gamma-aminobutyric acid type B receptor subunit 1

Overview
Namegamma-aminobutyric acid type B receptor subunit 1
Smed IDSMED30021921
Length (bp)3332
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of gamma-aminobutyric acid type B receptor subunit 1 (SMED30021921) t-SNE clustered cells

Violin plots show distribution of expression levels for gamma-aminobutyric acid type B receptor subunit 1 (SMED30021921) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of gamma-aminobutyric acid type B receptor subunit 1 (SMED30021921) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for gamma-aminobutyric acid type B receptor subunit 1 (SMED30021921) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021921

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30021921SMESG000036774.1 SMESG000036762.1 SmedASXL_018052SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parenchymal cellSMED30021921SMESG000051694.1 dd_Smed_v4_7897_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30021921SMESG000036774.1 SMESG000036762.1 dd_Smed_v6_20665_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Human
Match: GABBR1 (gamma-aminobutyric acid type B receptor subunit 1 [Source:HGNC Symbol;Acc:HGNC:4070])

HSP 1 Score: 509.99 bits (1312), Expect = 8.878e-165
Identity = 324/810 (40.00%), Postives = 470/810 (58.02%), Query Frame = 2
Query:  605 KEKQLHIGAVFPMSGDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRIKRQFRKTGDQDENIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREIEHLKSQL 3034
            + + ++IGA+FPMSG W GG +C+PA  MAL DVN++ DILPDY L +   DS+C  G  ++ +YEL+Y  P+KI+ + GCS+V+T VAEAA  WNLIV+++G+SSPALSNR RFP+FFRTHPSA+L NPTR+KL ++WGWKK++ I +  EVF+ST+ D E  VKE  I I  RQ          + +K+LK +DARII+GLFYE  ARKVFCE YK  L+G K VW +IGWY D+W+K +     INCT  EM  AVEGHITTE +M N  +  + S +TS++F ++L   LK   R+PE                +  G+ EAPLAYDAIWA+A+AL+K +       V L +F Y+ Q   I ++++RAMN + F GVS  V FD+SG+R++WT IEQ+  GSY  +G++    D+L+  K   W     P D   +I   R L   ++I    L  + I+  VVC+ F    +      + +  L  L ++GC L +  +  LG D      I  N  F  +CQ ++  + LGFSLGYGS+F  IW V+ V T +++    R T                                W++   +G     DV+ L  W+  DPL R    F +E+   D D+   P +E C  R +  WLGI +G+KGL+L+LG+ L+YET+++      D R+ GMA+YNV VL LITAPV++++  +Q A F F S +I+ +S ++L ++++P+++R   +   Q E   +          EEE+      EN +L++ I++ E  +  L+ QL
Sbjct:   49 ERRAVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPA---VPVKNLKRQDARIIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADNWFKIY--DPSINCTVDEMTEAVEGHITTEIVMLNPANTRSISNMTSQEFVEKLTKRLK---RHPE----------------ETGGFQEAPLAYDAIWALALALNKTSGGGGRSGVRLEDFNYNNQ--TITDQIYRAMNSSSFEGVSGHVVFDASGSRMAWTLIEQLQGGSYKKIGYYDSTKDDLSWSKTDKWIGGSPPADQTLVIKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLNNLTAVGCSLALAAVFPLGLD---GYHIGRNQ-FPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFTKKEEKKEWRKT-----------------------------LEPWKLYATVGLLVGMDVLTLAIWQIVDPLHRTIETFAKEEPKEDIDVSILPQLEHCSSRKMNTWLGIFYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDAAFAFASLAIVFSSYITLVVLFVPKMRRLITRGEWQSEAQDTMKTGSSTNNNEEEKSRLLEKENRELEKIIAEKEERVSELRHQL 799          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Human
Match: GABBR1 (gamma-aminobutyric acid type B receptor subunit 1 [Source:HGNC Symbol;Acc:HGNC:4070])

HSP 1 Score: 509.99 bits (1312), Expect = 8.878e-165
Identity = 324/810 (40.00%), Postives = 470/810 (58.02%), Query Frame = 2
Query:  605 KEKQLHIGAVFPMSGDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRIKRQFRKTGDQDENIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREIEHLKSQL 3034
            + + ++IGA+FPMSG W GG +C+PA  MAL DVN++ DILPDY L +   DS+C  G  ++ +YEL+Y  P+KI+ + GCS+V+T VAEAA  WNLIV+++G+SSPALSNR RFP+FFRTHPSA+L NPTR+KL ++WGWKK++ I +  EVF+ST+ D E  VKE  I I  RQ          + +K+LK +DARII+GLFYE  ARKVFCE YK  L+G K VW +IGWY D+W+K +     INCT  EM  AVEGHITTE +M N  +  + S +TS++F ++L   LK   R+PE                +  G+ EAPLAYDAIWA+A+AL+K +       V L +F Y+ Q   I ++++RAMN + F GVS  V FD+SG+R++WT IEQ+  GSY  +G++    D+L+  K   W     P D   +I   R L   ++I    L  + I+  VVC+ F    +      + +  L  L ++GC L +  +  LG D      I  N  F  +CQ ++  + LGFSLGYGS+F  IW V+ V T +++    R T                                W++   +G     DV+ L  W+  DPL R    F +E+   D D+   P +E C  R +  WLGI +G+KGL+L+LG+ L+YET+++      D R+ GMA+YNV VL LITAPV++++  +Q A F F S +I+ +S ++L ++++P+++R   +   Q E   +          EEE+      EN +L++ I++ E  +  L+ QL
Sbjct:   49 ERRAVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPA---VPVKNLKRQDARIIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADNWFKIY--DPSINCTVDEMTEAVEGHITTEIVMLNPANTRSISNMTSQEFVEKLTKRLK---RHPE----------------ETGGFQEAPLAYDAIWALALALNKTSGGGGRSGVRLEDFNYNNQ--TITDQIYRAMNSSSFEGVSGHVVFDASGSRMAWTLIEQLQGGSYKKIGYYDSTKDDLSWSKTDKWIGGSPPADQTLVIKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLNNLTAVGCSLALAAVFPLGLD---GYHIGRNQ-FPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFTKKEEKKEWRKT-----------------------------LEPWKLYATVGLLVGMDVLTLAIWQIVDPLHRTIETFAKEEPKEDIDVSILPQLEHCSSRKMNTWLGIFYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDAAFAFASLAIVFSSYITLVVLFVPKMRRLITRGEWQSEAQDTMKTGSSTNNNEEEKSRLLEKENRELEKIIAEKEERVSELRHQL 799          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Human
Match: GABBR1 (gamma-aminobutyric acid type B receptor subunit 1 [Source:HGNC Symbol;Acc:HGNC:4070])

HSP 1 Score: 509.99 bits (1312), Expect = 8.878e-165
Identity = 324/810 (40.00%), Postives = 470/810 (58.02%), Query Frame = 2
Query:  605 KEKQLHIGAVFPMSGDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRIKRQFRKTGDQDENIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREIEHLKSQL 3034
            + + ++IGA+FPMSG W GG +C+PA  MAL DVN++ DILPDY L +   DS+C  G  ++ +YEL+Y  P+KI+ + GCS+V+T VAEAA  WNLIV+++G+SSPALSNR RFP+FFRTHPSA+L NPTR+KL ++WGWKK++ I +  EVF+ST+ D E  VKE  I I  RQ          + +K+LK +DARII+GLFYE  ARKVFCE YK  L+G K VW +IGWY D+W+K +     INCT  EM  AVEGHITTE +M N  +  + S +TS++F ++L   LK   R+PE                +  G+ EAPLAYDAIWA+A+AL+K +       V L +F Y+ Q   I ++++RAMN + F GVS  V FD+SG+R++WT IEQ+  GSY  +G++    D+L+  K   W     P D   +I   R L   ++I    L  + I+  VVC+ F    +      + +  L  L ++GC L +  +  LG D      I  N  F  +CQ ++  + LGFSLGYGS+F  IW V+ V T +++    R T                                W++   +G     DV+ L  W+  DPL R    F +E+   D D+   P +E C  R +  WLGI +G+KGL+L+LG+ L+YET+++      D R+ GMA+YNV VL LITAPV++++  +Q A F F S +I+ +S ++L ++++P+++R   +   Q E   +          EEE+      EN +L++ I++ E  +  L+ QL
Sbjct:   49 ERRAVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPA---VPVKNLKRQDARIIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADNWFKIY--DPSINCTVDEMTEAVEGHITTEIVMLNPANTRSISNMTSQEFVEKLTKRLK---RHPE----------------ETGGFQEAPLAYDAIWALALALNKTSGGGGRSGVRLEDFNYNNQ--TITDQIYRAMNSSSFEGVSGHVVFDASGSRMAWTLIEQLQGGSYKKIGYYDSTKDDLSWSKTDKWIGGSPPADQTLVIKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLNNLTAVGCSLALAAVFPLGLD---GYHIGRNQ-FPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFTKKEEKKEWRKT-----------------------------LEPWKLYATVGLLVGMDVLTLAIWQIVDPLHRTIETFAKEEPKEDIDVSILPQLEHCSSRKMNTWLGIFYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDAAFAFASLAIVFSSYITLVVLFVPKMRRLITRGEWQSEAQDTMKTGSSTNNNEEEKSRLLEKENRELEKIIAEKEERVSELRHQL 799          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Human
Match: GABBR1 (gamma-aminobutyric acid type B receptor subunit 1 [Source:HGNC Symbol;Acc:HGNC:4070])

HSP 1 Score: 509.99 bits (1312), Expect = 8.878e-165
Identity = 324/810 (40.00%), Postives = 470/810 (58.02%), Query Frame = 2
Query:  605 KEKQLHIGAVFPMSGDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRIKRQFRKTGDQDENIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREIEHLKSQL 3034
            + + ++IGA+FPMSG W GG +C+PA  MAL DVN++ DILPDY L +   DS+C  G  ++ +YEL+Y  P+KI+ + GCS+V+T VAEAA  WNLIV+++G+SSPALSNR RFP+FFRTHPSA+L NPTR+KL ++WGWKK++ I +  EVF+ST+ D E  VKE  I I  RQ          + +K+LK +DARII+GLFYE  ARKVFCE YK  L+G K VW +IGWY D+W+K +     INCT  EM  AVEGHITTE +M N  +  + S +TS++F ++L   LK   R+PE                +  G+ EAPLAYDAIWA+A+AL+K +       V L +F Y+ Q   I ++++RAMN + F GVS  V FD+SG+R++WT IEQ+  GSY  +G++    D+L+  K   W     P D   +I   R L   ++I    L  + I+  VVC+ F    +      + +  L  L ++GC L +  +  LG D      I  N  F  +CQ ++  + LGFSLGYGS+F  IW V+ V T +++    R T                                W++   +G     DV+ L  W+  DPL R    F +E+   D D+   P +E C  R +  WLGI +G+KGL+L+LG+ L+YET+++      D R+ GMA+YNV VL LITAPV++++  +Q A F F S +I+ +S ++L ++++P+++R   +   Q E   +          EEE+      EN +L++ I++ E  +  L+ QL
Sbjct:   49 ERRAVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPA---VPVKNLKRQDARIIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADNWFKIY--DPSINCTVDEMTEAVEGHITTEIVMLNPANTRSISNMTSQEFVEKLTKRLK---RHPE----------------ETGGFQEAPLAYDAIWALALALNKTSGGGGRSGVRLEDFNYNNQ--TITDQIYRAMNSSSFEGVSGHVVFDASGSRMAWTLIEQLQGGSYKKIGYYDSTKDDLSWSKTDKWIGGSPPADQTLVIKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLNNLTAVGCSLALAAVFPLGLD---GYHIGRNQ-FPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFTKKEEKKEWRKT-----------------------------LEPWKLYATVGLLVGMDVLTLAIWQIVDPLHRTIETFAKEEPKEDIDVSILPQLEHCSSRKMNTWLGIFYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDAAFAFASLAIVFSSYITLVVLFVPKMRRLITRGEWQSEAQDTMKTGSSTNNNEEEKSRLLEKENRELEKIIAEKEERVSELRHQL 799          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Human
Match: GABBR1 (gamma-aminobutyric acid type B receptor subunit 1 [Source:HGNC Symbol;Acc:HGNC:4070])

HSP 1 Score: 509.99 bits (1312), Expect = 8.878e-165
Identity = 324/810 (40.00%), Postives = 470/810 (58.02%), Query Frame = 2
Query:  605 KEKQLHIGAVFPMSGDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRIKRQFRKTGDQDENIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREIEHLKSQL 3034
            + + ++IGA+FPMSG W GG +C+PA  MAL DVN++ DILPDY L +   DS+C  G  ++ +YEL+Y  P+KI+ + GCS+V+T VAEAA  WNLIV+++G+SSPALSNR RFP+FFRTHPSA+L NPTR+KL ++WGWKK++ I +  EVF+ST+ D E  VKE  I I  RQ          + +K+LK +DARII+GLFYE  ARKVFCE YK  L+G K VW +IGWY D+W+K +     INCT  EM  AVEGHITTE +M N  +  + S +TS++F ++L   LK   R+PE                +  G+ EAPLAYDAIWA+A+AL+K +       V L +F Y+ Q   I ++++RAMN + F GVS  V FD+SG+R++WT IEQ+  GSY  +G++    D+L+  K   W     P D   +I   R L   ++I    L  + I+  VVC+ F    +      + +  L  L ++GC L +  +  LG D      I  N  F  +CQ ++  + LGFSLGYGS+F  IW V+ V T +++    R T                                W++   +G     DV+ L  W+  DPL R    F +E+   D D+   P +E C  R +  WLGI +G+KGL+L+LG+ L+YET+++      D R+ GMA+YNV VL LITAPV++++  +Q A F F S +I+ +S ++L ++++P+++R   +   Q E   +          EEE+      EN +L++ I++ E  +  L+ QL
Sbjct:   49 ERRAVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPA---VPVKNLKRQDARIIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADNWFKIY--DPSINCTVDEMTEAVEGHITTEIVMLNPANTRSISNMTSQEFVEKLTKRLK---RHPE----------------ETGGFQEAPLAYDAIWALALALNKTSGGGGRSGVRLEDFNYNNQ--TITDQIYRAMNSSSFEGVSGHVVFDASGSRMAWTLIEQLQGGSYKKIGYYDSTKDDLSWSKTDKWIGGSPPADQTLVIKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLNNLTAVGCSLALAAVFPLGLD---GYHIGRNQ-FPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFTKKEEKKEWRKT-----------------------------LEPWKLYATVGLLVGMDVLTLAIWQIVDPLHRTIETFAKEEPKEDIDVSILPQLEHCSSRKMNTWLGIFYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDAAFAFASLAIVFSSYITLVVLFVPKMRRLITRGEWQSEAQDTMKTGSSTNNNEEEKSRLLEKENRELEKIIAEKEERVSELRHQL 799          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Celegans
Match: gbb-1 (Gamma-aminobutyric acid type B receptor subunit 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L0Q3])

HSP 1 Score: 448.743 bits (1153), Expect = 1.064e-141
Identity = 298/824 (36.17%), Postives = 463/824 (56.19%), Query Frame = 2
Query:  617 LHIGAVFPM---SGDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYL----ALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLS--IYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLG--ADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRV-ATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPL----SRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAP-VSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRIKRQFRKTGDQDENIISDDETIQ-LRKTEEEQHNKYFTENEQLKRQISQIEREIEHLKSQL 3034
            LHIG  FPM   SG WAGG +C PA  MAL DVN++ DILP Y L MT  +SQC  GL  + +Y+ +Y PP K+M LTGCS VTT +AEAAP W L+V+++G SSPALSNR RFP+ FRTHPSA++QNPTR+ +++++ WK+ +++  +EEVF +T  D E         I +++ ++   Q+ Y     A+K+L+ +DARII+GLFY   ARKV C+AY  GLYG + VW  IGWY D W+     ++ +NCT ++M  A E H TTES+M + D+    S +T  +F+ RL    +    N                   + G+ EAPLAYDA+WA+A+A +     L S  + L  F Y  +   I + L + +  T F GVS  V F  SG+RI+ T+IEQM  G Y ++G++   + +L    +  W N + P     +I ++ A+ +S   Y       ++ I + V    F  +     +    + +   +  IGC L +F + L+G  +D IS     S +LF +LC  +V  +  GF+  YGS+F  +WIV+R+ AT+ ++L + +  K++   +  +F  K       P+S       S +   ++ +    DV V   W   DPL     ++ ++   +    +ED    P ++ C      +W+GII G+K L+L+ G  LSYETRN+K  F  D+R  G+A+YNV V++L+TAP V+++I  K  A+F F+S ++L+ + +S+GLIY P+I+   +     DE  ++ +     + K ++++++    ENE L+ QI + ER+I   K +L
Sbjct:   24 LHIGGTFPMESGSGGWAGGEACLPAVEMALKDVNSRLDILPGYVLNMTNHNSQCQPGLAMQQLYDFLYKPPTKLMLLTGCSPVTTVIAEAAPVWKLVVLSYGGSSPALSNRNRFPTLFRTHPSANMQNPTRIHIMEKFKWKRFTILMSVEEVFVTTAKDLE--------AIARKKGIKVDRQSFYGDPTDAMKTLQRQDARIIVGLFYVTEARKVLCQAYHHGLYGRRYVWFFIGWYADTWY-IPPPEEHLNCTAEQMTEAAEYHFTTESVMLSRDNIPAISEMTGMQFQQRLTQYFQKDTAN-------------------VGGFPEAPLAYDAVWALALAFNCTRNNLPS-HIRLENFTYDNK--VIADTLFQCVKNTSFRGVSGKVMFSDSGDRIARTQIEQMQGGKYKIMGYYDTTSGDLEWYNKEQWLNGKGPPPDSTVI-KKHAMTVSNEFYYPTILFAVLGIAACVFIYLFTQKHHERLIIFQSQPECNNILLIGCSLCLFSLFLIGLPSDDISI----SESLFPLLCHARVTILLFGFTFAYGSMFAKVWIVHRMGATENQQLASRQ--KDELKPLLSNFSEK-------PIS-------SSKFYVIVAALTAVDVFVCFVWVLIDPLHLTEQKFPLFTPADS---EEDEMIMPVLQQCQSNQQEVWIGIIMGFKCLLLVFGTFLSYETRNLKLRFINDSRFVGLAIYNVAVMTLVTAPVVTLLIHGKVDANFAFISLTVLICTYISVGLIYGPKIRHIIKVPPSADEIQLNGNVGPGVMSKVDQKRYDMLKKENETLQIQIEEKERKIHECKERL 792          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Celegans
Match: gbb-1 (Gamma-aminobutyric acid type B receptor subunit 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L0Q3])

HSP 1 Score: 445.662 bits (1145), Expect = 1.346e-140
Identity = 298/820 (36.34%), Postives = 456/820 (55.61%), Query Frame = 2
Query:  617 LHIGAVFPM---SGDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLS--IYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLG--ADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRV-ATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPL----SRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAP-VSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRIKRQFRKTGDQDENIISDDETIQ-LRKTEEEQHNKYFTENEQLKRQISQIEREIEHLKSQL 3034
            LHIG  FPM   SG WAGG +C PA  MAL DVN++ DILP Y L MT  +SQC  GL  + +Y+ +Y PP K+M LTGCS VTT +AEAAP W L+V+++G SSPALSNR RFP+ FRTHPSA++QNPTR+ +++++ WK+ +++  +EEVF +T  D E   ++  I  V RQ           A+K+L+ +DARII+GLFY   ARKV C+AY  GLYG + VW  IGWY D W+     ++ +NCT ++M  A E H TTES+M + D+    S +T  +F+ RL    +    N                   + G+ EAPLAYDA+WA+A+A +     L S  + L  F Y  +   I + L + +  T F GVS  V F  SG+RI+ T+IEQM  G Y ++G++   + +L    +  W N + P     +I ++ A+ +S   Y       ++ I + V    F  +     +    + +   +  IGC L +F + L+G  +D IS     S +LF +LC  +V  +  GF+  YGS+F  +WIV+R+ AT+ ++L + +               KD+     P+S       S +   ++ +    DV V   W   DPL     ++ ++   +    +ED    P ++ C      +W+GII G+K L+L+ G  LSYETRN+K  F  D+R  G+A+YNV V++L+TAP V+++I  K  A+F F+S ++L+ + +S+GLIY P+I+   +     DE  ++ +     + K ++++++    ENE L+ QI + ER+I   K +L
Sbjct:   24 LHIGGTFPMESGSGGWAGGEACLPAVEMALKDVNSRLDILPGYVLNMTNHNSQCQPGLAMQQLYDFLYKPPTKLMLLTGCSPVTTVIAEAAPVWKLVVLSYGGSSPALSNRNRFPTLFRTHPSANMQNPTRIHIMEKFKWKRFTILMSVEEVFVTTAKDLEAIARKKGIK-VDRQSFYGDPTD---AMKTLQRQDARIIVGLFYVTEARKVLCQAYHHGLYGRRYVWFFIGWYADTWY-IPPPEEHLNCTAEQMTEAAEYHFTTESVMLSRDNIPAISEMTGMQFQQRLTQYFQKDTAN-------------------VGGFPEAPLAYDAVWALALAFNCTRNNLPS-HIRLENFTYDNK--VIADTLFQCVKNTSFRGVSGKVMFSDSGDRIARTQIEQMQGGKYKIMGYYDTTSGDLEWYNKEQWLNGKGPPPDSTVI-KKHAMTVSNEFYYPTILFAVLGIAACVFIYLFTQKHHERLIIFQSQPECNNILLIGCSLCLFSLFLIGLPSDDISI----SESLFPLLCHARVTILLFGFTFAYGSMFAKVWIVHRMGATENQQLASRQ---------------KDE-----PIS-------SSKFYVIVAALTAVDVFVCFVWVLIDPLHLTEQKFPLFTPADS---EEDEMIMPVLQQCQSNQQEVWIGIIMGFKCLLLVFGTFLSYETRNLKLRFINDSRFVGLAIYNVAVMTLVTAPVVTLLIHGKVDANFAFISLTVLICTYISVGLIYGPKIRHIIKVPPSADEIQLNGNVGPGVMSKVDQKRYDMLKKENETLQIQIEEKERKIHECKERL 781          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Celegans
Match: gbb-1 (Gamma-aminobutyric acid type B receptor subunit 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L0Q3])

