRPHNHLAYNLHNIFCKGKSVSSVIMKHQDFNKNSAKFSS--YKIPTFQILLRRGRQIVLVLDRSGSMNEFADKVKDVVCKFIKEYAEESAEISIVTY 344          
The following BLAST results are available for this feature:
BLAST of Chloride channel accessory 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CLCA11.436e-2831.53chloride channel accessory 1 [Source:HGNC Symbol;A... [more]
CLCA11.436e-2831.53chloride channel accessory 1 [Source:HGNC Symbol;A... [more]
CLCA48.494e-2528.09chloride channel accessory 4 [Source:HGNC Symbol;A... [more]
CLCA27.372e-2328.05chloride channel accessory 2 [Source:HGNC Symbol;A... [more]
back to top
BLAST of Chloride channel accessory 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chloride channel accessory 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chloride channel accessory 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clca14.350e-2931.96chloride channel accessory 1 [Source:ZFIN;Acc:ZDB-... [more]
clca11.085e-2528.66chloride channel accessory 1 [Source:ZFIN;Acc:ZDB-... [more]
clca17.517e-1434.04chloride channel accessory 1 [Source:ZFIN;Acc:ZDB-... [more]
clca15.920e-1235.40chloride channel accessory 1 [Source:ZFIN;Acc:ZDB-... [more]
si:ch211-116o3.36.110e-834.02si:ch211-116o3.3 [Source:ZFIN;Acc:ZDB-GENE-131121-... [more]
back to top
BLAST of Chloride channel accessory 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000026373.14.919e-2929.04chloride channel accessory 1 gene 2 [Source:NCBI g... [more]
ENSXETT00000038434.14.922e-2929.04chloride channel accessory 1 gene 2 [Source:NCBI g... [more]
gnl37.955e-2929.28guanine nucleotide binding protein-like 3 (nucleol... [more]
ENSXETT00000038492.11.096e-2629.79chloride channel accessory 4 gene 1 [Source:NCBI g... [more]
csnk2a22.296e-2530.04casein kinase 2 alpha 2 [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of Chloride channel accessory 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Clca3a13.387e-2929.78chloride channel accessory 3A1 [Source:MGI Symbol;... [more]
Clca3a11.255e-2829.78chloride channel accessory 3A1 [Source:MGI Symbol;... [more]
Clca3a21.575e-2829.78chloride channel accessory 3A2 [Source:MGI Symbol;... [more]
Clca3b5.873e-2730.03chloride channel accessory 3B [Source:MGI Symbol;A... [more]
Clca14.031e-2529.87chloride channel accessory 1 [Source:MGI Symbol;Ac... [more]
back to top
BLAST of Chloride channel accessory 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P54281|CLCA1_BOVIN1.469e-2829.60Calcium-activated chloride channel regulator 1 OS=... [more]
sp|A8K7I4|CLCA1_HUMAN6.898e-2831.53Calcium-activated chloride channel regulator 1 OS=... [more]
sp|Q9QX15|CA3A1_MOUSE8.781e-2829.78Calcium-activated chloride channel regulator 3A-1 ... [more]
sp|Q2TU62|CLCA1_HORSE8.145e-2629.30Calcium-activated chloride channel regulator 1 OS=... [more]
sp|Q6PT52|CLCA1_MACMU9.562e-2631.53Calcium-activated chloride channel regulator 1 OS=... [more]
back to top
BLAST of Chloride channel accessory 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V3ZDR84.861e-2831.55VWFA domain-containing protein OS=Lottia gigantea ... [more]
H0VS776.752e-2832.49Chloride channel accessory 1 OS=Cavia porcellus OX... [more]
A0A1L8GMX59.160e-2830.65VWFA domain-containing protein OS=Xenopus laevis O... [more]
F7IYU53.202e-2730.32Calcium activated chloride channel OS=Xenopus laev... [more]
A0A4W2HA854.483e-2731.33VWFA domain-containing protein OS=Bos indicus x Bo... [more]
back to top
BLAST of Chloride channel accessory 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000037970.12.745e-2430.74calcium-activated chloride channel regulator 1 [So... [more]
ENSAMXT00000007776.23.257e-2430.74calcium-activated chloride channel regulator 1 [So... [more]