HSP 1 Score: 443.736 bits (1140), Expect = 2.068e-139
Identity = 296/841 (35.20%), Postives = 465/841 (55.29%), Query Frame = 2
Query:  617 LHIGAVFPM---SGDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYL----ALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLS--IYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLG--ADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRV-ATDRKKLTTDRCTKNK------CGTIEDSFQIKDKLLKIAPVSKIGV-----------KYNSWEVIGMLGSFCMADVVVLLAWRYFDPL----SRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAP-VSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRIKRQFRKTGDQDENIISDDETIQ-LRKTEEEQHNKYFTENEQLKRQISQIEREIEHLKSQL 3034
            LHIG  FPM   SG WAGG +C PA  MAL DVN++ DILP Y L MT  +SQC  GL  + +Y+ +Y PP K+M LTGCS VTT +AEAAP W L+V+++G SSPALSNR RFP+ FRTHPSA++QNPTR+ +++++ WK+ +++  +EEVF +T  D E         I +++ ++   Q+ Y     A+K+L+ +DARII+GLFY   ARKV C+AY  GLYG + VW  IGWY D W+     ++ +NCT ++M  A E H TTES+M + D+    S +T  +F+ RL    +    N                   + G+ EAPLAYDA+WA+A+A +     L S  + L  F Y  +   I + L + +  T F GVS  V F  SG+RI+ T+IEQM  G Y ++G++   + +L    +  W N + P     +I ++ A+ +S   Y       ++ I + V    F  +     +    + +   +  IGC L +F + L+G  +D IS     S +LF +LC  +V  +  GF+  YGS+F  +WIV+R+ AT+ ++L + +  + +        T+  +   +  L++ +     G              +S +   ++ +    DV V   W   DPL     ++ ++   +    +ED    P ++ C      +W+GII G+K L+L+ G  LSYETRN+K  F  D+R  G+A+YNV V++L+TAP V+++I  K  A+F F+S ++L+ + +S+GLIY P+I+   +     DE  ++ +     + K ++++++    ENE L+ QI + ER+I   K +L
Sbjct:   24 LHIGGTFPMESGSGGWAGGEACLPAVEMALKDVNSRLDILPGYVLNMTNHNSQCQPGLAMQQLYDFLYKPPTKLMLLTGCSPVTTVIAEAAPVWKLVVLSYGGSSPALSNRNRFPTLFRTHPSANMQNPTRIHIMEKFKWKRFTILMSVEEVFVTTAKDLE--------AIARKKGIKVDRQSFYGDPTDAMKTLQRQDARIIVGLFYVTEARKVLCQAYHHGLYGRRYVWFFIGWYADTWY-IPPPEEHLNCTAEQMTEAAEYHFTTESVMLSRDNIPAISEMTGMQFQQRLTQYFQKDTAN-------------------VGGFPEAPLAYDAVWALALAFNCTRNNLPS-HIRLENFTYDNK--VIADTLFQCVKNTSFRGVSGKVMFSDSGDRIARTQIEQMQGGKYKIMGYYDTTSGDLEWYNKEQWLNGKGPPPDSTVI-KKHAMTVSNEFYYPTILFAVLGIAACVFIYLFTQKHHERLIIFQSQPECNNILLIGCSLCLFSLFLIGLPSDDISI----SESLFPLLCHARVTILLFGFTFAYGSMFAKVWIVHRMGATENQQLASRQKDEEENTPWEGIRTLISTMVGRQALMRKSSGQAYGALLEKRNTVLNQPISSSKFYVIVAALTAVDVFVCFVWVLIDPLHLTEQKFPLFTPADS---EEDEMIMPVLQQCQSNQQEVWIGIIMGFKCLLLVFGTFLSYETRNLKLRFINDSRFVGLAIYNVAVMTLVTAPVVTLLIHGKVDANFAFISLTVLICTYISVGLIYGPKIRHIIKVPPSADEIQLNGNVGPGVMSKVDQKRYDMLKKENETLQIQIEEKERKIHECKERL 825          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Celegans
Match: gbb-1 (Gamma-aminobutyric acid type B receptor subunit 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L0Q3])

HSP 1 Score: 356.681 bits (914), Expect = 4.498e-111
Identity = 209/538 (38.85%), Postives = 305/538 (56.69%), Query Frame = 2
Query:  617 LHIGAVFPM---SGDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIY---FVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLG--ADRISSVKIKSNTLFMVLCQLKVAF 2206
            LHIG  FPM   SG WAGG +C PA  MAL DVN++ DILP Y L MT  +SQC  GL  + +Y+ +Y PP K+M LTGCS VTT +AEAAP W L+V+++G SSPALSNR RFP+ FRTHPSA++QNPTR+ +++++ WK+ +++  +EEVF +T  D E   ++  I  V RQ           A+K+L+ +DARII+GLFY   ARKV C+AY  GLYG + VW  IGWY D W+     ++ +NCT ++M  A E H TTES+M + D+    S +T  +F+ RL    +    N                   + G+ EAPLAYDA+WA+A+A +     L S  + L  F Y  +   I + L + +  T F GVS  V F  SG+RI+ T+IEQM  G Y ++G++   + +L    +  W N + P     +I ++ A+ +S    +   +L  ++    C++   F  +     +    + +   +  IGC L +F + L+G  +D IS     S +LF +LC +   F
Sbjct:   24 LHIGGTFPMESGSGGWAGGEACLPAVEMALKDVNSRLDILPGYVLNMTNHNSQCQPGLAMQQLYDFLYKPPTKLMLLTGCSPVTTVIAEAAPVWKLVVLSYGGSSPALSNRNRFPTLFRTHPSANMQNPTRIHIMEKFKWKRFTILMSVEEVFVTTAKDLEAIARKKGIK-VDRQSFYGDPTD---AMKTLQRQDARIIVGLFYVTEARKVLCQAYHHGLYGRRYVWFFIGWYADTWY-IPPPEEHLNCTAEQMTEAAEYHFTTESVMLSRDNIPAISEMTGMQFQQRLTQYFQKDTAN-------------------VGGFPEAPLAYDAVWALALAFNCTRNNLPS-HIRLENFTYDNK--VIADTLFQCVKNTSFRGVSGKVMFSDSGDRIARTQIEQMQGGKYKIMGYYDTTSGDLEWYNKEQWLNGKGPPPDSTVI-KKHAMTVSNEF-YYPTILFAVLGIAACVFIYLFTQKHHERLIIFQSQPECNNILLIGCSLCLFSLFLIGLPSDDISI----SESLFPLLCHVSQTF 528          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Celegans
Match: gbb-2 (Gamma-aminobutyric acid type B receptor subunit 2 [Source:UniProtKB/Swiss-Prot;Acc:G5ECB2])

HSP 1 Score: 149.828 bits (377), Expect = 1.443e-36
Identity = 185/786 (23.54%), Postives = 347/786 (44.15%), Query Frame = 2
Query:  560 YFCMIIFYVDIVDNFKE------KQLHIGAVFPM---SGDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTG-CSTVTTFVAEAAPRWNLIVMAFGASSPALSNRAR---FPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKE--LNITIVKRQPLQ-KHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLK--DQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPS--WTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRI 2857
            +  +++F V  V  ++       K+ H G   P+   +    G     PA   AL+ V++++ IL  Y L M +KD+ C    G + +++LI + P  +  L G C+ V   +A A   W ++ +++  +    ++      F +FFR  P +   N  + K +  +GWK+V  + + ++   +  H+   +  E    + IV    +  +  + V   L  LK +D RII+    E++A  V C  Y  G+YG   VW++ G++ D W    L +   NCT +EM+ A + H + E              LT R    +++   +  D W    N+I++      L       GY      YD +W +AIAL  +           +EF +H        ++  A++ + F G++  V F ++  R+    I+Q  +G Y     +    D   ++   +  W+    P DS     +R  +   +++    L LI I   ++ +    R             L  +   G +     +I+LG D     +I S  +F+ LC  K   +C+GF+L +G++F   W V+ + T+ +                D   IKD  L I                 +LG     D+ VL+ W +  P S Y V   +   I +++I   P +E C+  + G++  +++  KG+++ILG  L++ETR++      D++  G +VY  VV+S++    SV+++++ +  F   S  ++ ++ L+L L+++P++
Sbjct:    4 WLSLLLFAVQAVGGYEAGEELSCKRRHGGIPLPLGVFTVQKEGFPDALPAIRTALSHVHSRSCILQGYRLEMIVKDTHCKTSQGMKALFDLIASRPRPVAILGGQCTEVNEPIAMALKYWQIVQLSYAETHAKFASSDSHELFTTFFRVVPGSRNTNMAKCKFVNHFGWKRVGTVKQNDQPRYALPHEALTTRLEHGFGVKIVHTAGVNWEQIETVGGELDELKERDVRIILVDVDEEMAATVLCAGYHRGMYGDNYVWILPGYHSDKW----LNQTHDNCTVEEMREAAKNHFSVE------------FALTRRDVDTKIVGNTRAGDVW----NEITQ------LDPNNTWRGY-----LYDGLWTLAIALSHSMG-------DNAEFSHH--------KMMEAIDNSSFQGLTGKVKF-ANNERLGLVDIKQWSDGQYVPFAVYDGADDEFKIIDSTTKGWSP---PLDSTITERRREHISSILFLAMSLLALIGIFLALIFLLINFRYRNHRFIKMSSPNLNNIIIAGSICTFASVIMLGLD----TRIVSPDVFVWLCYTKTWTLCIGFTLSFGAMFSKTWRVHSIFTNIRM---------------DRKAIKDSKLFI-----------------ILGILLFIDICVLVTWAFVSPFS-YTV--TELPHIPEDNIVIIPEVEKCNSSHSGVFQAVLYAVKGVLMILGCFLAWETRHVNVPALNDSKYIGTSVYCCVVMSVLGLSTSVILQERVNEMFSLASFFVIFSTTLTLCLVFVPKV 700          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Fly
Match: GABA-B-R1 (gene:FBgn0260446 transcript:FBtr0304732)

HSP 1 Score: 545.043 bits (1403), Expect = 1.083e-178
Identity = 329/836 (39.35%), Postives = 490/836 (58.61%), Query Frame = 2
Query:  605 KEKQLHIGAVFPMSG--DWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLSIYIGFC----CLVLICIISGVVCIYFVH-RCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDI-LDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRIKRQFRKTGDQDENIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREIEHLKSQLTNVYDVENLGISSQSIVA 3088
            +  +LHIG +FP++G   W GG +C PAA +AL+DVN Q ++LP + L +   DS+C  GLG+ +MY L+Y  P K+M L GCSTV T VAEAA  WNLIV+ +GASSPALS+R RFP+ FRTHPSA++ NPTR+KL+K++GW +V+++ + EEVF ST+ D E    E  + IV RQ           A+++L+ +DARII+GLFY   AR+V CE YK  LYG   VW  IGWY D+W++ +LK +GI CT ++M++A EGH+TTE+LMWN ++  T SG+T+ +F+ RL   L          I EG     ++      GY EAPLAYDA+W++A+A +K  +RL + K SL +F Y     EI +E++ AMN T F+GVS +V F S G+RI+ T+IEQMI+G Y  LG++    DNL+ L    W   ++P+D   +    R + L +++  C    C + +     +  I+  H R   SS      + L      G ++ +  +ILLG D     +  S   +  +CQ +   +  GF+L YG++F  +W V+R  T  K                      D   K+ P          W++  M+      D+V+LL+W+ FDPL RY   F  E  +   +DI  +P +E C+ +   +WLG+++G+KGL+L+ GL L+YETR+IK     D+R  GM++YNVVVL LITAPV ++I  +Q A F FV+ +++    LS+ LI++P++    R   D+ E+  + D  I   K +EE++ K  TENE+L+R I+Q E +I  L+ +L    D +   ++  + VA
Sbjct:   29 RPDELHIGGIFPIAGKGGWQGGQACMPAARLALDDVNKQPNLLPGFKLILHSNDSECEPGLGASVMYNLLYNKPQKLMLLAGCSTVCTTVAEAAKMWNLIVLCYGASSPALSDRKRFPTLFRTHPSATVHNPTRIKLMKKFGWSRVAILQQAEEVFISTVEDLENRCMEAGVEIVTRQSFLSDPTD---AVRNLRRQDARIIVGLFYVVAARRVLCEMYKQQLYGRAHVWFFIGWYEDNWYEVNLKAEGITCTVEQMRIAAEGHLTTEALMWNQNNQTTISGMTAEEFRHRLNQAL----------IEEGY---DINHDRYPEGYQEAPLAYDAVWSVALAFNKTMERLTTGKKSLRDFTY--TDKEIADEIYAAMNSTQFLGVSGVVAFSSQGDRIALTQIEQMIDGKYEKLGYYDTQLDNLSWLNTEQWIGGKVPQDRTIVTHVLRTVSLPLFVCMCTISSCGIFVAFALIIFNIWNKHRRVIQSSHPVCNTIML-----FGVIICLISVILLGIDG----RFVSPEEYPKICQARAWLLSTGFTLAYGAMFSKVWRVHRFTTKAK---------------------TDPKKKVEP----------WKLYTMVSGLLSIDLVILLSWQIFDPLQRYLETFPLEDPVSTTDDIKIRPELEHCESQRNSMWLGLVYGFKGLILVFGLFLAYETRSIKVKQINDSRYVGMSIYNVVVLCLITAPVGMVIASQQDASFAFVALAVIFCCFLSMLLIFVPKVIEVIRHPKDKAESKYNPDSAIS--KEDEERYQKLVTENEELQRLITQKEEKIRVLRQRLVERGDAKGTELNGATGVA 804          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Fly
Match: GABA-B-R1 (gene:FBgn0260446 transcript:FBtr0304731)

HSP 1 Score: 545.043 bits (1403), Expect = 1.083e-178
Identity = 329/836 (39.35%), Postives = 490/836 (58.61%), Query Frame = 2
Query:  605 KEKQLHIGAVFPMSG--DWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLSIYIGFC----CLVLICIISGVVCIYFVH-RCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDI-LDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRIKRQFRKTGDQDENIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREIEHLKSQLTNVYDVENLGISSQSIVA 3088
            +  +LHIG +FP++G   W GG +C PAA +AL+DVN Q ++LP + L +   DS+C  GLG+ +MY L+Y  P K+M L GCSTV T VAEAA  WNLIV+ +GASSPALS+R RFP+ FRTHPSA++ NPTR+KL+K++GW +V+++ + EEVF ST+ D E    E  + IV RQ           A+++L+ +DARII+GLFY   AR+V CE YK  LYG   VW  IGWY D+W++ +LK +GI CT ++M++A EGH+TTE+LMWN ++  T SG+T+ +F+ RL   L          I EG     ++      GY EAPLAYDA+W++A+A +K  +RL + K SL +F Y     EI +E++ AMN T F+GVS +V F S G+RI+ T+IEQMI+G Y  LG++    DNL+ L    W   ++P+D   +    R + L +++  C    C + +     +  I+  H R   SS      + L      G ++ +  +ILLG D     +  S   +  +CQ +   +  GF+L YG++F  +W V+R  T  K                      D   K+ P          W++  M+      D+V+LL+W+ FDPL RY   F  E  +   +DI  +P +E C+ +   +WLG+++G+KGL+L+ GL L+YETR+IK     D+R  GM++YNVVVL LITAPV ++I  +Q A F FV+ +++    LS+ LI++P++    R   D+ E+  + D  I   K +EE++ K  TENE+L+R I+Q E +I  L+ +L    D +   ++  + VA
Sbjct:   29 RPDELHIGGIFPIAGKGGWQGGQACMPAARLALDDVNKQPNLLPGFKLILHSNDSECEPGLGASVMYNLLYNKPQKLMLLAGCSTVCTTVAEAAKMWNLIVLCYGASSPALSDRKRFPTLFRTHPSATVHNPTRIKLMKKFGWSRVAILQQAEEVFISTVEDLENRCMEAGVEIVTRQSFLSDPTD---AVRNLRRQDARIIVGLFYVVAARRVLCEMYKQQLYGRAHVWFFIGWYEDNWYEVNLKAEGITCTVEQMRIAAEGHLTTEALMWNQNNQTTISGMTAEEFRHRLNQAL----------IEEGY---DINHDRYPEGYQEAPLAYDAVWSVALAFNKTMERLTTGKKSLRDFTY--TDKEIADEIYAAMNSTQFLGVSGVVAFSSQGDRIALTQIEQMIDGKYEKLGYYDTQLDNLSWLNTEQWIGGKVPQDRTIVTHVLRTVSLPLFVCMCTISSCGIFVAFALIIFNIWNKHRRVIQSSHPVCNTIML-----FGVIICLISVILLGIDG----RFVSPEEYPKICQARAWLLSTGFTLAYGAMFSKVWRVHRFTTKAK---------------------TDPKKKVEP----------WKLYTMVSGLLSIDLVILLSWQIFDPLQRYLETFPLEDPVSTTDDIKIRPELEHCESQRNSMWLGLVYGFKGLILVFGLFLAYETRSIKVKQINDSRYVGMSIYNVVVLCLITAPVGMVIASQQDASFAFVALAVIFCCFLSMLLIFVPKVIEVIRHPKDKAESKYNPDSAIS--KEDEERYQKLVTENEELQRLITQKEEKIRVLRQRLVERGDAKGTELNGATGVA 804          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Fly
Match: GABA-B-R3 (gene:FBgn0031275 transcript:FBtr0343787)

HSP 1 Score: 222.631 bits (566), Expect = 6.439e-59
Identity = 228/847 (26.92%), Postives = 399/847 (47.11%), Query Frame = 2
Query:  647 GDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFL---TGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHI---TTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPE-------NKIS---------------------EGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAK--RLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTL----LKEPSWTNSRIPRDSVALIFQRRA---LPLSIYIGFCCLVLICIISGVVCIYF-VHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRIKRQFRKTGDQDENIIS-------------DDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREIE 3016
            G    G+S   AA MA+  +N +  +LP Y L +   D+QC  G+G    +  IYT P   M +   + CS VT  +A+  P WN++ ++FG++SPALS+R  FP F+RT    S  NP R+  ++++GW  V+   + EEV S  +++    ++  NI+               L L  L+  D RIIIG F ++LA ++ CEAY+L ++GA   W++       WW          C+  E+++AVE  I   T  S++ NN   V++SGL +  F  +L      Q+   +       ++IS                       L  E +SQ         AP  YDA+WAIA+AL  A +  R   ++  L  F+Y    +++  E  + M + +F+GVS  V F S  +R+  T   Q+  G    +  ++  TD L       +   W + ++P      +F+ R     PL+ Y     L  + I   +  + F +H     ++K     KL  + ++GC+     +ILLG D   S    +   F  +C  +V  +  GFSL +GS+F   + V+R+ T             + G++      KDK+L+              ++I ++G   + D +++  W   DP+ R+      E    D  + YQP +E+C  ++   WL +++ +KGL+L++G+ +++ETR++K     D++  G++VY+VV+ S I   ++ +I ++ +  F+ ++  IL ++  +L L++IP++   + +    D  I S              D+  +L+   E Q+  Y  E + L  +I ++ER +E
Sbjct:  166 GPRPDGLSELGAATMAVEHINRK-RLLPGYTLELVTNDTQCDPGVGVDRFFHAIYTQPSTRMVMLLGSACSEVTESLAKVVPYWNIVQVSFGSTSPALSDRREFPYFYRTVAPDSSHNPARIAFIRKFGWGTVTTFSQNEEVHSLAVNNLVTELEAANISCAATITFAATDFKEQLLL--LRETDTRIIIGSFSQELAPQILCEAYRLRMFGADYAWILHESMGAPWW----PDQRTACSNHELQLAVENLIVVSTHNSIVGNN---VSYSGLNNHMFNSQLRKQ-SAQFHGQDGFGSGYGSRISIAATQSDSRRRRRRGVGGTSGGHLFPEAISQY--------APQTYDAVWAIALALRAAEEHWRRNEEQSKLDGFDY--TRSDMAWEFLQQMGKLHFLGVSGPVSF-SGPDRVGTTAFYQIQRGLLEPVALYYPATDALDFRCPRCRPVKWHSGQVP--IAKRVFKLRVATIAPLAFYT-IATLSSVGIALAIAFLAFNLHFRKLKAIKLSSP-KLSNITAVGCIFVYATVILLGLDH--STLPSAEDSFATVCTARVYLLSAGFSLAFGSMFAKTYRVHRIFT-------------RTGSV-----FKDKMLQ------------DIQLILLVGGLLLVDALLVTLWVVTDPMERHLHNLTLEISATDRSVVYQPQVEVCRSQHTQTWLSVLYAYKGLLLVVGVYMAWETRHVKIPALNDSQYIGVSVYSVVITSAIVVVLANLISERVTLAFITITALILTSTTATLCLLFIPKLHDIWARNDIIDPVIHSMGLKMECNTRRFVVDDRRELQYRVEVQNRVYKKEIQALDAEIRKLERLLE 954          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Fly
Match: GABA-B-R3 (gene:FBgn0031275 transcript:FBtr0343785)

HSP 1 Score: 222.631 bits (566), Expect = 6.439e-59
Identity = 228/847 (26.92%), Postives = 399/847 (47.11%), Query Frame = 2
Query:  647 GDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFL---TGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHI---TTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPE-------NKIS---------------------EGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAK--RLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTL----LKEPSWTNSRIPRDSVALIFQRRA---LPLSIYIGFCCLVLICIISGVVCIYF-VHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRIKRQFRKTGDQDENIIS-------------DDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREIE 3016
            G    G+S   AA MA+  +N +  +LP Y L +   D+QC  G+G    +  IYT P   M +   + CS VT  +A+  P WN++ ++FG++SPALS+R  FP F+RT    S  NP R+  ++++GW  V+   + EEV S  +++    ++  NI+               L L  L+  D RIIIG F ++LA ++ CEAY+L ++GA   W++       WW          C+  E+++AVE  I   T  S++ NN   V++SGL +  F  +L      Q+   +       ++IS                       L  E +SQ         AP  YDA+WAIA+AL  A +  R   ++  L  F+Y    +++  E  + M + +F+GVS  V F S  +R+  T   Q+  G    +  ++  TD L       +   W + ++P      +F+ R     PL+ Y     L  + I   +  + F +H     ++K     KL  + ++GC+     +ILLG D   S    +   F  +C  +V  +  GFSL +GS+F   + V+R+ T             + G++      KDK+L+              ++I ++G   + D +++  W   DP+ R+      E    D  + YQP +E+C  ++   WL +++ +KGL+L++G+ +++ETR++K     D++  G++VY+VV+ S I   ++ +I ++ +  F+ ++  IL ++  +L L++IP++   + +    D  I S              D+  +L+   E Q+  Y  E + L  +I ++ER +E
Sbjct:  166 GPRPDGLSELGAATMAVEHINRK-RLLPGYTLELVTNDTQCDPGVGVDRFFHAIYTQPSTRMVMLLGSACSEVTESLAKVVPYWNIVQVSFGSTSPALSDRREFPYFYRTVAPDSSHNPARIAFIRKFGWGTVTTFSQNEEVHSLAVNNLVTELEAANISCAATITFAATDFKEQLLL--LRETDTRIIIGSFSQELAPQILCEAYRLRMFGADYAWILHESMGAPWW----PDQRTACSNHELQLAVENLIVVSTHNSIVGNN---VSYSGLNNHMFNSQLRKQ-SAQFHGQDGFGSGYGSRISIAATQSDSRRRRRRGVGGTSGGHLFPEAISQY--------APQTYDAVWAIALALRAAEEHWRRNEEQSKLDGFDY--TRSDMAWEFLQQMGKLHFLGVSGPVSF-SGPDRVGTTAFYQIQRGLLEPVALYYPATDALDFRCPRCRPVKWHSGQVP--IAKRVFKLRVATIAPLAFYT-IATLSSVGIALAIAFLAFNLHFRKLKAIKLSSP-KLSNITAVGCIFVYATVILLGLDH--STLPSAEDSFATVCTARVYLLSAGFSLAFGSMFAKTYRVHRIFT-------------RTGSV-----FKDKMLQ------------DIQLILLVGGLLLVDALLVTLWVVTDPMERHLHNLTLEISATDRSVVYQPQVEVCRSQHTQTWLSVLYAYKGLLLVVGVYMAWETRHVKIPALNDSQYIGVSVYSVVITSAIVVVLANLISERVTLAFITITALILTSTTATLCLLFIPKLHDIWARNDIIDPVIHSMGLKMECNTRRFVVDDRRELQYRVEVQNRVYKKEIQALDAEIRKLERLLE 954          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Fly
Match: GABA-B-R3 (gene:FBgn0031275 transcript:FBtr0078001)

HSP 1 Score: 222.631 bits (566), Expect = 6.439e-59
Identity = 228/847 (26.92%), Postives = 399/847 (47.11%), Query Frame = 2
Query:  647 GDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFL---TGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHI---TTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPE-------NKIS---------------------EGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAK--RLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTL----LKEPSWTNSRIPRDSVALIFQRRA---LPLSIYIGFCCLVLICIISGVVCIYF-VHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRIKRQFRKTGDQDENIIS-------------DDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREIE 3016
            G    G+S   AA MA+  +N +  +LP Y L +   D+QC  G+G    +  IYT P   M +   + CS VT  +A+  P WN++ ++FG++SPALS+R  FP F+RT    S  NP R+  ++++GW  V+   + EEV S  +++    ++  NI+               L L  L+  D RIIIG F ++LA ++ CEAY+L ++GA   W++       WW          C+  E+++AVE  I   T  S++ NN   V++SGL +  F  +L      Q+   +       ++IS                       L  E +SQ         AP  YDA+WAIA+AL  A +  R   ++  L  F+Y    +++  E  + M + +F+GVS  V F S  +R+  T   Q+  G    +  ++  TD L       +   W + ++P      +F+ R     PL+ Y     L  + I   +  + F +H     ++K     KL  + ++GC+     +ILLG D   S    +   F  +C  +V  +  GFSL +GS+F   + V+R+ T             + G++      KDK+L+              ++I ++G   + D +++  W   DP+ R+      E    D  + YQP +E+C  ++   WL +++ +KGL+L++G+ +++ETR++K     D++  G++VY+VV+ S I   ++ +I ++ +  F+ ++  IL ++  +L L++IP++   + +    D  I S              D+  +L+   E Q+  Y  E + L  +I ++ER +E
Sbjct:  166 GPRPDGLSELGAATMAVEHINRK-RLLPGYTLELVTNDTQCDPGVGVDRFFHAIYTQPSTRMVMLLGSACSEVTESLAKVVPYWNIVQVSFGSTSPALSDRREFPYFYRTVAPDSSHNPARIAFIRKFGWGTVTTFSQNEEVHSLAVNNLVTELEAANISCAATITFAATDFKEQLLL--LRETDTRIIIGSFSQELAPQILCEAYRLRMFGADYAWILHESMGAPWW----PDQRTACSNHELQLAVENLIVVSTHNSIVGNN---VSYSGLNNHMFNSQLRKQ-SAQFHGQDGFGSGYGSRISIAATQSDSRRRRRRGVGGTSGGHLFPEAISQY--------APQTYDAVWAIALALRAAEEHWRRNEEQSKLDGFDY--TRSDMAWEFLQQMGKLHFLGVSGPVSF-SGPDRVGTTAFYQIQRGLLEPVALYYPATDALDFRCPRCRPVKWHSGQVP--IAKRVFKLRVATIAPLAFYT-IATLSSVGIALAIAFLAFNLHFRKLKAIKLSSP-KLSNITAVGCIFVYATVILLGLDH--STLPSAEDSFATVCTARVYLLSAGFSLAFGSMFAKTYRVHRIFT-------------RTGSV-----FKDKMLQ------------DIQLILLVGGLLLVDALLVTLWVVTDPMERHLHNLTLEISATDRSVVYQPQVEVCRSQHTQTWLSVLYAYKGLLLVVGVYMAWETRHVKIPALNDSQYIGVSVYSVVITSAIVVVLANLISERVTLAFITITALILTSTTATLCLLFIPKLHDIWARNDIIDPVIHSMGLKMECNTRRFVVDDRRELQYRVEVQNRVYKKEIQALDAEIRKLERLLE 954          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Zebrafish
Match: gabbr1b (gamma-aminobutyric acid (GABA) B receptor, 1b [Source:ZFIN;Acc:ZDB-GENE-060503-5])

HSP 1 Score: 516.538 bits (1329), Expect = 7.023e-166
Identity = 313/813 (38.50%), Postives = 479/813 (58.92%), Query Frame = 2
Query:  608 EKQLHIGAVFPMSGDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRIKRQFRK---TGDQDENIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREIEHLKSQLT 3037
            +K+L+IGA+FPMSG W GG +C PAA MAL+ VN +TDILPDY L +   DS C  G  ++++Y+L+YT P+KI+ + GCS+V+T VAEAA  WNLIV+++G+SSPALSNR RFP+FFRTHPSA+L NPTR++L ++W W K++ I +  EVF+ST+ D E  VKE  I I  RQ          +A+K+LK +DARII+GLFYE  ARKVFCE YK  LYG K VW +IGWY D+W+K  +K   INCT ++M  AVEGH+TTE +M N +     S LTS++F  +L++ L    +NPE                +  G+ EAPLAYDA+WA+A+AL+K    LK+K   L +F Y+ +  +I  E++RA+N + F GVS  V FD+ G+R++WT IEQ+  GSY  +G++ +   NL+      W  S  P D   +I + R L   +++       + I+ G+VC+ F    +      + +  L  + ++GC++ +  +  LG D +       N+ F V+CQ ++  + LGFSL YGS+F  IW V+ V T + +    R                                  W++   +G   + D++ L+ W+  DPL      F +E    D D   +P ++ C    +  WLG+++G+KGL+L+LG+ L+YET+++      D R+ GMA+YNV VL +ITAPV++++  KQ A F F S +I+ +  ++L ++++P+++R   +     DQ E + +   T      +EE+  +   EN++L++ I + E  +  L++QL+
Sbjct:  157 KKKLYIGALFPMSGGWPGGQACLPAAQMALDLVNKRTDILPDYELELIHYDSMCDPGEATKLLYDLLYTEPIKIVLMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVQLFQKWKWTKIATIQQTTEVFTSTLDDLEQRVKEAGIEISVRQSFLTDPA---VAVKNLKRQDARIIVGLFYETEARKVFCEVYKEKLYGKKYVWFLIGWYADNWFK--IKDPSINCTVEQMTEAVEGHVTTEIVMLNPETVRGASNLTSQEFLAQLMSKLGG--KNPE----------------ETGGFQEAPLAYDAVWALALALNKTVGPLKAKGRRLEDFNYNNK--DITAEIYRALNTSSFEGVSGHVVFDAQGSRMAWTLIEQLQGGSYKKIGYYDMTKGNLSWYGNDRWIGSGPPADQTVVIQKFRYLSQKLFVSVSVFAGLGILMGIVCLTFNIYNSNVRYIQNSQPYLNNMTAVGCMMALAAVFPLGIDGLHV----RNSQFPVVCQFRLWLLGLGFSLAYGSMFTKIWWVHTVFTKKDEKKDKRKQ----------------------------HLEPWKLYATVGVLLVIDILSLMIWQIVDPLHITVEKFTKEAPKGDVDELIEPLLQHCSSEKMNTWLGVVYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVSVLCMITAPVTMILSSKQDASFAFASLAIIFSVYITLVVLFVPKMRRLITRGEWQSDQQETMKTGSST---NNNDEEKSRQLERENKELQKIIQEKEERVSELRNQLS 909          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Zebrafish
Match: gabbr1b (gamma-aminobutyric acid (GABA) B receptor, 1b [Source:ZFIN;Acc:ZDB-GENE-060503-5])

HSP 1 Score: 516.538 bits (1329), Expect = 9.365e-166
Identity = 313/813 (38.50%), Postives = 479/813 (58.92%), Query Frame = 2
Query:  608 EKQLHIGAVFPMSGDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRIKRQFRK---TGDQDENIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREIEHLKSQLT 3037
            +K+L+IGA+FPMSG W GG +C PAA MAL+ VN +TDILPDY L +   DS C  G  ++++Y+L+YT P+KI+ + GCS+V+T VAEAA  WNLIV+++G+SSPALSNR RFP+FFRTHPSA+L NPTR++L ++W W K++ I +  EVF+ST+ D E  VKE  I I  RQ          +A+K+LK +DARII+GLFYE  ARKVFCE YK  LYG K VW +IGWY D+W+K  +K   INCT ++M  AVEGH+TTE +M N +     S LTS++F  +L++ L    +NPE                +  G+ EAPLAYDA+WA+A+AL+K    LK+K   L +F Y+ +  +I  E++RA+N + F GVS  V FD+ G+R++WT IEQ+  GSY  +G++ +   NL+      W  S  P D   +I + R L   +++       + I+ G+VC+ F    +      + +  L  + ++GC++ +  +  LG D +       N+ F V+CQ ++  + LGFSL YGS+F  IW V+ V T + +    R                                  W++   +G   + D++ L+ W+  DPL      F +E    D D   +P ++ C    +  WLG+++G+KGL+L+LG+ L+YET+++      D R+ GMA+YNV VL +ITAPV++++  KQ A F F S +I+ +  ++L ++++P+++R   +     DQ E + +   T      +EE+  +   EN++L++ I + E  +  L++QL+
Sbjct:  163 KKKLYIGALFPMSGGWPGGQACLPAAQMALDLVNKRTDILPDYELELIHYDSMCDPGEATKLLYDLLYTEPIKIVLMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVQLFQKWKWTKIATIQQTTEVFTSTLDDLEQRVKEAGIEISVRQSFLTDPA---VAVKNLKRQDARIIVGLFYETEARKVFCEVYKEKLYGKKYVWFLIGWYADNWFK--IKDPSINCTVEQMTEAVEGHVTTEIVMLNPETVRGASNLTSQEFLAQLMSKLGG--KNPE----------------ETGGFQEAPLAYDAVWALALALNKTVGPLKAKGRRLEDFNYNNK--DITAEIYRALNTSSFEGVSGHVVFDAQGSRMAWTLIEQLQGGSYKKIGYYDMTKGNLSWYGNDRWIGSGPPADQTVVIQKFRYLSQKLFVSVSVFAGLGILMGIVCLTFNIYNSNVRYIQNSQPYLNNMTAVGCMMALAAVFPLGIDGLHV----RNSQFPVVCQFRLWLLGLGFSLAYGSMFTKIWWVHTVFTKKDEKKDKR-----------------------------KHLEPWKLYATVGVLLVIDILSLMIWQIVDPLHITVEKFTKEAPKGDVDELIEPLLQHCSSEKMNTWLGVVYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVSVLCMITAPVTMILSSKQDASFAFASLAIIFSVYITLVVLFVPKMRRLITRGEWQSDQQETMKTGSST---NNNDEEKSRQLERENKELQKIIQEKEERVSELRNQLS 914          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Zebrafish
Match: gabbr1a (gamma-aminobutyric acid (GABA) B receptor, 1a [Source:ZFIN;Acc:ZDB-GENE-030904-5])

HSP 1 Score: 512.301 bits (1318), Expect = 3.904e-164
Identity = 316/812 (38.92%), Postives = 472/812 (58.13%), Query Frame = 2
Query:  608 EKQLHIGAVFPMSGDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLG--IIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRIKRQFRKTGDQDENIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREIEHLKSQLT 3037
            +K+L+IGA+FPMSG W GG +C PAA MAL+ VNN++DILPDY L +   DS C  G  ++++Y+L+YT P+KI+ + GCS+V+T VAEAA  WNLIV ++G+SSPALSNR RFP+FFRTHPSA+L NPTR++L ++W W K++ I +  EVF+ST+ D E  VKE NI I  RQ          +A+K+LK +DARII+GLFYE  ARKVFCE +K  LYG K VW +IGWY D+W+K  +K   INCT + M  AVEGHITTE +M N +     S LTS++F  +L++ L    +NPE                +  G+ EAPLAYDA+WA+A+AL+K    L++K   L +F Y+ +  EI  E++RA+N + F GVS  V FD+ G+R++WT IEQ+  GSY  +G++     NL+      W     P D   +I + R L   +++       + I+ G+VC+ F    +      + +  L  + ++GC+L +  +  LG D +   + +    F V+CQ ++  + LGFSL YGS+F  IW V+ V T + +    R                                  W++   +      DV+ LL W+  DPL      F +E    D D+  QP +E C  + +  WLG  +++G+KGL+L+LG+ L+YET++I      D R+ GMA+YNV VL +ITAPV++++  +Q A F F S +I+ +  ++L ++++P+I+R   +   Q E   +          +EE+  +   EN +L++ I + E  +  L+SQL 
Sbjct:  158 KKKLYIGALFPMSGGWPGGQACLPAAQMALDLVNNRSDILPDYELELIHYDSMCDPGEATKLLYDLLYTEPIKIVLMPGCSSVSTLVAEAARMWNLIVFSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVRLFQKWEWTKIATIQQTTEVFTSTLDDLEERVKEANIEISVRQSFLTDPA---VAVKNLKRQDARIIVGLFYETEARKVFCEVFKEKLYGKKYVWFLIGWYADNWFK--IKDPAINCTVENMTEAVEGHITTEIVMLNPETVRGASNLTSQEFIAQLMSRLGG--KNPE----------------ETGGFQEAPLAYDAVWALALALNKTVAPLRAKGWGLEDFNYNNK--EITAEIYRALNTSSFEGVSGHVVFDAQGSRMAWTLIEQLQGGSYKKIGYYDSTKGNLSWYGNDKWIGLSPPADQTKVIKEFRYLSQKLFVSVSVFAGLGILLGIVCLSFNIYNSSVRYIQNSQPYLNNMTAVGCVLALAAVFPLGIDGLHVRRSQ----FPVVCQFRLWLLGLGFSLAYGSMFTKIWWVHTVFTKKDEKKEKR-----------------------------KHLEPWKLYATVAVLLAIDVLSLLIWQIMDPLHITVEQFTKEAPKEDLDVLIQPLLEHCSSKKMNTWLGECVVYGYKGLLLLLGIFLAYETKSISTEKINDHRAVGMAIYNVAVLCMITAPVTMILSSQQDASFAFASLAIIFSVYITLVVLFVPKIRRLITRGEWQSEQQDTLKTGSSTNNNDEEKSRQLERENRELQKIIQEKEERVTELRSQLA 911          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Zebrafish
Match: gabbr1a (gamma-aminobutyric acid (GABA) B receptor, 1a [Source:ZFIN;Acc:ZDB-GENE-030904-5])

HSP 1 Score: 445.277 bits (1144), Expect = 5.414e-142
Identity = 283/758 (37.34%), Postives = 429/758 (56.60%), Query Frame = 2
Query:  764 QCIAGLGSRMMYELIYTPPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRIKRQFRKTGDQDENIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREIEHLKSQLT 3037
            QC  G  ++++Y+L+YT P+KI+ + GCS+V+T VAEAA  WNLIV ++G+SSPALSNR RFP+FFRTHPSA+L NPTR++L ++W W K++ I +  EVF+ST+ D E  VKE NI I  RQ          +A+K+LK +DARII+GLFYE  ARKVFCE +K  LYG K VW +IGWY D+W+K  +K   INCT + M  AVEGHITTE +M N +     S LTS++F  +L++ L    +NPE                +  G+ EAPLAYDA+WA+A+AL+K    L++K   L +F Y+ +  EI  E++RA+N + F GVS  V FD+ G+R++WT IEQ+  GSY  +G++     NL+      W     P D   +I + R L   +++       + I+ G+VC+ F    +      + +  L  + ++GC+L +  +  LG D +   + +    F V+CQ ++  + LGFSL YGS+F  IW V+ V T + +    R                                  W++   +      DV+ LL W+  DPL      F +E    D D+  QP +E C  + +  WLG+++G+KGL+L+LG+ L+YET++I      D R+ GMA+YNV VL +ITAPV++++  +Q A F F S +I+ +  ++L ++++P+I+R   +   Q E   +          +EE+  +   EN +L++ I +    I    + LT
Sbjct:   16 QCDPGEATKLLYDLLYTEPIKIVLMPGCSSVSTLVAEAARMWNLIVFSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVRLFQKWEWTKIATIQQTTEVFTSTLDDLEERVKEANIEISVRQSFLTDPA---VAVKNLKRQDARIIVGLFYETEARKVFCEVFKEKLYGKKYVWFLIGWYADNWFK--IKDPAINCTVENMTEAVEGHITTEIVMLNPETVRGASNLTSQEFIAQLMSRLGG--KNPE----------------ETGGFQEAPLAYDAVWALALALNKTVAPLRAKGWGLEDFNYNNK--EITAEIYRALNTSSFEGVSGHVVFDAQGSRMAWTLIEQLQGGSYKKIGYYDSTKGNLSWYGNDKWIGLSPPADQTKVIKEFRYLSQKLFVSVSVFAGLGILLGIVCLSFNIYNSSVRYIQNSQPYLNNMTAVGCVLALAAVFPLGIDGLHVRRSQ----FPVVCQFRLWLLGLGFSLAYGSMFTKIWWVHTVFTKKDEKKEKR-----------------------------KHLEPWKLYATVAVLLAIDVLSLLIWQIMDPLHITVEQFTKEAPKEDLDVLIQPLLEHCSSKKMNTWLGVVYGYKGLLLLLGIFLAYETKSISTEKINDHRAVGMAIYNVAVLCMITAPVTMILSSQQDASFAFASLAIIFSVYITLVVLFVPKIRRLITRGEWQSEQQDTLKTGSSTNNNDEEKSRQLERENRELQKIIQEARAAILTAGASLT 715          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Zebrafish
Match: gabbr2 (gamma-aminobutyric acid (GABA) B receptor, 2 [Source:ZFIN;Acc:ZDB-GENE-060503-620])