ENSAMXT00000007818.21.235e-2128.37pep primary_assembly:Astyanax_mexicanus-2.0:1:5630... [more]
ENSAMXT00000054901.11.013e-1829.77pep primary_assembly:Astyanax_mexicanus-2.0:1:5707... [more]
ENSAMXT00000007808.23.632e-1730.38pep primary_assembly:Astyanax_mexicanus-2.0:1:5707... [more]
back to top
BLAST of Chloride channel accessory 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CLCA14.948e-2527.83chloride channel accessory 1 [Source:HGNC Symbol;A... [more]
CLCA14.119e-2329.17chloride channel accessory 1 [Source:HGNC Symbol;A... [more]
CLCA15.125e-2326.50chloride channel accessory 1 [Source:HGNC Symbol;A... [more]
back to top
BLAST of Chloride channel accessory 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chloride channel accessory 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chloride channel accessory 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chloride channel accessory 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000080918.10.000e+099.63SMESG000080918.1[more]
SMESG000080916.15.527e-6341.89SMESG000080916.1[more]
SMESG000080919.13.843e-6237.54SMESG000080919.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021926 ID=SMED30021926|Name=Chloride channel accessory 1|organism=Schmidtea mediterranea sexual|type=transcript|length=946bp
TATAGAGAATATAGGATGAAAAGGACGAAGAATTAGTCGACAGTATAAAA
AAACTAATTCTGATGCATCCATAGCATTGTACGAGGCTACGAGCAACATG
GGGGGTAAAGAATATGGGGTGAAATTCGGAAAAGTTTCCATTATAATTCC
TTCACATTGGAAATTGAAAGGAGATTCAAATTCTGGATTGCATTGCGGTG
ATGCTCAAATAAACATCCTTCCTAAAACACCCAAAAATATCCCATTTACT
AAACAACTTCGGAAGTGTGGGATATCTGGGGAGTATATTTCTATTCCAAC
TGATATTTTGAAGCTTACAGGCAGAGGTAGACAAATCATGAGAGAATATG
TAAAATTGAGATATGGAGTTTATGATGAAGAAGTTATTAACAATCAGGCA
AAAGTTTTAACTAAAGACGGATTAGTGAATTCTGTGTGCAATTCAAATAT
CGAATTAGAATTTGAAAGGCCTCACACAAAAATGATAAAATGCACTGATT
CAAATGATCTTTGTCATTTCAAAATAAAGAAAAACCAAAATCACAATTAT
TCCGTAATGTTTGATACAGAAACCCCCTCGAGCAAATATTTTTGTGACGA
CAAAAATAGACCACATAATAAATATGCGAAGAATTATCAAAACAAGCTAT
GTAATCAAAAAAGTATCACATCTGTTATTTTGAATCATACAGATTTTAAA
AATGTTTTTAGCTTTCCAAAAATCTACTATGAACTTCCAACATTCAATAT
CATTCAAACTAAGCATAGAAAAATAGTGCTAATCCTAGACATATCCGGGA
GTATGGCAGATTATATCGCTACAATGAAAAATGCAATTAAAGAATTTGTG
AATAATTTAATTGAAGACACAGCAGAAATTGGACTAGTAACATTTTCTGA
TTCTGCTTCAAAACTTTTCTGACATGATTCCAATGAATAAAATGGA
back to top

protein sequence of SMED30021926-orf-1

>SMED30021926-orf-1 ID=SMED30021926-orf-1|Name=SMED30021926-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=275bp
MGGKEYGVKFGKVSIIIPSHWKLKGDSNSGLHCGDAQINILPKTPKNIPF
TKQLRKCGISGEYISIPTDILKLTGRGRQIMREYVKLRYGVYDEEVINNQ
AKVLTKDGLVNSVCNSNIELEFERPHTKMIKCTDSNDLCHFKIKKNQNHN
YSVMFDTETPSSKYFCDDKNRPHNKYAKNYQNKLCNQKSITSVILNHTDF
KNVFSFPKIYYELPTFNIIQTKHRKIVLILDISGSMADYIATMKNAIKEF
VNNLIEDTAEIGLVTFSDSASKLF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR002035VWF_A
IPR013642CLCA_N
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0030141secretory granule
GO:0042589zymogen granule membrane
GO:0005902microvillus
GO:0016020membrane
GO:0005576extracellular region
GO:0005615extracellular space
GO:0005886plasma membrane
GO:0005887integral component of plasma membrane
Vocabulary: molecular function
TermDefinition
GO:0016787hydrolase activity
GO:0046872metal ion binding
GO:0008233peptidase activity
GO:0008237metallopeptidase activity
GO:0004222metalloendopeptidase activity
GO:0005229intracellular calcium activated chloride channel activity
GO:0005254chloride channel activity
Vocabulary: biological process
TermDefinition
GO:0034220ion transmembrane transport
GO:0071456cellular response to hypoxia
GO:1902476chloride transmembrane transport
GO:0006508proteolysis
GO:0006810transport
GO:0006811ion transport
GO:0006816calcium ion transport
GO:0006821chloride transport