HSP 1 Score: 264.233 bits (674), Expect = 1.800e-73
Identity = 209/804 (26.00%), Postives = 389/804 (48.38%), Query Frame = 2
Query:  677 PAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTG-CSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEP-SWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRI------------KRQFRKTGDQ-DENIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREIEHLKSQLTNV 3043
            PA  +A+  +         ++L   + D++C    G R  ++ I   P  +M   G C +VT+ +AE+   WNL+ ++F A++P L++R ++P+FFRT PS +  NP  +K L  + W +V  + +  + FS   +D    +++ +I I   +     S    + +K LK+ D RIIIG F E LA KVFC AY L +YG+K  W+I GWY  +WW+   + +  NCT +++  A+EG+I+ +    +       SG T +++ +R  N  +DQ               K  + +K  G+     AYD IW IA  L +  + L+ K+       + +   E+ + +   MNET F GV+  V F  +G R+   +  Q   G    +G ++ + D L L+     +     P+D   +  QRR + + +Y     + ++ ++ G   ++F  +     +       +  L  +G +L+   I L G D        S+  F  LC ++   + +G++  +G++F   W V+ +  + K        K K         IKD+ L I                 ++G   + D+ +L+ W+  DPL R    ++ E D    DI  +P++E C+  ++ +WLGI++ +KGL+++ G  L++ETRN+      D++  GM+VYNV ++ +I A VS + +D+ +  F  V+  I+  S ++L L+++P+              R+ + T +Q  E+  +      + +    + +   ++N +L+ +I+++++E+E +  QL + 
Sbjct:   77 PAVQLAIQHIRESRQY--SFSLITKIYDTECDNAKGLRAFFDAICYGPKHLMIFGGVCPSVTSIIAESLEGWNLVQLSFAATTPVLADRKKYPNFFRTVPSDNAVNPAVVKFLNFYNWSRVGTLTQDVQRFSEVRNDLTNELEKADIQIADTESF---SNDPCVNVKKLKDNDVRIIIGQFDENLAAKVFCCAYNLNMYGSKYQWIIPGWYQGNWWE---QANSTNCTTRKLLTAMEGYISVDFEPLSAKQIKGISGRTPQEY-EREYNRERDQ---------------KGVETSKFHGF-----AYDGIWVIAKTLTRVMELLRHKERHDMYHNFTVDDREVGKMVLDVMNETNFFGVTGQVMF-RNGERMGTIKFTQFQEGQEVKVGEYNAIADVLDLINNTIRFQGVEPPKDRTFVRLQRRQINVPLYSILSTITILGMLMGGAFLFFNIKNRNHRLIKMSSPYMNNLIILGGMLSYASIFLFGLDG----SFVSDKEFETLCTVRTWILIVGYTTAFGAMFAKTWRVHAIFKNVK-------MKKKI--------IKDQKLFI-----------------IVGGMLLIDLCILICWQIVDPLKRTVEEYSLEADPQGRDIAIRPFLEHCENTHMTIWLGIVYAYKGLLMLFGCFLAWETRNVSIPALNDSKYIGMSVYNVGIMCIIGAAVSFLTRDQPNVQFCIVALVIIFCSTITLCLVFVPKFVTMRTNPDAATQNRRLKFTQNQKKEDSKTSTSVTSVNQANTSRLDGLQSDNHRLRMKITELDKELEEVTMQLQDT 814          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Xenopus
Match: tonsl (tonsoku like, DNA repair protein [Source:Xenbase;Acc:XB-GENE-5939806])

HSP 1 Score: 502.671 bits (1293), Expect = 3.506e-161
Identity = 314/806 (38.96%), Postives = 464/806 (57.57%), Query Frame = 2
Query:  596 DNFKEKQLHIGAVFPMSGDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRIKRQFRKTGDQDENIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREI 3013
            ++ +++ LH+GA+FPMSG W GG +C+PAA MAL DVNN+ DILP+Y L +   DSQC  G  +R +YEL+Y  P+KIM + GCS+V+T VAEAA  W+LIV+++G+SSPALSNR RFP+FFRTHPSA+L NPTR++L K+WGW K++ I +  EVF+ST+ D E  VKE  I I  RQ          + +K+LK +DAR+I+GLFYE  ARKVFCE YK  L+G K VW +IGWY D+W+K  +    INCT +EM  AVEGH+TTE +M N ++    S +TS++F ++L   L +   NPE                   G  EAPLAYDAIWA+A+AL+K A  L  K   L +F Y+ +   I EE++RAMN + F GVS  V FD+SG+R++WT IEQ+  G Y  +G++    DNL+      W     P D   +I   R +   ++I    L  + I+ G VC+ F    +      + +  L  + + GC+L++  +  LG D     +      F ++CQ ++  + LGFSL YGS+F  IW ++   T +         + +  T+E                        W++   +      DV+ L  W+  DPL R    F +E+   D D+   P +E C    +  WLGI++G KGL+L+LG+ L+YET+++      D R+ GMA+YNV VL LITAPV++++  +Q A F F S +I+ ++ ++L ++++P+++R   +   Q E   +          EEE+      EN++L R I++ E  +
Sbjct:   98 ESSRKRALHVGALFPMSGGWPGGQACQPAAQMALEDVNNRRDILPEYELRLIHHDSQCDPGQATRYLYELLYNDPIKIMLMPGCSSVSTLVAEAARMWHLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVQLFKKWGWTKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPA---IPVKNLKRQDARVIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADNWFK--IPDPAINCTVEEMTQAVEGHVTTEIVMLNPENTRGISNMTSQEFMEKLKKRLGE---NPE----------------MTGGLQEAPLAYDAIWALALALNKTAYELSKKGRRLEDFNYNNK--MISEEIYRAMNSSSFDGVSGHVVFDASGSRMAWTLIEQLQGGVYKKIGYYDSTKDNLSWYNNDKWIGGSPPADHTKVIITFRYVSQKLFISVSVLAGLGILLGFVCLSFNIYNSHVRYIQNSQPHLNDVTAAGCILSLAAVFPLGLDG----RHIETWHFPLVCQARLWLLGLGFSLAYGSMFTKIWWIHTAFTKKDDKKE---RRKQSQTLE-----------------------PWKLYTTVSLLLGLDVITLGIWQIVDPLQRSIEEFTKEEPRGDLDVLILPQLEHCSSLKMNTWLGIVYGSKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDASFAFSSLAIVFSAYITLVVLFVPKMRRLITRGEWQSEQQDTLKTGSSTNNNEEEKSRLLERENQELGRIIAEKEERV 847          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Xenopus
Match: tonsl (tonsoku like, DNA repair protein [Source:Xenbase;Acc:XB-GENE-5939806])

HSP 1 Score: 502.286 bits (1292), Expect = 5.591e-161
Identity = 314/806 (38.96%), Postives = 464/806 (57.57%), Query Frame = 2
Query:  596 DNFKEKQLHIGAVFPMSGDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRIKRQFRKTGDQDENIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREI 3013
            ++ +++ LH+GA+FPMSG W GG +C+PAA MAL DVNN+ DILP+Y L +   DSQC  G  +R +YEL+Y  P+KIM + GCS+V+T VAEAA  W+LIV+++G+SSPALSNR RFP+FFRTHPSA+L NPTR++L K+WGW K++ I +  EVF+ST+ D E  VKE  I I  RQ          + +K+LK +DAR+I+GLFYE  ARKVFCE YK  L+G K VW +IGWY D+W+K  +    INCT +EM  AVEGH+TTE +M N ++    S +TS++F ++L   L +   NPE                   G  EAPLAYDAIWA+A+AL+K A  L  K   L +F Y+ +   I EE++RAMN + F GVS  V FD+SG+R++WT IEQ+  G Y  +G++    DNL+      W     P D   +I   R +   ++I    L  + I+ G VC+ F    +      + +  L  + + GC+L++  +  LG D     +      F ++CQ ++  + LGFSL YGS+F  IW ++   T +         + +  T+E                        W++   +      DV+ L  W+  DPL R    F +E+   D D+   P +E C    +  WLGI++G KGL+L+LG+ L+YET+++      D R+ GMA+YNV VL LITAPV++++  +Q A F F S +I+ ++ ++L ++++P+++R   +   Q E   +          EEE+      EN++L R I++ E  +
Sbjct:  105 ESSRKRALHVGALFPMSGGWPGGQACQPAAQMALEDVNNRRDILPEYELRLIHHDSQCDPGQATRYLYELLYNDPIKIMLMPGCSSVSTLVAEAARMWHLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVQLFKKWGWTKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPA---IPVKNLKRQDARVIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADNWFK--IPDPAINCTVEEMTQAVEGHVTTEIVMLNPENTRGISNMTSQEFMEKLKKRLGE---NPE----------------MTGGLQEAPLAYDAIWALALALNKTAYELSKKGRRLEDFNYNNK--MISEEIYRAMNSSSFDGVSGHVVFDASGSRMAWTLIEQLQGGVYKKIGYYDSTKDNLSWYNNDKWIGGSPPADHTKVIITFRYVSQKLFISVSVLAGLGILLGFVCLSFNIYNSHVRYIQNSQPHLNDVTAAGCILSLAAVFPLGLDG----RHIETWHFPLVCQARLWLLGLGFSLAYGSMFTKIWWIHTAFTKKDDKKE---RRKQSQTLE-----------------------PWKLYTTVSLLLGLDVITLGIWQIVDPLQRSIEEFTKEEPRGDLDVLILPQLEHCSSLKMNTWLGIVYGSKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDASFAFSSLAIVFSAYITLVVLFVPKMRRLITRGEWQSEQQDTLKTGSSTNNNEEEKSRLLERENQELGRIIAEKEERV 854          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Xenopus
Match: tonsl (tonsoku like, DNA repair protein [Source:Xenbase;Acc:XB-GENE-5939806])

HSP 1 Score: 502.671 bits (1293), Expect = 1.895e-160
Identity = 315/806 (39.08%), Postives = 462/806 (57.32%), Query Frame = 2
Query:  596 DNFKEKQLHIGAVFPMSGDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRIKRQFRKTGDQDENIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREI 3013
            D   ++ LH+GA+FPMSG W GG +C+PAA MAL DVNN+ DILP+Y L +   DSQC  G  +R +YEL+Y  P+KIM + GCS+V+T VAEAA  W+LIV+++G+SSPALSNR RFP+FFRTHPSA+L NPTR++L K+WGW K++ I +  EVF+ST+ D E  VKE  I I  RQ          + +K+LK +DAR+I+GLFYE  ARKVFCE YK  L+G K VW +IGWY D+W+K  +    INCT +EM  AVEGH+TTE +M N ++    S +TS++F ++L   L +   NPE                   G  EAPLAYDAIWA+A+AL+K A  L  K   L +F Y+ +   I EE++RAMN + F GVS  V FD+SG+R++WT IEQ+  G Y  +G++    DNL+      W     P D   +I   R +   ++I    L  + I+ G VC+ F    +      + +  L  + + GC+L++  +  LG D     +      F ++CQ ++  + LGFSL YGS+F  IW ++   T +         + +  T+E                        W++   +      DV+ L  W+  DPL R    F +E+   D D+   P +E C    +  WLGI++G KGL+L+LG+ L+YET+++      D R+ GMA+YNV VL LITAPV++++  +Q A F F S +I+ ++ ++L ++++P+++R   +   Q E   +          EEE+      EN++L R I++ E  +
Sbjct:  161 DTSSKRALHVGALFPMSGGWPGGQACQPAAQMALEDVNNRRDILPEYELRLIHHDSQCDPGQATRYLYELLYNDPIKIMLMPGCSSVSTLVAEAARMWHLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVQLFKKWGWTKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPA---IPVKNLKRQDARVIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADNWFK--IPDPAINCTVEEMTQAVEGHVTTEIVMLNPENTRGISNMTSQEFMEKLKKRLGE---NPE----------------MTGGLQEAPLAYDAIWALALALNKTAYELSKKGRRLEDFNYNNK--MISEEIYRAMNSSSFDGVSGHVVFDASGSRMAWTLIEQLQGGVYKKIGYYDSTKDNLSWYNNDKWIGGSPPADHTKVIITFRYVSQKLFISVSVLAGLGILLGFVCLSFNIYNSHVRYIQNSQPHLNDVTAAGCILSLAAVFPLGLDG----RHIETWHFPLVCQARLWLLGLGFSLAYGSMFTKIWWIHTAFTKKDDKKE---RRKQSQTLE-----------------------PWKLYTTVSLLLGLDVITLGIWQIVDPLQRSIEEFTKEEPRGDLDVLILPQLEHCSSLKMNTWLGIVYGSKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDASFAFSSLAIVFSAYITLVVLFVPKMRRLITRGEWQSEQQDTLKTGSSTNNNEEEKSRLLERENQELGRIIAEKEERV 910          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Xenopus
Match: tonsl (tonsoku like, DNA repair protein [Source:Xenbase;Acc:XB-GENE-5939806])

HSP 1 Score: 502.286 bits (1292), Expect = 3.014e-160
Identity = 314/806 (38.96%), Postives = 464/806 (57.57%), Query Frame = 2
Query:  596 DNFKEKQLHIGAVFPMSGDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRIKRQFRKTGDQDENIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREI 3013
            ++ +++ LH+GA+FPMSG W GG +C+PAA MAL DVNN+ DILP+Y L +   DSQC  G  +R +YEL+Y  P+KIM + GCS+V+T VAEAA  W+LIV+++G+SSPALSNR RFP+FFRTHPSA+L NPTR++L K+WGW K++ I +  EVF+ST+ D E  VKE  I I  RQ          + +K+LK +DAR+I+GLFYE  ARKVFCE YK  L+G K VW +IGWY D+W+K  +    INCT +EM  AVEGH+TTE +M N ++    S +TS++F ++L   L +   NPE                   G  EAPLAYDAIWA+A+AL+K A  L  K   L +F Y+ +   I EE++RAMN + F GVS  V FD+SG+R++WT IEQ+  G Y  +G++    DNL+      W     P D   +I   R +   ++I    L  + I+ G VC+ F    +      + +  L  + + GC+L++  +  LG D     +      F ++CQ ++  + LGFSL YGS+F  IW ++   T +         + +  T+E                        W++   +      DV+ L  W+  DPL R    F +E+   D D+   P +E C    +  WLGI++G KGL+L+LG+ L+YET+++      D R+ GMA+YNV VL LITAPV++++  +Q A F F S +I+ ++ ++L ++++P+++R   +   Q E   +          EEE+      EN++L R I++ E  +
Sbjct:  161 ESSRKRALHVGALFPMSGGWPGGQACQPAAQMALEDVNNRRDILPEYELRLIHHDSQCDPGQATRYLYELLYNDPIKIMLMPGCSSVSTLVAEAARMWHLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVQLFKKWGWTKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPA---IPVKNLKRQDARVIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADNWFK--IPDPAINCTVEEMTQAVEGHVTTEIVMLNPENTRGISNMTSQEFMEKLKKRLGE---NPE----------------MTGGLQEAPLAYDAIWALALALNKTAYELSKKGRRLEDFNYNNK--MISEEIYRAMNSSSFDGVSGHVVFDASGSRMAWTLIEQLQGGVYKKIGYYDSTKDNLSWYNNDKWIGGSPPADHTKVIITFRYVSQKLFISVSVLAGLGILLGFVCLSFNIYNSHVRYIQNSQPHLNDVTAAGCILSLAAVFPLGLDG----RHIETWHFPLVCQARLWLLGLGFSLAYGSMFTKIWWIHTAFTKKDDKKE---RRKQSQTLE-----------------------PWKLYTTVSLLLGLDVITLGIWQIVDPLQRSIEEFTKEEPRGDLDVLILPQLEHCSSLKMNTWLGIVYGSKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDASFAFSSLAIVFSAYITLVVLFVPKMRRLITRGEWQSEQQDTLKTGSSTNNNEEEKSRLLERENQELGRIIAEKEERV 910          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Xenopus
Match: tonsl (tonsoku like, DNA repair protein [Source:Xenbase;Acc:XB-GENE-5939806])

HSP 1 Score: 501.901 bits (1291), Expect = 5.240e-160
Identity = 314/806 (38.96%), Postives = 464/806 (57.57%), Query Frame = 2
Query:  596 DNFKEKQLHIGAVFPMSGDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRIKRQFRKTGDQDENIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREI 3013
            ++ +++ LH+GA+FPMSG W GG +C+PAA MAL DVNN+ DILP+Y L +   DSQC  G  +R +YEL+Y  P+KIM + GCS+V+T VAEAA  W+LIV+++G+SSPALSNR RFP+FFRTHPSA+L NPTR++L K+WGW K++ I +  EVF+ST+ D E  VKE  I I  RQ          + +K+LK +DAR+I+GLFYE  ARKVFCE YK  L+G K VW +IGWY D+W+K  +    INCT +EM  AVEGH+TTE +M N ++    S +TS++F ++L   L +   NPE                   G  EAPLAYDAIWA+A+AL+K A  L  K   L +F Y+ +   I EE++RAMN + F GVS  V FD+SG+R++WT IEQ+  G Y  +G++    DNL+      W     P D   +I   R +   ++I    L  + I+ G VC+ F    +      + +  L  + + GC+L++  +  LG D     +      F ++CQ ++  + LGFSL YGS+F  IW ++   T +         + +  T+E                        W++   +      DV+ L  W+  DPL R    F +E+   D D+   P +E C    +  WLGI++G KGL+L+LG+ L+YET+++      D R+ GMA+YNV VL LITAPV++++  +Q A F F S +I+ ++ ++L ++++P+++R   +   Q E   +          EEE+      EN++L R I++ E  +
Sbjct:  168 ESSRKRALHVGALFPMSGGWPGGQACQPAAQMALEDVNNRRDILPEYELRLIHHDSQCDPGQATRYLYELLYNDPIKIMLMPGCSSVSTLVAEAARMWHLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVQLFKKWGWTKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPA---IPVKNLKRQDARVIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADNWFK--IPDPAINCTVEEMTQAVEGHVTTEIVMLNPENTRGISNMTSQEFMEKLKKRLGE---NPE----------------MTGGLQEAPLAYDAIWALALALNKTAYELSKKGRRLEDFNYNNK--MISEEIYRAMNSSSFDGVSGHVVFDASGSRMAWTLIEQLQGGVYKKIGYYDSTKDNLSWYNNDKWIGGSPPADHTKVIITFRYVSQKLFISVSVLAGLGILLGFVCLSFNIYNSHVRYIQNSQPHLNDVTAAGCILSLAAVFPLGLDG----RHIETWHFPLVCQARLWLLGLGFSLAYGSMFTKIWWIHTAFTKKDDKKE---RRKQSQTLE-----------------------PWKLYTTVSLLLGLDVITLGIWQIVDPLQRSIEEFTKEEPRGDLDVLILPQLEHCSSLKMNTWLGIVYGSKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDASFAFSSLAIVFSAYITLVVLFVPKMRRLITRGEWQSEQQDTLKTGSSTNNNEEEKSRLLERENQELGRIIAEKEERV 917          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Mouse
Match: Gabbr1 (gamma-aminobutyric acid (GABA) B receptor, 1 [Source:MGI Symbol;Acc:MGI:1860139])

HSP 1 Score: 507.679 bits (1306), Expect = 3.899e-164
Identity = 320/810 (39.51%), Postives = 470/810 (58.02%), Query Frame = 2
Query:  605 KEKQLHIGAVFPMSGDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRIKRQFRKTGDQDENIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREIEHLKSQL 3034
            + + ++IGA+FPMSG W GG +C+PA  MAL DVN++ DILPDY L +   DS+C  G  ++ +YEL+Y  P+KI+ + GCS+V+T VAEAA  WNLIV+++G+SSPALSNR RFP+FFRTHPSA+L NPTR+KL ++WGWKK++ I +  EVF+ST+ D E  VKE  I I  RQ          + +K+LK +DARII+GLFYE  ARKVFCE YK  L+G K VW +IGWY D+W+K +     INCT +EM  AVEGHITTE +M N  +  + S +TS++F ++L   LK   R+PE                +  G+ EAPLAYDAIWA+A+AL+K +       V L +F Y+ Q   I ++++RAMN + F GVS  V FD+SG+R++WT IEQ+  GSY  +G++    D+L+  K   W     P D   +I   R L   ++I    L  + I+  VVC+ F    +      + +  L  L ++GC L +  +  LG D          + F  +CQ ++  + LGFSLGYGS+F  IW V+ V T +++    R T                                W++   +G     D++ L  W+  DPL R    F +E+   D D+   P +E C  + +  WLGI +G+KGL+L+LG+ L+YET+++      D R+ GMA+YNV VL LITAPV++++  +Q A F F S +I+ +S ++L ++++P+++R   +   Q E   +          EEE+      EN +L++ I++ E  +  L+ QL
Sbjct:   49 ERRAVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPA---VPVKNLKRQDARIIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADNWFKTY--DPSINCTVEEMTEAVEGHITTEIVMLNPANTRSISNMTSQEFVEKLTKRLK---RHPE----------------ETGGFQEAPLAYDAIWALALALNKTSGGGGRSGVRLEDFNYNNQ--TITDQIYRAMNSSSFEGVSGHVVFDASGSRMAWTLIEQLQGGSYKKIGYYDSTKDDLSWSKTDKWIGGSPPADQTLVIKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLNNLTAVGCSLALAAVFPLGLDGYHI----GRSQFPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFTKKEEKKEWRKT-----------------------------LEPWKLYATVGLLVGMDILTLAIWQIVDPLHRTIETFAKEEPKEDIDVSILPQLEHCSSKKMNTWLGIFYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDAAFAFASLAIVFSSYITLVVLFVPKMRRLITRGEWQSEAQDTMKTGSSTNNNEEEKSRLLEKENRELEKIIAEKEERVSELRHQL 799          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Mouse
Match: Gabbr1 (gamma-aminobutyric acid (GABA) B receptor, 1 [Source:MGI Symbol;Acc:MGI:1860139])

HSP 1 Score: 506.908 bits (1304), Expect = 2.142e-162
Identity = 321/817 (39.29%), Postives = 474/817 (58.02%), Query Frame = 2
Query:  584 VDIVDNFKEKQLHIGAVFPMSGDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRIKRQFRKTGDQDENIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREIEHLKSQL 3034
            V+   + + + ++IGA+FPMSG W GG +C+PA  MAL DVN++ DILPDY L +   DS+C  G  ++ +YEL+Y  P+KI+ + GCS+V+T VAEAA  WNLIV+++G+SSPALSNR RFP+FFRTHPSA+L NPTR+KL ++WGWKK++ I +  EVF+ST+ D E  VKE  I I  RQ          + +K+LK +DARII+GLFYE  ARKVFCE YK  L+G K VW +IGWY D+W+K +     INCT +EM  AVEGHITTE +M N  +  + S +TS++F ++L   LK   R+PE                +  G+ EAPLAYDAIWA+A+AL+K +       V L +F Y+ Q   I ++++RAMN + F GVS  V FD+SG+R++WT IEQ+  GSY  +G++    D+L+  K   W     P D   +I   R L   ++I    L  + I+  VVC+ F    +      + +  L  L ++GC L +  +  LG D     +    + F  +CQ ++  + LGFSLGYGS+F  IW V+ V T +++    R T                                W++   +G     D++ L  W+  DPL R    F +E+   D D+   P +E C  + +  WLGI +G+KGL+L+LG+ L+YET+++      D R+ GMA+YNV VL LITAPV++++  +Q A F F S +I+ +S ++L ++++P+++R   +   Q E   +          EEE+      EN +L++ I++ E  +  L+ QL
Sbjct:  158 VNRTPHSERRAVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPA---VPVKNLKRQDARIIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADNWFKTY--DPSINCTVEEMTEAVEGHITTEIVMLNPANTRSISNMTSQEFVEKLTKRLK---RHPE----------------ETGGFQEAPLAYDAIWALALALNKTSGGGGRSGVRLEDFNYNNQ--TITDQIYRAMNSSSFEGVSGHVVFDASGSRMAWTLIEQLQGGSYKKIGYYDSTKDDLSWSKTDKWIGGSPPADQTLVIKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLNNLTAVGCSLALAAVFPLGLDGYHIGR----SQFPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFTKKEEKKEWRKT-----------------------------LEPWKLYATVGLLVGMDILTLAIWQIVDPLHRTIETFAKEEPKEDIDVSILPQLEHCSSKKMNTWLGIFYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDAAFAFASLAIVFSSYITLVVLFVPKMRRLITRGEWQSEAQDTMKTGSSTNNNEEEKSRLLEKENRELEKIIAEKEERVSELRHQL 915          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Mouse
Match: Gabbr2 (gamma-aminobutyric acid (GABA) B receptor, 2 [Source:MGI Symbol;Acc:MGI:2386030])

HSP 1 Score: 255.758 bits (652), Expect = 1.461e-70
Identity = 213/828 (25.72%), Postives = 400/828 (48.31%), Query Frame = 2
Query:  623 IGAVFPMSGDWAGGISCR---PAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTG-CSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWW-KYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRL--KSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEP-SWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRI------------KRQFRKTGDQ-DENIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREIEHLKSQLTNV 3043
            I  + P++ + A G   R   PA  +A+  + N++ + P Y L + + D++C    G +  Y+ I   P  +M   G C +VT+ +AE+   WNL+ ++F A++P L+++ ++P FFRT PS +  NP  LKLLK + W++V  + +  + FS   +D    +   +I I   +     S     ++K LK  D RII+G F + +A KVFC A++  ++G+K  W+I GWY   WW + H++ +   C  + +  A+EG+I            V F  L+S++ K  +      Q+    N    G+        +K  GYA     YD IW IA  L +A + L   S+   + +F Y    + +   +  AMNET F GV+  V F  +G R+   +  Q  +     +G ++ + D L ++ +   +  S  P+D   ++ Q R + L +Y     L ++ +I     ++F  +     +       +  L  +G +L+   I L G D        S   F  LC ++   + +G++  +G++F   W V+ +  + K                    +K K++K              +++ ++G   + D+ +L+ W+  DPL R    ++ E D    DI  +P +E C+  ++ +WLGI++ +KGL+++ G  L++ETRN+      D++  GM+VYNV ++ +I A VS + +D+ +  F  V+  I+  S ++L L+++P++             R+F+ T +Q  E+  +      + +    +     +EN +L+ +I+++++++E +  QL + 
Sbjct:   57 IMGLMPLTKEVAKGSIGRGVLPAVELAIEQIRNESLLRP-YFLDLRLYDTECDNAKGLKAFYDAIKYGPNHLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDNAVNPAILKLLKHFRWRRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESF---SNDPCTSVKKLKGNDVRIILGQFDQNMAAKVFCCAFEESMFGSKYQWIIPGWYEPAWWEQVHVEANSSRCLRRSLLAAMEGYI-----------GVDFEPLSSKQIKT-ISGKTPQQYEREYNSKRSGVGP------SKFHGYA-----YDGIWVIAKTLQRAMETLHASSRHQRIQDFNY--TDHTLGRIILNAMNETNFFGVTGQVVF-RNGERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKDKTIILEQLRKISLPLYSILSALTILGMIMASAFLFFNIKNRNQKLIKMSSPYMNNLIILGGMLSYASIFLFGLDG----SFVSEKTFETLCTVRTWILTVGYTTAFGAMFAKTWRVHAIFKNVK--------------------MKKKIIK------------DQKLLVIVGGMLLIDLCILICWQAVDPLRRTVERYSMEPDPAGRDISIRPLLEHCENTHMTIWLGIVYAYKGLLMLFGCFLAWETRNVSIPALNDSKYIGMSVYNVGIMCIIGAAVSFLTRDQPNVQFCIVALVIIFCSTITLCLVFVPKLITLRTNPDAATQNRRFQFTQNQKKEDSKTSTSVTSVNQASTSRLEGLQSENHRLRMKITELDKDLEEVTMQLQDT 818          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Mouse
Match: Gabbr1 (gamma-aminobutyric acid (GABA) B receptor, 1 [Source:MGI Symbol;Acc:MGI:1860139])

HSP 1 Score: 152.525 bits (384), Expect = 1.960e-41
Identity = 94/213 (44.13%), Postives = 124/213 (58.22%), Query Frame = 2
Query:  605 KEKQLHIGAVFPMSGDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVF 1243
            + + ++IGA+FPMSG W GG +C+PA  MAL DVN++ DILPDY L +   DS+                                             +++G+SSPALSNR RFP+FFRTHPSA+L NPTR+KL ++WGWKK++ I +  EVF+ST+ D E  VKE  I I  RQ          + +K+LK +DARII+GLFYE  ARKVF
Sbjct:   49 ERRAVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSK---------------------------------------------LSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPA---VPVKNLKRQDARIIVGLFYETEARKVF 213          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. UniProt/SwissProt
Match: sp|Q9UBS5|GABR1_HUMAN (Gamma-aminobutyric acid type B receptor subunit 1 OS=Homo sapiens OX=9606 GN=GABBR1 PE=1 SV=1)

HSP 1 Score: 509.22 bits (1310), Expect = 2.160e-162
Identity = 325/817 (39.78%), Postives = 473/817 (57.89%), Query Frame = 2
Query:  584 VDIVDNFKEKQLHIGAVFPMSGDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRIKRQFRKTGDQDENIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREIEHLKSQL 3034
            V+   + + + ++IGA+FPMSG W GG +C+PA  MAL DVN++ DILPDY L +   DS+C  G  ++ +YEL+Y  P+KI+ + GCS+V+T VAEAA  WNLIV+++G+SSPALSNR RFP+FFRTHPSA+L NPTR+KL ++WGWKK++ I +  EVF+ST+ D E  VKE  I I  RQ          + +K+LK +DARII+GLFYE  ARKVFCE YK  L+G K VW +IGWY D+W+K +     INCT  EM  AVEGHITTE +M N  +  + S +TS++F ++L   LK   R+PE                +  G+ EAPLAYDAIWA+A+AL+K +       V L +F Y+ Q   I ++++RAMN + F GVS  V FD+SG+R++WT IEQ+  GSY  +G++    D+L+  K   W     P D   +I   R L   ++I    L  + I+  VVC+ F    +      + +  L  L ++GC L +  +  LG D      I  N  F  +CQ ++  + LGFSLGYGS+F  IW V+ V T +++    R T                                W++   +G     DV+ L  W+  DPL R    F +E+   D D+   P +E C  R +  WLGI +G+KGL+L+LG+ L+YET+++      D R+ GMA+YNV VL LITAPV++++  +Q A F F S +I+ +S ++L ++++P+++R   +   Q E   +          EEE+      EN +L++ I++ E  +  L+ QL
Sbjct:  159 VNRTPHSERRAVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPA---VPVKNLKRQDARIIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADNWFKIY--DPSINCTVDEMTEAVEGHITTEIVMLNPANTRSISNMTSQEFVEKLTKRLK---RHPE----------------ETGGFQEAPLAYDAIWALALALNKTSGGGGRSGVRLEDFNYNNQ--TITDQIYRAMNSSSFEGVSGHVVFDASGSRMAWTLIEQLQGGSYKKIGYYDSTKDDLSWSKTDKWIGGSPPADQTLVIKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLNNLTAVGCSLALAAVFPLGLD---GYHIGRNQ-FPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFTKKEEKKEWRKT-----------------------------LEPWKLYATVGLLVGMDVLTLAIWQIVDPLHRTIETFAKEEPKEDIDVSILPQLEHCSSRKMNTWLGIFYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDAAFAFASLAIVFSSYITLVVLFVPKMRRLITRGEWQSEAQDTMKTGSSTNNNEEEKSRLLEKENRELEKIIAEKEERVSELRHQL 916          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. UniProt/SwissProt
Match: sp|Q9WV18|GABR1_MOUSE (Gamma-aminobutyric acid type B receptor subunit 1 OS=Mus musculus OX=10090 GN=Gabbr1 PE=1 SV=1)

HSP 1 Score: 506.908 bits (1304), Expect = 1.499e-161
Identity = 321/817 (39.29%), Postives = 474/817 (58.02%), Query Frame = 2
Query:  584 VDIVDNFKEKQLHIGAVFPMSGDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRIKRQFRKTGDQDENIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREIEHLKSQL 3034
            V+   + + + ++IGA+FPMSG W GG +C+PA  MAL DVN++ DILPDY L +   DS+C  G  ++ +YEL+Y  P+KI+ + GCS+V+T VAEAA  WNLIV+++G+SSPALSNR RFP+FFRTHPSA+L NPTR+KL ++WGWKK++ I +  EVF+ST+ D E  VKE  I I  RQ          + +K+LK +DARII+GLFYE  ARKVFCE YK  L+G K VW +IGWY D+W+K +     INCT +EM  AVEGHITTE +M N  +  + S +TS++F ++L   LK   R+PE                +  G+ EAPLAYDAIWA+A+AL+K +       V L +F Y+ Q   I ++++RAMN + F GVS  V FD+SG+R++WT IEQ+  GSY  +G++    D+L+  K   W     P D   +I   R L   ++I    L  + I+  VVC+ F    +      + +  L  L ++GC L +  +  LG D     +    + F  +CQ ++  + LGFSLGYGS+F  IW V+ V T +++    R T                                W++   +G     D++ L  W+  DPL R    F +E+   D D+   P +E C  + +  WLGI +G+KGL+L+LG+ L+YET+++      D R+ GMA+YNV VL LITAPV++++  +Q A F F S +I+ +S ++L ++++P+++R   +   Q E   +          EEE+      EN +L++ I++ E  +  L+ QL
Sbjct:  158 VNRTPHSERRAVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPA---VPVKNLKRQDARIIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADNWFKTY--DPSINCTVEEMTEAVEGHITTEIVMLNPANTRSISNMTSQEFVEKLTKRLK---RHPE----------------ETGGFQEAPLAYDAIWALALALNKTSGGGGRSGVRLEDFNYNNQ--TITDQIYRAMNSSSFEGVSGHVVFDASGSRMAWTLIEQLQGGSYKKIGYYDSTKDDLSWSKTDKWIGGSPPADQTLVIKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLNNLTAVGCSLALAAVFPLGLDGYHIGR----SQFPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFTKKEEKKEWRKT-----------------------------LEPWKLYATVGLLVGMDILTLAIWQIVDPLHRTIETFAKEEPKEDIDVSILPQLEHCSSKKMNTWLGIFYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDAAFAFASLAIVFSSYITLVVLFVPKMRRLITRGEWQSEAQDTMKTGSSTNNNEEEKSRLLEKENRELEKIIAEKEERVSELRHQL 915          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. UniProt/SwissProt
Match: sp|Q9Z0U4|GABR1_RAT (Gamma-aminobutyric acid type B receptor subunit 1 OS=Rattus norvegicus OX=10116 GN=Gabbr1 PE=1 SV=1)

HSP 1 Score: 492.271 bits (1266), Expect = 1.288e-155
Identity = 322/848 (37.97%), Postives = 474/848 (55.90%), Query Frame = 2
Query:  584 VDIVDNFKEKQLHIGAVFPMSGDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLG-------------------------------IIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRIKRQFRKTGDQDENIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREIEHLKSQL 3034
            V+   + + + ++IGA+FPMSG W GG +C+PA  MAL DVN++ DILPDY L +   DS+C  G  ++ +YEL+Y  P+KI+ + GCS+V+T VAEAA  WNLIV+++G+SSPALSNR RFP+FFRTHPSA+L NPTR+KL ++WGWKK++ I +  EVF+ST+ D E  VKE  I I  RQ          + +K+LK +DARII+GLFYE  ARKVFCE YK  L+G K VW +IGWY D+W+K +     INCT +EM  AVEGHITTE +M N  +  + S +TS++F ++L   LK   R+PE                +  G+ EAPLAYDAIWA+A+AL+K +       V L +F Y+ Q   I ++++RAMN + F GVS  V FD+SG+R++WT IEQ+  GSY  +G++    D+L+  K   W     P D   +I   R L   ++I    L  + I+  VVC+ F    +      + +  L  L ++GC L +  +  LG D     +    + F  +CQ ++  + LGFSLGYGS+F  IW V+ V T +++    R T                                W++   +G     DV+ L  W+  DPL R    F +E+   D D+   P +E C  + +  WLG                               I +G+KGL+L+LG+ L+YET+++      D R+ GMA+YNV VL LITAPV++++  +Q A F F S +I+ +S ++L ++++P+++R   +   Q E   +          EEE+      EN +L++ I++ E  +  L+ QL
Sbjct:  158 VNRTPHSERRAVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPA---VPVKNLKRQDARIIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADNWFKTY--DPSINCTVEEMTEAVEGHITTEIVMLNPANTRSISNMTSQEFVEKLTKRLK---RHPE----------------ETGGFQEAPLAYDAIWALALALNKTSGGGGRSGVRLEDFNYNNQ--TITDQIYRAMNSSSFEGVSGHVVFDASGSRMAWTLIEQLQGGSYKKIGYYDSTKDDLSWSKTDKWIGGSPPADQTLVIKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLNNLTAVGCSLALAAVFPLGLDGYHIGR----SQFPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFTKKEEKKEWRKT-----------------------------LEPWKLYATVGLLVGMDVLTLAIWQIVDPLHRTIETFAKEEPKEDIDVSILPQLEHCSSKKMNTWLGELWSFAVSSDVQRRATVGGDSPICVWPAPESIFYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDAAFAFASLAIVFSSYITLVVLFVPKMRRLITRGEWQSETQDTMKTGSSTNNNEEEKSRLLEKENRELEKIIAEKEERVSELRHQL 946          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. UniProt/SwissProt
Match: sp|H2L0Q3|GABR1_CAEEL (Gamma-aminobutyric acid type B receptor subunit 1 OS=Caenorhabditis elegans OX=6239 GN=gbb-1 PE=1 SV=2)

HSP 1 Score: 443.736 bits (1140), Expect = 2.630e-138
Identity = 296/841 (35.20%), Postives = 465/841 (55.29%), Query Frame = 2
Query:  617 LHIGAVFPM---SGDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYL----ALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLS--IYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLG--ADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRV-ATDRKKLTTDRCTKNK------CGTIEDSFQIKDKLLKIAPVSKIGV-----------KYNSWEVIGMLGSFCMADVVVLLAWRYFDPL----SRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAP-VSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRIKRQFRKTGDQDENIISDDETIQ-LRKTEEEQHNKYFTENEQLKRQISQIEREIEHLKSQL 3034
            LHIG  FPM   SG WAGG +C PA  MAL DVN++ DILP Y L MT  +SQC  GL  + +Y+ +Y PP K+M LTGCS VTT +AEAAP W L+V+++G SSPALSNR RFP+ FRTHPSA++QNPTR+ +++++ WK+ +++  +EEVF +T  D E         I +++ ++   Q+ Y     A+K+L+ +DARII+GLFY   ARKV C+AY  GLYG + VW  IGWY D W+     ++ +NCT ++M  A E H TTES+M + D+    S +T  +F+ RL    +    N                   + G+ EAPLAYDA+WA+A+A +     L S  + L  F Y  +   I + L + +  T F GVS  V F  SG+RI+ T+IEQM  G Y ++G++   + +L    +  W N + P     +I ++ A+ +S   Y       ++ I + V    F  +     +    + +   +  IGC L +F + L+G  +D IS     S +LF +LC  +V  +  GF+  YGS+F  +WIV+R+ AT+ ++L + +  + +        T+  +   +  L++ +     G              +S +   ++ +    DV V   W   DPL     ++ ++   +    +ED    P ++ C      +W+GII G+K L+L+ G  LSYETRN+K  F  D+R  G+A+YNV V++L+TAP V+++I  K  A+F F+S ++L+ + +S+GLIY P+I+   +     DE  ++ +     + K ++++++    ENE L+ QI + ER+I   K +L
Sbjct:   24 LHIGGTFPMESGSGGWAGGEACLPAVEMALKDVNSRLDILPGYVLNMTNHNSQCQPGLAMQQLYDFLYKPPTKLMLLTGCSPVTTVIAEAAPVWKLVVLSYGGSSPALSNRNRFPTLFRTHPSANMQNPTRIHIMEKFKWKRFTILMSVEEVFVTTAKDLE--------AIARKKGIKVDRQSFYGDPTDAMKTLQRQDARIIVGLFYVTEARKVLCQAYHHGLYGRRYVWFFIGWYADTWY-IPPPEEHLNCTAEQMTEAAEYHFTTESVMLSRDNIPAISEMTGMQFQQRLTQYFQKDTAN-------------------VGGFPEAPLAYDAVWALALAFNCTRNNLPS-HIRLENFTYDNK--VIADTLFQCVKNTSFRGVSGKVMFSDSGDRIARTQIEQMQGGKYKIMGYYDTTSGDLEWYNKEQWLNGKGPPPDSTVI-KKHAMTVSNEFYYPTILFAVLGIAACVFIYLFTQKHHERLIIFQSQPECNNILLIGCSLCLFSLFLIGLPSDDISI----SESLFPLLCHARVTILLFGFTFAYGSMFAKVWIVHRMGATENQQLASRQKDEEENTPWEGIRTLISTMVGRQALMRKSSGQAYGALLEKRNTVLNQPISSSKFYVIVAALTAVDVFVCFVWVLIDPLHLTEQKFPLFTPADS---EEDEMIMPVLQQCQSNQQEVWIGIIMGFKCLLLVFGTFLSYETRNLKLRFINDSRFVGLAIYNVAVMTLVTAPVVTLLIHGKVDANFAFISLTVLICTYISVGLIYGPKIRHIIKVPPSADEIQLNGNVGPGVMSKVDQKRYDMLKKENETLQIQIEEKERKIHECKERL 825          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. UniProt/SwissProt
Match: sp|O75899|GABR2_HUMAN (Gamma-aminobutyric acid type B receptor subunit 2 OS=Homo sapiens OX=9606 GN=GABBR2 PE=1 SV=1)

HSP 1 Score: 260.381 bits (664), Expect = 2.790e-71
Identity = 217/828 (26.21%), Postives = 399/828 (48.19%), Query Frame = 2
Query:  623 IGAVFPMSGDWAGGISCR---PAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTG-CSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWW-KYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRL--KSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEP-SWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRI------------KRQFRKTGDQ-DENIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREIEHLKSQLTNV 3043
            I  + P++ + A G   R   PA  +A+  + N++ + P Y L + + D++C    G +  Y+ I   P  +M   G C +VT+ +AE+   WNL+ ++F A++P L+++ ++P FFRT PS +  NP  LKLLK + WK+V  + +  + FS   +D    +   +I I   +     S     ++K LK  D RII+G F + +A KVFC AY+  +YG+K  W+I GWY   WW + H + +   C  K +  A+EG+I            V F  L+S++ K  +      Q+    N    G+        +K  GYA     YD IW IA  L +A + L   S+   + +F Y    + +   +  AMNET F GV+  V F  +G R+   +  Q  +     +G ++ + D L ++ +   +  S  P+D   ++ Q R + L +Y     L ++ +I     ++F  +     +       +  L  +G +L+   I L G D        S   F  LC ++   + +G++  +G++F   W V+ +  + K                    +K K++K              +++ ++G   + D+ +L+ W+  DPL R    ++ E D    DI  +P +E C+  ++ +WLGI++ +KGL+++ G  L++ETRN+      D++  GM+VYNV ++ +I A VS + +D+ +  F  V+  I+  S ++L L+++P++             R+F+ T +Q  E+  +      + +    +     +EN +L+ +I+++++++E +  QL + 
Sbjct:   58 IMGLMPLTKEVAKGSIGRGVLPAVELAIEQIRNESLLRP-YFLDLRLYDTECDNAKGLKAFYDAIKYGPNHLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDNAVNPAILKLLKHYQWKRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESF---SNDPCTSVKKLKGNDVRIILGQFDQNMAAKVFCCAYEENMYGSKYQWIIPGWYEPSWWEQVHTEANSSRCLRKNLLAAMEGYI-----------GVDFEPLSSKQIKT-ISGKTPQQYEREYNNKRSGVGP------SKFHGYA-----YDGIWVIAKTLQRAMETLHASSRHQRIQDFNY--TDHTLGRIILNAMNETNFFGVTGQVVF-RNGERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKDKTIILEQLRKISLPLYSILSALTILGMIMASAFLFFNIKNRNQKLIKMSSPYMNNLIILGGMLSYASIFLFGLDG----SFVSEKTFETLCTVRTWILTVGYTTAFGAMFAKTWRVHAIFKNVK--------------------MKKKIIK------------DQKLLVIVGGMLLIDLCILICWQAVDPLRRTVEKYSMEPDPAGRDISIRPLLEHCENTHMTIWLGIVYAYKGLLMLFGCFLAWETRNVSIPALNDSKYIGMSVYNVGIMCIIGAAVSFLTRDQPNVQFCIVALVIIFCSTITLCLVFVPKLITLRTNPDAATQNRRFQFTQNQKKEDSKTSTSVTSVNQASTSRLEGLQSENHRLRMKITELDKDLEEVTMQLQDT 819          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. TrEMBL
Match: A0A2Z5X789 (Gamma-aminobutyric acid B receptor A OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 1414.82 bits (3661), Expect = 0.000e+0
Identity = 738/925 (79.78%), Postives = 819/925 (88.54%), Query Frame = 2
Query:  551 SKIYFC-MIIFYVDIVDNFKEKQLHIGAVFPMSGDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRIKRQFRKTGDQDENIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREIEHLKSQLTNVYDVENLGISSQSIVAIHGGFSSYENLNHPKNNSFNRKKLKITGKIKSERKTLLKHSFLTKQQTIALEKEFNDKFSGAMESTSGVYSEFGMISI 3322
            +K  FC  I F+++ + NFKEKQLHIGAVFPMSGDWAGGISCRPAA+MALNDVN+Q +ILPDYNLTMTMKDSQCIAGLG+RMMYELIYTPPVKIMFLTGCSTVTTFVA+AAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTRLKL KRWGWK+VSLIWEMEEVF+STIHDFEM+ KELNITIVKRQPLQKHSQAV+LALKSLKN+ ARII+GLFYEKLAR+VFCEAYKLGLYGAKVVW+IIGWYPDDWWK++LK D INCT ++MK+AVEGHITTESLMWN+DD VT SGLTSRKFK RL++ML+DQWRN E+KI E LI E+LSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSK +SL++F+YH QPN+IYEELHRAMNET FMGVSTLVYFDSSG+RISWTRIEQMINGSY +LGHHHILTDNLTLL EPSW N +IP+DS+ALIFQRRALPLSIYIGFCCLV ICII G++CIY+VH+C P SMKTDGKLKLKLLC  GC+LNM  II LGADRI SV I+S+TLFM+LCQLKV  +C+GFSLGYGSLF+SIW+VYRVAT+RKKL  D+   NKC  IE+     DK       +K    YNSWE+IGMLGSFC +D+++L AW+YFDPLSR KV FNQEKD  DEDIHYQPYMEICDC+NLGLWLGIIFGWKGLVLILGLLLSYETRNIKFSFAIDTRSTGMAVYNVVVLSLI APVSVMIKDKQSAHFVFVST+ILLTS+LSLGLIY+PR+KRQF KT DQDE+ ISDDETIQLRK EEEQ  +  TENEQLKRQI+++EREIEHLK+QL N YD++    SSQ IV+IHG F S ENLN    NS  RK   IT K K ERK LLKHS+L+KQ T+ L+KE+NDK S A+ESTSGVYSEFGMISI
Sbjct:    3 NKKLFCYFIFFHINTIHNFKEKQLHIGAVFPMSGDWAGGISCRPAALMALNDVNSQHEILPDYNLTMTMKDSQCIAGLGTRMMYELIYTPPVKIMFLTGCSTVTTFVAQAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTRLKLFKRWGWKRVSLIWEMEEVFTSTIHDFEMTAKELNITIVKRQPLQKHSQAVFLALKSLKNEGARIIVGLFYEKLARRVFCEAYKLGLYGAKVVWIIIGWYPDDWWKFNLKNDEINCTVEQMKIAVEGHITTESLMWNSDDVVTLSGLTSRKFKSRLLDMLRDQWRNTEDKIPEILINERLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKNISLNDFQYHTQPNKIYEELHRAMNETNFMGVSTLVYFDSSGSRISWTRIEQMINGSYKLLGHHHILTDNLTLLSEPSWENDKIPKDSIALIFQRRALPLSIYIGFCCLVFICIILGIICIYWVHKCTPISMKTDGKLKLKLLCFAGCILNMCGIICLGADRIPSVTIQSDTLFMILCQLKVGLICIGFSLGYGSLFISIWVVYRVATNRKKLIPDQYINNKCDKIENPKHANDKKSNCEQRTKNKTGYNSWELIGMLGSFCFSDILILAAWQYFDPLSRSKVTFNQEKDKFDEDIHYQPYMEICDCKNLGLWLGIIFGWKGLVLILGLLLSYETRNIKFSFAIDTRSTGMAVYNVVVLSLIAAPVSVMIKDKQSAHFVFVSTAILLTSSLSLGLIYLPRLKRQFSKTSDQDESKISDDETIQLRKAEEEQQKRVNTENEQLKRQITEVEREIEHLKTQLMNEYDIQT---SSQPIVSIHGNFLSNENLNQYNENSCRRKDRIITNKKKCERKKLLKHSWLSKQHTVTLDKEYNDKLSVALESTSGVYSEFGMISI 924          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. TrEMBL
Match: A0A2C9JYZ8 (G_PROTEIN_RECEP_F3_4 domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106073558 PE=4 SV=1)

HSP 1 Score: 589.341 bits (1518), Expect = 0.000e+0
Identity = 342/815 (41.96%), Postives = 504/815 (61.84%), Query Frame = 2
Query:  602 FKEKQLHIGAVFPMSGDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNE-IYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSR-YKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRIKRQFRKTGDQDENIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREIEHLKSQLTN 3040
            FK+K L IG +FPMSG WAGG+ C PA  MAL DVNN+TDILPDY L M   DSQC  GLG++++YEL+Y  P K++ LTGCS V+TFVA+AA  W L+V+++G SSPALSNR RFP+FFRTHPSA+L NP R+K+ K++ W ++S I E +E+F+STI D E  VKE  I I  RQ           A+++LK +DARII+G+FYE +AR+VFC+AYK  LYG K VW IIGWYPD+W+K  +K D  NCT ++++ A+EGH TTE++M + +  +T  G+T+++F  RL  +L                    S  + ++GY EAPLAYDA+WA+A A +K   +L  + + L +F+Y+   NE I   ++ AMN T F+G+S  V F + G+RI+WT+IEQ INGSY  LG +    DNLT  ++  W   R P D   +I   R +  ++Y   C L  + I++G++C+ F H           +  +  L  +GC++ +  I+LLG D     K   +  + V+CQ++   + LGF+L YGS+F  IW V+++ T RKK   DR                  +++I            WE+  +LG   + DV VL AW+  DPL R  + +   +    ++DI  +P +E C   NL +WLG++FG+KG++LI G+ L+YETR++K     D+R  GM++YNVVVL +ITAP+S++I +++ A F FVS +I+L S LS+GLI++P++    +    + + + S  +++  R+ EEE+H K   ENEQLK+QI+++E  I  L  +L +
Sbjct:   25 FKQKTLTIGGIFPMSGSWAGGVGCLPAVEMALADVNNRTDILPDYKLDMRRGDSQCKPGLGTKVLYELLYEKPTKLLVLTGCSIVSTFVAQAAKMWKLVVLSYGGSSPALSNRERFPTFFRTHPSATLHNPIRVKVFKKFNWHRISTIQETQELFTSTIEDLEQRVKEAGIDIAVRQSFLTDPTN---AVRNLKRQDARIIVGVFYEDMARRVFCQAYKERLYGKKHVWFIIGWYPDNWYK--VKDDRHNCTIEQLEEALEGHFTTEAVMIHQEPTMTDVGMTAQQFTQRLNKILNT------------------SDTSLVTGYPEAPLAYDAVWAVAFAFNKTVAQLAERNMKLEDFDYY---NENITNAIYSAMNSTKFLGISGNVAFSAKGDRIAWTQIEQFINGSYVKLGVYDAAADNLTWYRKEKWLGGRPPPDHTQVIDDLRVVSHTLYFSMCGLAGVGILAGILCLIFNHINRNRQCVAFSQPAINNLTVVGCMICLSCIVLLGLDG----KFVPDYHYPVVCQVRAWLLSLGFTLSYGSMFSKIWTVHQLTTTRKK---DRA-----------------IVQI------------WELFTVLGILILLDVGVLTAWQVLDPLQRKLETFARIQPTNTEDDIELRPQLEHCHSENLNIWLGVLFGYKGILLIFGIFLAYETRSVKLKQVNDSRFVGMSIYNVVVLCVITAPISLIIGNQEDATFAFVSLAIILCSFLSMGLIFVPKMMEIIQNPQREGQEVKSLTDSLVSRE-EEERHQKMLGENEQLKKQIAEMEDRIRELNQKLQD 776          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. TrEMBL
Match: A0A0L8H9G1 (G_PROTEIN_RECEP_F3_4 domain-containing protein (Fragment) OS=Octopus bimaculoides OX=37653 GN=OCBIM_22019908mg PE=4 SV=1)

HSP 1 Score: 584.334 bits (1505), Expect = 0.000e+0
Identity = 339/801 (42.32%), Postives = 503/801 (62.80%), Query Frame = 2
Query:  602 FKEKQLHIGAVFPMSGDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYF-NQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRIKRQFRKTGDQDENIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQI 3001
             K K L IG +FPM+G WAGG +C PA  MAL+D+N + D+LPDYNL M  KDSQC+ GLG++++YEL+Y PP KI+ LTGCS V+TFVAEAA  WNL+V+A+GASSPALSNR RFP+FFRTHPSA+L NPTR+KL +R+ WK+++ I    EVF+STI D E  VKE NI I  RQ           A+K+LK +DARII+G+FYE +AR+VFC+AYK  LYG K VW IIGWYPD+W  Y  +   INCT  ++K A+EGH TTE+++ N     T + +TS+++K+RL + L                   ++  ++++GY E+PLAYDA+WA+A+AL+K A RL  K ++L EF+Y+     I +E++ AM+ T F+GVS  V F S G+RI+ T+IEQMING+YH++G++  +TDNLT L +  W   + P D    +   R +P  ++     L    I++G+VC+ F        +       +  +  +GC + +F I L+G D     +  S  ++ V+CQ++   + +GF+LGYGS+F  IW V+R+AT RKK                    + K+++             WE++ +L    + D+ +L+ W+  DPL R+   F  +E     EDI  +PY+E C  +N+ +WLGI+F +KG++LI GL L+YETR++K     D+R  GM++YNVVVL +ITAP++++I  +Q A F F+S +I++ S LS+GLI+ P+I         +   I +  +++  R+ EEE++ +   ENE++K+ I+Q+
Sbjct:   32 LKHKNLTIGTIFPMTGGWAGGKACLPAVKMALDDINKRHDVLPDYNLEMDYKDSQCMPGLGTKVLYELLYNPPTKILVLTGCSIVSTFVAEAAKMWNLVVLAYGASSPALSNRDRFPTFFRTHPSATLHNPTRVKLFQRYKWKRIATIQVSLEVFTSTIDDLERKVKEANIDIAVRQSFLTDPTN---AVKNLKRQDARIIVGVFYEDMARRVFCQAYKEKLYGKKYVWFIIGWYPDNW--YMAEDKSINCTVDQLKEALEGHFTTEAMILNQQPTKTLANMTSQRYKERLDSEL------------------NVTDTSQVTGYPESPLAYDALWAVALALNKTAARLALKNLTLDEFDYN--KKHITDEIYSAMDSTSFLGVSGNVAFSSEGDRIALTQIEQMINGTYHLMGYYDSVTDNLTWLDKEQWLGGKPPPDHTRFVRFLRVVPQGLFFSMSVLAFFGILAGIVCMSFNIMHKHRRLIIYSHAGVNNVMVVGCQMCLFCIFLIGMDG----QFISEDIYPVVCQIRAWLLTIGFTLGYGSMFSKIWTVHRLATTRKK--------------------ERKVVR------------KWELLAVLVCLLVIDMAILVPWQLLDPLYRHLEKFPPEEPKHTSEDIMLEPYLEHCSSKNMKIWLGIMFSYKGVLLIFGLFLAYETRSVKLKQVNDSRFVGMSIYNVVVLCVITAPITLIINSQQDATFAFMSLAIVMCSFLSMGLIFGPKIVDVLNNPHQEGMEIRALTDSLACRE-EEERYQRLLAENEEIKKAIAQV 770          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. TrEMBL
Match: V4CE55 (G_PROTEIN_RECEP_F3_4 domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_141127 PE=4 SV=1)

HSP 1 Score: 578.941 bits (1491), Expect = 0.000e+0
Identity = 333/807 (41.26%), Postives = 498/807 (61.71%), Query Frame = 2
Query:  593 VDNFKEKQLHIGAVFPMSGDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDI-LDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPR-IKRQFRKTGDQDENIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQIER 3007
            V + K+K+L IG +FPM+G WAGG +C PA +MAL DVNN++DIL DY L M+  DSQC+ GLG++++Y L+YT PVK+M L+GCS V+TFVA+AA  WNL+V+A+GASSPALSNR RFP+FFRTHPSA+L NPTR+K+ +++GW K++ I + +EVF ST  D    VK   I IV  Q           A++SLK +DARII+GLFYE  ARKVFC+ YK  LYG K VW++IGWYPD+W+K  L  D INCT  ++  A+EGH TTE+++ + D ++T  G+T+ +F  RL   L+               ++ ++  + ++GY EAPLAYDA+WA+A+AL+K A RL  K +SL +F+Y +  N I +E++ AMN T F+GVS  V F S G+RI+WT+IEQMING+YH LG++  + DNLT   +  W   +IP+D   ++   R +  ++Y   C +  + I++GVVC+ F +      +    +  +  +  IGC++ +  I ++G D     K      + + CQ+    + +GF+LGYGS+F  +W+V+++ T  KK                                   +   W V  +L  F   DV +L  W+  DPL R   +F  E     DEDI   P +E C   +L +WLG++FG+K ++LI G+ LSYE R++K     D++   M +YNVVV+ +ITAP++++I  +Q A F F+S +I+L S LS+GL+++P+ ++ +   + D+++N    D  +   + EEE+H +   ENEQLK+QI+ + R
Sbjct:   16 VYSLKDKKLSIGGIFPMNGSWAGGQACLPAVLMALQDVNNRSDILRDYELEMSFDDSQCMPGLGTKVLYNLLYTKPVKLMVLSGCSIVSTFVAQAAKMWNLVVLAYGASSPALSNRQRFPTFFRTHPSATLHNPTRVKIFQKFGWTKIATIQDTQEVFQSTKEDLSKRVKAAGINIVATQTFLTDPVN---AVRSLKRQDARIIVGLFYEDAARKVFCQVYKEKLYGKKYVWLLIGWYPDNWYKSKL--DSINCTGDQLAEALEGHFTTEAVILHQDSSMTDVGMTAPEFTRRLDEKLR--------------YEKNITDTSLVTGYPEAPLAYDAVWAMALALNKTAVRLAEKNLSLLDFDY-VNKN-ITDEIYSAMNSTKFLGVSGNVAFSSQGDRIAWTQIEQMINGTYHKLGYYDSVADNLTWFGKEKWKGGKIPKDHTVVVNSLRVVSPALYYSMCGVASLGILAGVVCLLFNYTNRNRRIIALSQPLVNSITCIGCMICLLCIFMVGLDG----KFLPADKYSLKCQVGAWILSIGFTLGYGSMFAKVWMVHKLTTASKK-----------------------------------ERKEWGVHVVLSIFLALDVAILTIWQIMDPLQRKLEFFPLENPRNTDEDIKLLPQLEHCYSEHLSIWLGVLFGYKSILLIFGIFLSYELRSVKLKQVNDSKFVAMGIYNVVVMCVITAPITLIIGHQQDATFAFISLAIVLCSFLSMGLLFVPKMVEVKRHSSADEEDNSGLTDSLVS--REEEERHQRLLAENEQLKKQIADVSR 760          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. TrEMBL
Match: A0A2T7NKE5 (G_PROTEIN_RECEP_F3_4 domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_17430 PE=4 SV=1)

HSP 1 Score: 572.007 bits (1473), Expect = 0.000e+0
Identity = 349/829 (42.10%), Postives = 508/829 (61.28%), Query Frame = 2
Query:  605 KEKQLHIGAVFPMSGDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDI-LDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRIKRQFRKTGDQDENIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREIEHLKSQLTNVYDVENLGISSQSIVA 3088
            K+  L +G +FPMSG WAGG++C+PA +MAL  VNN+ DILP Y+L M   DSQC+ GLG++++Y+L+Y  P KIM L+GCS+V+TFVA+AA  WNLIV+A+GASSPALSNR RFP FFRTHPSA++ NPTR+KL K + W +++ I E +E+F+STI D E  VKE  I I  RQ           A+++LK +DAR+I+G+FYE +AR+VFC+AYK  LYG K VW+IIGWYPD+W  Y  + D  NCT ++++ A+EGH+TTE+++ + ++  T  G+  ++F  RL         N E   S+  +         I+GY EAPLAYDA+WA+A AL+K A +L  K +SL +F Y  +  EI +E++ AMN T F+G+S  V F S G+RI+ T+IEQMING+YH LG++  L DN T      W   + P D   +I   R +  ++Y   C L ++ I++G  C+ F +R          +  +  L  +GC+  +  I LLG D     K  S  ++ ++CQ++   + LGF+L YGS+F  IW V+++ T RKK                               + GV+   WE+  +L    + DV VL AW+  DPL R    F QE     +EDI  +P +E C+  NL +WLG++FG+KG++LI G+ L+YETR++K     D+R  GM++YNVVVL +ITAP+S++I ++Q A F FVS +I+L S LSLGLI++P  KR  ++     ++++S        + EEE+H +  +ENEQLK+QI+++   I    S    V  + N  I + +I A
Sbjct:  101 KDIPLTLGGIFPMSGSWAGGVACKPAVMMALEMVNNRPDILPRYHLNMQYNDSQCMPGLGTKVLYQLLYDKPTKIMVLSGCSSVSTFVAQAANMWNLIVLAYGASSPALSNRERFPMFFRTHPSATVHNPTRVKLFKHFKWNRIATIQETQELFTSTIEDLEKRVKEAGIDIAVRQSFLTDPTN---AVRNLKRQDARVIVGVFYEDMARRVFCQAYKEKLYGKKYVWLIIGWYPDNW--YRTRDDRHNCTVEQLEEALEGHLTTEAVILHQENTTTDVGMMPQEFTQRL---------NKELNTSDPSL---------ITGYPEAPLAYDAVWALAFALNKTANKLAEKGMSLEQFNYSNK--EIAQEIYSAMNSTKFLGISGNVAFSSQGDRIARTQIEQMINGTYHKLGYYDSLADNFTWFGTDRWIGGKPPLDHTHVIDHLRVVSKTLYFSMCALAIVGILAGAFCLIFNYRNRQRRCVAFSQPNINSLTVLGCMSCLACIFLLGLDG----KFVSPDVYPLVCQIRAWVLSLGFTLSYGSMFSKIWTVHQLTTSRKK------------------------------DRKGVQI--WELYTVLAVLLVLDVGVLSAWQVLDPLKRELEVFAQEDPTDTEEDIQLRPQLEHCNSENLSVWLGVLFGYKGILLIFGIFLAYETRSVKLKQVNDSRFVGMSIYNVVVLCVITAPISLIIGNQQDATFAFVSLAIILCSFLSLGLIFVP--KRDGQEVRSLTDSLVS--------REEEERHLRMVSENEQLKKQIAEV---ISPFLSPDETVPLLSNTSIHANAITA 855          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Cavefish
Match: gabbr1b (gamma-aminobutyric acid type B receptor subunit 1 [Source:NCBI gene;Acc:103033827])

HSP 1 Score: 518.464 bits (1334), Expect = 2.312e-168
Identity = 314/813 (38.62%), Postives = 480/813 (59.04%), Query Frame = 2
Query:  608 EKQLHIGAVFPMSGDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRIKRQFRK---TGDQDENIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREIEHLKSQLT 3037
            +K+L+IGA+FPMSG W GG +C P+A MAL  VN +TDILPDY L +   DSQC  G  ++++Y+L+YT P+KI+ + GCS+V+T VAEAA  WNLIV+++G+SSPALSNR RFP+FFRTHPSA+L NPTR++L ++WGW K++ I +  EVF+ST+ D E  VKE  I I  RQ          +A+K+LK +DARII+GLFYE  ARKVFCE YK  LYG K VW +IGWY D+W+K  +K   INCT ++M  AVEGH+TTE +M N +     S LTS++F  +L   L    ++PE                +  G+ EAPLAYDA+WA+A+AL+K    LK+K   L +F Y+ +  +I  E++RA+N + F GVS  V FD+ G+R++WT IEQ+  GSY  +G++ +   NL+      W  +  P D   +I + R L   +++       + I+ G+VC+ F    +      + +  L  + ++GC++ +  +  LG D +   K +    F V+CQ ++  + LGFSL YGS+F  IW V+ V T + +    R                                  W++   +G   + DV+ L+ W+  DPL      F +E    D+D+  +P +E C    +  WLG+++G+KGL+L+LG+ L+YET+++      D R+ GMA+YNV VL +ITAPV++++  KQ A F F S +I+ +  ++L ++++P+++R   +     DQ E + +   T      +EE+  +   EN++L++ I + E  +  L++QL+
Sbjct:   33 KKKLYIGALFPMSGGWPGGQACLPSAKMALELVNKRTDILPDYELELIHYDSQCDPGEATKLLYDLLYTEPIKIVLMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVQLFQKWGWTKIATIQQTTEVFTSTLDDLEQRVKEAGIEISVRQSFLTDPA---VAVKNLKRQDARIIVGLFYETEARKVFCEVYKEKLYGKKHVWFLIGWYADNWFK--IKDPSINCTVEQMTEAVEGHVTTEIVMLNPETVRGASNLTSQEFLAQLNVTLGG--KSPE----------------ETGGFQEAPLAYDAVWALALALNKTVGPLKAKGRRLEDFNYNNK--DITAEIYRALNTSSFEGVSGHVVFDAQGSRMAWTLIEQLQGGSYKKIGYYDMTKGNLSWYGNDKWIGAGPPADQTMVILEYRFLSQKLFVSVSVFAGLGILLGIVCLTFNIYNSNVRYIQNSQPYLNNMTAVGCMMALAAVFPLGLDGLHVHKSQ----FPVVCQFRLWLLGLGFSLAYGSMFTKIWWVHTVFTKKDEKKDKR-----------------------------KHLEPWKLYATVGVLLVIDVLSLMIWQIVDPLHITVEKFTREAPKGDQDVLIEPLLEHCSSEKMNTWLGVVYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVSVLCMITAPVTMILSSKQDASFAFASLAIVFSVYITLVVLFVPKMRRLITRGEWQSDQQETMKTGSST---NNNDEEKSRQLERENKELQKIIQEKEERVSELRNQLS 784          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Cavefish
Match: gabbr1a (gamma-aminobutyric acid type B receptor subunit 1 [Source:NCBI gene;Acc:103038203])

HSP 1 Score: 517.694 bits (1332), Expect = 2.817e-166
Identity = 314/810 (38.77%), Postives = 474/810 (58.52%), Query Frame = 2
Query:  608 EKQLHIGAVFPMSGDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRIKRQFRKTGDQDENIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREIEHLKSQLT 3037
            +K+L+IGA+FPMSG W GG +C P+A MAL+ VNN++DILPDY L +   DS C  G  ++++Y+L+YT P+KI+ + GCS+V+T VAEAA  WNLIV ++G+SSPALSNR RFP+FFRTHPSA+L NPTR++L ++W W K++ I +  EVF+ST+ D E  VKE  I I  RQ          +A+K+LK +DARII+GLFYE  ARKVFCE YK  L+G K VW +IGWY D+W+K  +K   INCT ++M  AVEGH+TTE +M N +     S LTS++F  +L++ L    +NPE                +  G+ EAPLAYDA+WA+A+AL+K    L++K   L +F Y+ +  +I  E++RA+N + F GVS  V FD+ G+R++WT IEQ+  GSY  +G++     NL+      W  +  P D   +I Q R L   +++       + I+ G+VC+ F    +      + +  L  + ++GC+L +  +  LG D     + +    F V+CQ ++  + LGFSL YGS+F  IW V+ V T + +    R                                + W++   +G     DV+ L+ W+  DPL      F +E    D D+  QP +E C  + +  WLG++FG+KGL+L+LG+ L+YET++I      D R+ GMA+YNV VL LITAPV++++  +Q A F F S +I+ +  ++L ++++P+++R   +   Q E   +          +EE+  +   EN +L++ I + E  +  L+SQL 
Sbjct:  164 KKKLYIGALFPMSGGWPGGQACLPSAQMALDLVNNRSDILPDYELELIHYDSMCDPGEATKLLYDLLYTEPIKIVLMPGCSSVSTLVAEAARMWNLIVFSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVRLFQKWNWSKIATIQQTTEVFTSTLDDLEQRVKEAQIEISVRQSFLTDPA---VAVKNLKRQDARIIVGLFYETEARKVFCEVYKEKLFGKKYVWFLIGWYADNWFK--IKDPAINCTVEQMTEAVEGHVTTEIVMLNPETVRGASNLTSQEFIAQLMSRLGG--KNPE----------------ETGGFQEAPLAYDAVWALALALNKTVAPLRAKGRRLEDFNYNNK--DITAEIYRALNTSSFEGVSGHVVFDAQGSRMAWTLIEQLQGGSYKKIGYYDSSKGNLSWYGNDKWIGAGPPADQTMVIDQYRYLSQKLFVSVSVFAGLGILLGIVCLTFNIYNSNVRYIQNSQPYLNNITAVGCVLALAAVFPLGIDGHHVHRSQ----FPVVCQFRLWLLGLGFSLAYGSMFTKIWWVHTVFTKKDEKKEKR-----------------------------KHLDPWKLYATVGGLLAIDVLSLMIWQIIDPLHVTVEQFTKEAPKADLDVLIQPLLEHCSSKKINTWLGVVFGYKGLLLLLGIFLAYETKSISTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDASFAFASLAIVFSVYITLVVLFVPKMRRLITRGEWQSEQQDTLKTGSSTNNNDEEKSRQLERENRELQKIIQEKEERVTELRSQLA 915          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Cavefish
Match: gabbr1b (gamma-aminobutyric acid type B receptor subunit 1 [Source:NCBI gene;Acc:103033827])

HSP 1 Score: 516.924 bits (1330), Expect = 7.337e-166
Identity = 314/813 (38.62%), Postives = 480/813 (59.04%), Query Frame = 2
Query:  608 EKQLHIGAVFPMSGDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRIKRQFRK---TGDQDENIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREIEHLKSQLT 3037
            +K+L+IGA+FPMSG W GG +C P+A MAL  VN +TDILPDY L +   DSQC  G  ++++Y+L+YT P+KI+ + GCS+V+T VAEAA  WNLIV+++G+SSPALSNR RFP+FFRTHPSA+L NPTR++L ++WGW K++ I +  EVF+ST+ D E  VKE  I I  RQ          +A+K+LK +DARII+GLFYE  ARKVFCE YK  LYG K VW +IGWY D+W+K  +K   INCT ++M  AVEGH+TTE +M N +     S LTS++F  +L   L    ++PE                +  G+ EAPLAYDA+WA+A+AL+K    LK+K   L +F Y+ +  +I  E++RA+N + F GVS  V FD+ G+R++WT IEQ+  GSY  +G++ +   NL+      W  +  P D   +I + R L   +++       + I+ G+VC+ F    +      + +  L  + ++GC++ +  +  LG D +   K    + F V+CQ ++  + LGFSL YGS+F  IW V+ V T + +    R                                  W++   +G   + DV+ L+ W+  DPL      F +E    D+D+  +P +E C    +  WLG+++G+KGL+L+LG+ L+YET+++      D R+ GMA+YNV VL +ITAPV++++  KQ A F F S +I+ +  ++L ++++P+++R   +     DQ E + +   T      +EE+  +   EN++L++ I + E  +  L++QL+
Sbjct:  163 KKKLYIGALFPMSGGWPGGQACLPSAKMALELVNKRTDILPDYELELIHYDSQCDPGEATKLLYDLLYTEPIKIVLMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVQLFQKWGWTKIATIQQTTEVFTSTLDDLEQRVKEAGIEISVRQSFLTDPA---VAVKNLKRQDARIIVGLFYETEARKVFCEVYKEKLYGKKHVWFLIGWYADNWFK--IKDPSINCTVEQMTEAVEGHVTTEIVMLNPETVRGASNLTSQEFLAQLNVTLGG--KSPE----------------ETGGFQEAPLAYDAVWALALALNKTVGPLKAKGRRLEDFNYNNK--DITAEIYRALNTSSFEGVSGHVVFDAQGSRMAWTLIEQLQGGSYKKIGYYDMTKGNLSWYGNDKWIGAGPPADQTMVILEYRFLSQKLFVSVSVFAGLGILLGIVCLTFNIYNSNVRYIQNSQPYLNNMTAVGCMMALAAVFPLGLDGLHVHK----SQFPVVCQFRLWLLGLGFSLAYGSMFTKIWWVHTVFTKKDEKKDKRKQ----------------------------HLEPWKLYATVGVLLVIDVLSLMIWQIVDPLHITVEKFTREAPKGDQDVLIEPLLEHCSSEKMNTWLGVVYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVSVLCMITAPVTMILSSKQDASFAFASLAIVFSVYITLVVLFVPKMRRLITRGEWQSDQQETMKTGSST---NNNDEEKSRQLERENKELQKIIQEKEERVSELRNQLS 915          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Cavefish
Match: gabbr1a (gamma-aminobutyric acid type B receptor subunit 1 [Source:NCBI gene;Acc:103038203])

HSP 1 Score: 503.827 bits (1296), Expect = 4.297e-163
Identity = 307/799 (38.42%), Postives = 463/799 (57.95%), Query Frame = 2
Query:  641 MSGDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRIKRQFRKTGDQDENIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREIEHLKSQLT 3037
            MSG W GG +C P+A MAL+ VNN++DILPDY L +   DS C  G  ++++Y+L+YT P+KI+ + GCS+V+T VAEAA  WNLIV ++G+SSPALSNR RFP+FFRTHPSA+L NPTR++L ++W W K++ I +  EVF+ST+ D E  VKE  I I  RQ          +A+K+LK +DARII+GLFYE  ARKVFCE YK  L+G K VW +IGWY D+W+K  +K   INCT ++M  AVEGH+TTE +M N +     S LTS++F  +L++ L    +NPE                +  G+ EAPLAYDA+WA+A+AL+K    L++K   L +F Y+ +  +I  E++RA+N + F GVS  V FD+ G+R++WT IEQ+  GSY  +G++     NL+      W  +  P D   +I Q R L   +++       + I+ G+VC+ F    +      + +  L  + ++GC+L +  +  LG D     +    + F V+CQ ++  + LGFSL YGS+F  IW V+ V T + +    R                                + W++   +G     DV+ L+ W+  DPL      F +E    D D+  QP +E C  + +  WLG++FG+KGL+L+LG+ L+YET++I      D R+ GMA+YNV VL LITAPV++++  +Q A F F S +I+ +  ++L ++++P+++R   +   Q E   +          +EE+  +   EN +L++ I + E  +  L+SQL 
Sbjct:    1 MSGGWPGGQACLPSAQMALDLVNNRSDILPDYELELIHYDSMCDPGEATKLLYDLLYTEPIKIVLMPGCSSVSTLVAEAARMWNLIVFSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVRLFQKWNWSKIATIQQTTEVFTSTLDDLEQRVKEAQIEISVRQSFLTDPA---VAVKNLKRQDARIIVGLFYETEARKVFCEVYKEKLFGKKYVWFLIGWYADNWFK--IKDPAINCTVEQMTEAVEGHVTTEIVMLNPETVRGASNLTSQEFIAQLMSRLGG--KNPE----------------ETGGFQEAPLAYDAVWALALALNKTVAPLRAKGRRLEDFNYNNK--DITAEIYRALNTSSFEGVSGHVVFDAQGSRMAWTLIEQLQGGSYKKIGYYDSSKGNLSWYGNDKWIGAGPPADQTMVIDQYRYLSQKLFVSVSVFAGLGILLGIVCLTFNIYNSNVRYIQNSQPYLNNITAVGCVLALAAVFPLGIDGHHVHR----SQFPVVCQFRLWLLGLGFSLAYGSMFTKIWWVHTVFTKKDEKKEKR-----------------------------KHLDPWKLYATVGGLLAIDVLSLMIWQIIDPLHVTVEQFTKEAPKADLDVLIQPLLEHCSSKKINTWLGVVFGYKGLLLLLGIFLAYETKSISTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDASFAFASLAIVFSVYITLVVLFVPKMRRLITRGEWQSEQQDTLKTGSSTNNNDEEKSRQLERENRELQKIIQEKEERVTELRSQLA 741          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Cavefish
Match: gabbr1a (gamma-aminobutyric acid type B receptor subunit 1 [Source:NCBI gene;Acc:103038203])

HSP 1 Score: 493.426 bits (1269), Expect = 2.937e-157
Identity = 307/809 (37.95%), Postives = 463/809 (57.23%), Query Frame = 2
Query:  608 EKQLHIGAVFPMSGDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRIKRQFRKTGDQDENIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREIEHLKSQL 3034
            +K+L+IGA+FPMSG W GG +C P+A MAL+ VNN++DILPDY L +   DS C  G  ++++Y+L+YT P+KI+ + GCS+V+T VAEAA  WNLIV ++G+SSPALSNR RFP+FFRTHPSA+L NPTR++L ++W W K++ I +  EVF+ST+ D E  VKE  I I  RQ          +A+K+LK +DARII+GLFYE  ARKVFCE YK  L+G K VW +IGWY D+W+K  +K   INCT ++M  AVEGH+TTE +M N +     S LTS++F  +L++ L    +NPE                +  G+ EAPLAYDA+WA+A+AL+K    L++K   L +F Y+ +  +I  E++RA+N + F GVS  V FD+ G+R++WT IEQ+                            +  P D   +I Q R L   +++       + I+ G+VC+ F    +      + +  L  + ++GC+L +  +  LG D     + +    F V+CQ ++  + LGFSL YGS+F  IW V+ V T + +    R                                + W++   +G     DV+ L+ W+  DPL      F +E    D D+  QP +E C  + +  WLG++FG+KGL+L+LG+ L+YET++I      D R+ GMA+YNV VL LITAPV++++  +Q A F F S +I+ +  ++L ++++P+++R   +   Q E   +          +EE+  +   EN +L++ I + E  +  L+SQL
Sbjct:  164 KKKLYIGALFPMSGGWPGGQACLPSAQMALDLVNNRSDILPDYELELIHYDSMCDPGEATKLLYDLLYTEPIKIVLMPGCSSVSTLVAEAARMWNLIVFSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVRLFQKWNWSKIATIQQTTEVFTSTLDDLEQRVKEAQIEISVRQSFLTDPA---VAVKNLKRQDARIIVGLFYETEARKVFCEVYKEKLFGKKYVWFLIGWYADNWFK--IKDPAINCTVEQMTEAVEGHVTTEIVMLNPETVRGASNLTSQEFIAQLMSRLGG--KNPE----------------ETGGFQEAPLAYDAVWALALALNKTVAPLRAKGRRLEDFNYNNK--DITAEIYRALNTSSFEGVSGHVVFDAQGSRMAWTLIEQL--------------------------QGAGPPADQTMVIDQYRYLSQKLFVSVSVFAGLGILLGIVCLTFNIYNSNVRYIQNSQPYLNNITAVGCVLALAAVFPLGIDGHHVHRSQ----FPVVCQFRLWLLGLGFSLAYGSMFTKIWWVHTVFTKKDEKKEKR-----------------------------KHLDPWKLYATVGGLLAIDVLSLMIWQIIDPLHVTVEQFTKEAPKADLDVLIQPLLEHCSSKKINTWLGVVFGYKGLLLLLGIFLAYETKSISTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDASFAFASLAIVFSVYITLVVLFVPKMRRLITRGEWQSEQQDTLKTGSSTNNNDEEKSRQLERENRELQKIIQEKEERVTELRSQL 888          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007580.1 (pep scaffold:Pmarinus_7.0:GL479777:49246:63453:-1 gene:ENSPMAG00000006844.1 transcript:ENSPMAT00000007580.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 274.248 bits (700), Expect = 2.921e-81
Identity = 195/582 (33.51%), Postives = 310/582 (53.26%), Query Frame = 2
Query: 1253 YKLGLYGAKVVWVIIGWYPDDWWKYHLKKD-GINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRIKRQFRKTGDQDENIISDDETIQLRKTEEEQHNKYFTENEQLKRQIS 2995
            YK  LYG K VW IIGWY D W   +LK D  INCT ++M+ AVEG +TTE LM +  +    S +TS +F  RL+  L    + PE                +  G+ EAPLAYDAIWA+A+AL+K A+ L  K + L +F Y    N I  E+++A+N + F GVS  V FD+SG R++WT IEQ+ +G Y  +G++    +NL+ L    W     P D   ++ Q R L   ++I    L  I II G VC+ F           + +  L  L ++GC+L + V++ LG D +      S + F  +CQ++V  + +GF +GYGS+F  IW V+ + T +                      K ++ ++ P      +   W++          D V +L W+  DPL R    F +E +++ +D+   P +E C  R +  WLGI++ +KGL+L+LG+ L+YET+++      D RS GMA+YNV VL +ITAPV++++  +Q A F F + +++ +S ++L ++++P+++R   +   Q E   ++         EEE+  +   EN +L+R I+
Sbjct:    2 YKEKLYGKKHVWFIIGWYADKW---YLKPDLAINCTAEQMQEAVEGQVTTEILMVDLANTRGVSNMTSDEFISRLVKNLT---KTPE----------------ETGGFQEAPLAYDAIWALALALNKTAQELAKKGMRLEDFNY--SDNTITNEIYKALNSSSFDGVSGHVVFDASGARMAWTLIEQLQDGKYVKIGYYDSNNNNLSWLNTDRWIGGSPPPDRTKVVIQFRYLSQKLFISLSVLAGIGIIFGCVCLVFNIYNRNVRYIQNSQPNLNNLTALGCILTLAVVLPLGLDGLHI----SESQFPFICQVRVWLLSIGFGMGYGSMFTKIWWVHTLFTKKDD--------------------KKEMRQLNP------QLEQWKLYVTAAVLIFIDAVTILIWQLVDPLQRTVEGFGKE-NLVGDDVEILPQLEHCSSRKMTTWLGIVYTYKGLLLLLGIFLAYETKSVSTEKINDHRSVGMAIYNVSVLCMITAPVAMIVSKQQDASFAFAALAVIFSSYITLIVLFVPKMRRLITRGEWQTEQHDANKTISTTLNNEEEKSRQLERENRELERIIA 528          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010341.1 (pep scaffold:Pmarinus_7.0:GL478021:14492:51134:1 gene:ENSPMAG00000009364.1 transcript:ENSPMAT00000010341.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 191.045 bits (484), Expect = 3.097e-54
Identity = 99/192 (51.56%), Postives = 139/192 (72.40%), Query Frame = 2
Query:  608 EKQLHIGAVFPMSGDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLK 1183
            ++ L+IG +FPMSG W GG +C+PAA+MAL+DVN++ D++ DY L +   DS    G  ++++Y+L+Y  P+KI+ + GCS+V+T VAEAA  WNLIV+++G+SSPALSNR RFP+FFRTHPSA+L NPTR+ L K WGW +++ I +  EVF+ST+ D E SVKE  I I  RQ          +A+K+LK
Sbjct:  140 KQALYIGGLFPMSGSWPGGQACKPAAMMALDDVNDKPDLMSDYELKLIETDSMVWPGHATKILYDLLYYGPIKIVLMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVHLFKTWGWTRIATIQQTAEVFTSTLADLEESVKEAGIEINVRQSFLSDPS---VAVKNLK 328          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Sea Lamprey
Match: GABBR2 (gamma-aminobutyric acid type B receptor subunit 2 [Source:HGNC Symbol;Acc:HGNC:4507])

HSP 1 Score: 149.828 bits (377), Expect = 3.478e-39
Identity = 116/416 (27.88%), Postives = 202/416 (48.56%), Query Frame = 2
Query:  902 MAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKK---VSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEP-SWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGAD 2137
            ++F A++P LS++ ++P+FFRT PS +  NP  ++ L+ + W++V  + +  + FS   +D     KEL+   ++    Q  S    + +++LK  D RII+G F E++A KVFC AY  G+YG+K  WVI GWY   WW++  ++    C +K + +A+E  I  + +  +     T SGLT +++++   +ML          +SE      ++  +K  GY     AYD IW IA  L++  + L++ K    S+  F Y  Q   I + L  A+NET F+GV+  V F  +G R+      Q  +     +G ++ + D L L+     +     P D   +  + R + L +Y     L  + +      ++F  +     +       +  L  +G +L+   I L G D
Sbjct:    2 LSFAATTPVLSDKKKYPNFFRTVPSDNAVNPAIVRFLQHYKWQRVGTLAQDVQRFSEVHNDL---TKELDKAGIQIAETQSFSNDPCVNVQNLKTSDVRIILGQFDEEMAAKVFCCAYNEGMYGSKYQWVIPGWYGSRWWEHTQQQ----CPQKNLLIAMENCIYVDFMPLSTRPVRTISGLTPQQYEEEYYHML---------GVSE------VAPHSKFHGY-----AYDGIWVIAQVLNRTIELLEADKSLIASIESFSYTNQ--RIGQILLDALNETNFLGVTGQVLF-RNGERLGTIEFMQFQSTERVKVGEYNAVPDTLELINSTMRFQGPDPPWDRTIVQSKLREVYLPLYSILSVLTCLGMFMASAFLFFNIKNRNQKLIKMSSPYMNNLIILGGMLSYMTIFLFGLD 387          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007583.1 (pep scaffold:Pmarinus_7.0:GL479777:50633:55489:-1 gene:ENSPMAG00000006844.1 transcript:ENSPMAT00000007583.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 104.375 bits (259), Expect = 7.256e-25
Identity = 93/316 (29.43%), Postives = 163/316 (51.58%), Query Frame = 2
Query: 1907 PRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPR 2854
            P D   ++ Q R L   ++I    L  I II G VC+ F           + +  L  L ++GC+L + V++ LG D +      S + F  +CQ++V  + +GF +GYGS+F  IW V+ + T +     D+               K++L               W++          D V +L W+  DPL R      + ++++ +D+   P +E C  R +  WLGI++ +KGL+L+LG+ L+YET+++      D RS GMA+YNV VL +ITAPV++++  +Q A F F + +++ +S ++L ++++P+
Sbjct:    5 PPDRTKVVIQFRYLSQKLFISLSVLAGIGIIFGCVCLVFNIYNRNVRYIQNSQPNLNNLTALGCILTLAVVLPLGLDGLH----ISESQFPFICQVRVWLLSIGFGMGYGSMFTKIWWVHTLFTKKD----DK---------------KEQL-------------EQWKLYVTAAVLIFIDAVTILIWQLVDPLQRTV----EVENLVGDDVEILPQLEHCSSRKMTTWLGIVYTYKGLLLLLGIFLAYETKSVSTEKINDHRSVGMAIYNVSVLCMITAPVAMIVSKQQDASFAFAALAVIFSSYITLIVLFVPK 280          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004054.1 (pep scaffold:Pmarinus_7.0:GL487958:4015:7652:1 gene:ENSPMAG00000003710.1 transcript:ENSPMAT00000004054.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.3066 bits (142), Expect = 2.733e-10
Identity = 45/170 (26.47%), Postives = 91/170 (53.53%), Query Frame = 2
Query: 2534 EDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRI------------KRQFRKTGDQD-ENIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQIE 3004
            ED    P +E C+  ++ +WL I++ +KGL+++ G  L++ETRN+      D++  GM+VYNV ++ +I A VS + +D+ +  +  V+   + +S ++L L+++P++             R+FR T  Q  E+  +      +  +   +      EN++L+  I+Q+ 
Sbjct:    8 EDFTILPQLEHCESTHMTIWLSIVYAYKGLLMVFGCFLAWETRNVSIPALNDSKYIGMSVYNVGIMCIIGAAVSFLTRDQPNVQYCTVALVTIFSSTITLCLVFMPKLIAMRTNPDAATRNRRFRFTQAQKREDARTPPSVSSVNHSSSGRLEGLQAENQRLRMYITQVP 177          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Nematostella
Match: EDO47111 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNB3])

HSP 1 Score: 264.233 bits (674), Expect = 7.557e-76
Identity = 223/748 (29.81%), Postives = 375/748 (50.13%), Query Frame = 2
Query:  611 KQLHIGAVFPMSGD--WAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYE-LIYTPPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQM-----INGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQR------RALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMI-KDKQS-----AHFVF 2794
            K+L+IG  FP+SG    + G    PA  MAL  +NN++DILPDY L +  +D++C  G G +++YE L  + PV  +    CS VT  VAE A  W+L+ +++ +++  LSN+ ++P  +RT    S  N  R+ +L+ +GW++V  + + + VFSS + +   S+++ NI++V  +   K  +     L+++K++DARIIIG+FYE  AR+VFCEAYKLG+YG++ VW+++ W  +  W +    D ++CT  +M  AV G+ + +S+     D    SGLTS++F       LK+  R   N  +   +                P A+D++W IA+AL+  A +L  +  SL +F Y    +E+   L R+     F GV+ ++ F   G R     I Q+     ++   +   ++ I+  N TL   P W     P D +     R        L ++I +G   ++ I + SG +C    +R   S +K      L  +  +G +L    IIL+  D     +  S      +C      + +G+SL  G++F   W V+++                               K+ P  K+   +   E+IG++      D+VV   W   DPL+ Y++  + E  I + D+   P+ E C  ++   WL II G+KGL+L++G  +S+ETR +K     D+R  GM+VYN+V+  +I  P++++I  D+ S     + FVF
Sbjct:    2 KELYIGGFFPLSGVPVASSGRDILPACKMALEMLNNRSDILPDYRLNLLARDTKCDVGHGIKVLYEYLSRSTPVITLLGPACSAVTKVVAEVAWHWSLLQVSYASTASDLSNKEKYPLLYRTVQPDSAFNSARVSVLEFYGWRRVGTLRQDDFVFSSVMSELHQSLEDHNISVVSPETFSKEPRR---HLEAIKDQDARIIIGMFYEDAARRVFCEAYKLGMYGSQYVWILLDWADNHQW-WLTPDDDVDCTADQMASAVTGYFSIDSVNLERTDKPGISGLTSKEF-------LKEFSRYHPNGTANLYV----------------PYAFDSMWMIALALNNTAGQLHRQNKSLDQFCY--GDHEMARLLQRSTESLVFRGVTGMIEFSKKGERKQPVWINQLQEWRPVHVGLYDPANNKIM-QNTTL---PIWQGDGPPSDGLVHYLSRVEHVTMSLLWVTIVLG---MIGILLASGFLCFNVRYRNH-SYIKLSSP-NLNNVIIVGAILIYMSIILVAMDG----RTVSPASLTHICTATSYLLGIGYSLAVGAMFSKTWRVHQIFN-----------------------------KVKPKKKV---FQDSELIGLVVLMIAVDLVVFSLWAGVDPLT-YRLQQSGEA-IREGDVMVTPFYESCHSKHSTTWLYIIMGYKGLILLVGCFISWETRKVKVRALNDSRFVGMSVYNIVLAVVIGGPLTLLIGGDRDSFVALYSFFVF 673          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Nematostella
Match: EDO49051 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHX2])

HSP 1 Score: 254.218 bits (648), Expect = 5.089e-72
Identity = 224/727 (30.81%), Postives = 357/727 (49.11%), Query Frame = 2
Query:  590 IVDNFKEKQLHIGAVFPMS---GDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVK--IMFLTG-CSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSST-IHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPS---WTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYF----VHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVV 2728
            I +N   K+L IGA F +    G W+      PA  MA+ DVNN T IL DY L M  +D++C  G G R + +L+  P  K  IM + G CS  T   AE +  WNLI +AF A+S  LS + R+P  FRT  + S+ NP R+ +LKR+GWK V+ +++ E +F+ T IH  EM  K  N T++  + L K        + +LK KDARIIIG+FY  +ARKVFC AYK G+YGA+ +W+I GW+ D WW         +CT  ++K+A   +I      W+ D  +T +  T+ +  +R                       K    T  +    +   YDA+WA+A  LDKA   L+++   L +F ++   + +       +   ++ G+S  + F+S G+RI    ++Q+       +G +  +   L +L  PS   W +  IP D + +  +  ++  S++I    + L C I  ++ + F    +H      ++     ++  +  IGC++  F  +L G D     K  S   +  LCQ+K+  + +GF+L YG++F   W V+ +   R               IE    I+D                  ++ G++ +    D  +L AW+  +P  R   Y   EKD    +   +PY+E C C ++  W G+I  +KGL+LILG  L++ETRN+      D+R+ G++VY VV+
Sbjct:   19 IANNSTRKKLWIGAFFTVDISDGGWSSA-GVLPAVEMAIEDVNNST-ILQDYELHMEWRDTKCKRGYGIRQLVDLLELPSDKSPIMLIGGGCSVGTEATAEVSHFWNLIQIAFSANSMYLSEQDRYPLLFRTCYTESIGNPARIAILKRYGWKNVATVYQNEGLFTLTAIHLREMLDKN-NFTVISSENLAKDPT---FQILNLKQKDARIIIGMFYSAMARKVFCRAYKEGMYGARYLWLIPGWFSDQWWNI----TDTDCTPAQIKLAAGNYIAIMESTWSTDPRLTINRQTAAELTERYF---------------------KRVDATPYTRNEYSVFGYDAVWAVAQTLDKAIPVLRAQGRMLEDFRFN--DSSMSALFKSILQGLHYQGMSGEIMFNSKGDRIGSAIVKQLQGDREVKIGTYDSIHGTL-ILDGPSKLIWQDGAIPVDRMVVKLKLVSVSASLFI---VITLFCSIGILLALGFLAFNIHYRERRFIRMSSP-RMNSITVIGCIIIYFAALLSGLDG----KYLSEDQYSTLCQVKLWTLSVGFTLAYGAMFSKTWRVHVIFLRR---------------IERR-SIRDH-----------------QLYGIVIALLAVDTALLAAWQVLNPFIRAIKYLPIEKDENGFE-AVRPYIEYCSCDHVMEWKGVILAYKGLLLILGAFLAWETRNVTIPALNDSRNIGVSVYTVVL 669          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Nematostella
Match: EDO38981 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBD0])

HSP 1 Score: 226.483 bits (576), Expect = 5.114e-61
Identity = 239/894 (26.73%), Postives = 418/894 (46.76%), Query Frame = 2
Query:  617 LHIGAVFPMSGDWAG--GISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFL-TGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWE--MEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEM------------------------KMAVEGHIT--TESLMWNNDD--AVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQ-LTKISGYAE------------AP----LAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTR--IEQMINGSYHVLGHHHILTDNLTLLKEPS-WTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKL-------LCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDIL-DEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRIKR---------QFRKTGDQDE---NIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREIEHLKSQLTNVYDVENLGISSQS 3079
            L++G  FP+S + A   G +   AA +AL+ VNN +DILP+++L M +K+S+C     +    +L+      +M L   CS VT  +AE +   NL+ +++ + S  LSNR ++P+ FRT PS S +N  R+  ++++GWK ++L++E    ++   + +     +K+LN ++V  Q  Q     + L L++L   DARII+G FYE+ AR++FC+A+K GLYGA+ VW++IG Y   WW   +  +G++CT +EM                        K A+ G ++  + SL+ +N D     F  L S   +    N+ +  W       +  L+ EK S  LTK   + +            AP     AYDA+W IA AL++    ++    S+  F    Q  E++     A+    F G++  V F + G+R       ++   +G+   +G+++     + L+ + + W   ++P D    + Q   +PL +YI  C +  + I+ G+V + F       ++K   K  +KL       +  +GC+L    + L G D   S K+ + T     C L + F     ++   +     W V+++ T+ KK+                  ++DK                 ++ GMLG   + DV++L  W    P SR  +     +    D D  +  + E C   +   WL   + +  L+L+ GL L++ETR I      D+R  G++VYNVV+L  I  P+S +   + +A F  +   IL  + ++L +++IP++           Q  K  D +     +I     +     E     ++  +N +L+ +IS ++ E + LK QL  + D +N  I+SQS
Sbjct:   21 LYVGGFFPLSPNKASVPGHALLAAAKLALSHVNN-SDILPNHDLRMIIKNSKCDPAYTANAFIDLLMDERPSLMILGAACSDVTEILAELSAYRNLVQVSYASRSLVLSNRDKYPTLFRTLPSESARNLARVNWIEQFGWKNIALLYEKTSSDLAGQSNNQVIEELKKLNCSVVLSQ--QISDNQLDLDLQTLTRNDARIIVGTFYERKARQIFCQAFKSGLYGARYVWLLIGTYSYRWWA--VPDNGVDCTVQEMQAAVAYSFIFNNQIFLGEDEQGNAKRAISGVVSYASRSLVLSNRDKYPTLFRTLPSESAR----NLARVNWIEQFGWKNIALLYEKTSSDLTKAEYFKQYQSYLQADNITTAPNITAYAYDAVWVIAAALNQTIPVIQRMGKSMENFTIDPQITEVFLS---AIQNIQFQGITGEVEFFNDGDRYDGIVEILQHYPDGTAVTVGYYYPREREVRLIGKGNLWPEGKVPLDRTIKVRQFIKIPLWLYIFVCLMGSLGIVLGLVFLAF-------NIKYRNKRYIKLSSPNLNNVVILGCILIYSTVFLYGLDGRVSDKVFTATCRARFCLLSLGFTIGFGAMFSKT-----WRVHQIFTNVKKVKK---------------VVRDK-----------------DLFGMLGVIVLIDVLLLSLWMALHPPSRKVIVLEGSRKFSKDRDHEFVMHREECTGPHSLPWLVTFYAFHSLLLVFGLFLAFETRKISVPVLNDSRFIGISVYNVVLLCAIGVPLSHVSSSEPAAGFALICAVILFCTTVTLSVLFIPKVPDVIVVIMMVIQMWKDPDGNPLHGTMIPGRGQMSSTGNELSVVEQFSNKNSRLEAEISTLKLENKQLKRQLP-MNDGDNHQINSQS 857          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Nematostella
Match: EDO46609 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPP5])

HSP 1 Score: 213.772 bits (543), Expect = 2.923e-57
Identity = 212/778 (27.25%), Postives = 366/778 (47.04%), Query Frame = 2
Query:  611 KQLHIGAVFPMSGDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDS-QCIAGLGSRMMYELIYTPPVKIMFLTGCSTVTTF-VAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEME-EVFSSTIHDFEMSVKEL---NITIVKRQPLQ-KHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWY-PDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDS-SGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYF--VHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKD--KQSAHFVFVXXXXXXXXXXXXXXXYIPRIKRQFRKTGDQDENIIS 2905
            K+LH+GA  P S     G   R A  +A+  +NN++DIL  + + +   D+     G   + ++  I  PP K+M +    T     VAEAA  WNL+ +++ + SP   N  ++ + +R  PS+   +  ++  +K +GW++V++I E   E+FS T     + VKEL   NI+++  +  Q K    V   +  LKN D+RIIIG F +  A+KVFCEAYK G+YG + VW++ G   P    +     + ++C+ +E+K A++G   T  L    DD  T SG+T+ +F    I  ++ + +  E   S                      A+D++W+ A+ LD+A+   K+  +   +F Y+   +       R +    F GV+  V F   S  R+    I Q+ N S+  +G H   +D+L L  +  W   R P+D    I +    PL + +    L  I  +  +  +YF  VHR   S   +  +L   ++  +GCLL    ++L G D     +  +   +   C  +   + +GFSL +G++F   W V+++ T  K L                  I+D  L                  G++ +  + D+  L  W  FD L   K+ F+ +    + D  Y P +  C C +   +L +++ +KG++L+ GL L++ETRN+      D++  GM+VYNVV LS I A V+  +       A +   S  +++ +  +L L+++P++   F  + DQ  N+ +
Sbjct:   72 KELHLGAFVPYSEIDRFGF--RAAMELAVEMINNRSDILGGHKMVLHYADTFYGDGGRAVKALFNFIMQPPNKVMLIGPARTDALMPVAEAAVNWNLLQISYASLSPMFGNNRKYRNTYRIVPSSESNSKAKVSFIKNFGWERVAIIHEYSAEMFSLTA---SILVKELVQNNISVIAVEGFQQKEDTDVSFQINKLKNMDSRIIIGEFSKNGAQKVFCEAYKHGIYGPRYVWIVFGHLDPLLILEIQPHVNHVSCSREELKEALQGVFATAQLDLRQDDNTTISGMTATQF----IRTMQAEKKKSETYTS---------------------FAFDSVWSAAVTLDEAS---KTSNIHPDKFNYNGTAHA--SGFRRILEGINFEGVTGPVRFSGESRERVGTVMIMQLQNESWVTIGQHFTYSDSLDLFHKIEWQGGRPPKDRTLEIEELLLNPLPLIVVTWLLAGIGALLSIFFLYFNVVHRGNRSIKMSSPQLNNFII--LGCLLCYASVVLFGLDG----RFLTLERYGFSCNARTTVLSIGFSLSFGAMFSKTWRVHKIFTAAKTL--------------KKMAIRDIHL-----------------FGIVAALVIIDIWYLSIWFGFDSLKATKIRFDDQAR-KEHDKIYIPVLYQCTCTHKTYFLAVLYAYKGILLLFGLFLAWETRNVTIPALNDSKYIGMSVYNVVTLSCIGAIVTTALDGTIHYQAPYAITSLCLIICTTATLLLVFVPKVYNYFTGSDDQAFNVTT 776          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Nematostella
Match: EDO47553 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM77])

HSP 1 Score: 183.726 bits (465), Expect = 1.406e-48
Identity = 180/718 (25.07%), Postives = 319/718 (44.43%), Query Frame = 2
Query:  617 LHIGAVFPMS---GDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFL-TGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLG-----HHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCI-----YFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVV 2728
            L+IG    ++   G W  G    PA  +AL  +N    +L    L + +KDS+C      + + E I      +M +  GCS     +A A   WNL+ +A+ A +P LS++  FP F+R +   ++ N   + +LK++ W +V+++ E   VF+      ++ ++  NI+++       +   V   +  LK KDARIII L YE   RK+ C A++ G YG  +VW++ GWY +DW K       + C+ +E++ A   +I  E ++ +     T +GLT     D+L  +   Q RN    I+                 + A   YDA+W +A+AL++    LK   ++L  F Y      I   ++ +  +T F G+S  V F  +G+RIS   IEQ  +     +G     H     D +     PS      P     ++     L +++    C  + +  +  ++ I      F+   +P     +  +   ++C    +L    + L  +D +    I S  L+++ C   +AF         G++F+  W VY++ T+ K          + G + D                         ++ ML      D++ L  W+  D L + ++   Q ++  ++     P    C C +  +WLG ++ +KGL++I GL L++ETRN+ +    D+R  G++VYNVV+
Sbjct:    9 LYIGGFIDLNTTNGGWNSG-GVYPAIELALQHINQDQSLLQGIKLELVIKDSRCSDAYAIKTLVEHITADHTVVMLIGPGCSIAAEPIAIAGKFWNLVQVAYAAGTPRLSDKTLFPLFYRVNAPETVANLAIVAMLKKFKWSRVAIVKEDVAVFNDVSEGLQLLLRRENISLIGANSFITNPDNV---ITDLKQKDARIIIVLTYEGKCRKLMCSAFRHGFYGKHIVWLLRGWYVEDWSKV---VTDVTCSPQEVQSAHGNYIAFEEVILSTSTEKTINGLT----PDQLNKLYLRQARNISYPIN-----------------SYAAYGYDAMWVVALALNRTNTLLKESGLTLHNFTY--DNKYIASIINESTAKTRFFGMSGEVAFLDNGDRISSMWIEQFQDDGEIRVGVFDATHGDTGVDRINGSPPPSE-----PVTITEIVLIEMPLFVTMATIACAGIFLSTLFLILNIKNRQRTFIRMSSP--YLNNFIIAGSIMCYTCVILFGVDVFLDESDHVIHSAICSFRLWLLSCGYTLAF---------GTMFIKTWRVYKIFTNHK-------LDKQLGRLHDR-----------------------HLVCMLALMLSVDLLFLSVWQAVDGL-KTEIRNVQTENGRNKITILMPVFLACTCTHKLIWLGCLYTYKGLLMIFGLFLAWETRNVSYPALNDSRYIGLSVYNVVI 649          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Medaka
Match: gabbr1b (gamma-aminobutyric acid type B receptor subunit 1 [Source:NCBI gene;Acc:101172346])

HSP 1 Score: 504.597 bits (1298), Expect = 7.007e-163
Identity = 313/810 (38.64%), Postives = 473/810 (58.40%), Query Frame = 2
Query:  617 LHIGAVFPMSGDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRIKRQFRK---TGDQDENIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREIEHLKSQLT 3037
            L+IGA+FPMSG W GG +C PA  MAL  VN +TDILPDY L +   DS C  G  ++++Y+L+YT P+K++ + GCS+V+T VAEAA  WNLIV+++G+SSPALSNR RFP+FFRTHPSA+L NPTR++L ++W W K++ I +  EVF+ST+ D E   KE  I I  RQ          +A+K+LK +DARII+GLFYE  ARKVFCE YK  LYG K VW +IGWY D+W+K  +K   INCT ++M  AVEGH+TTE +M N +     S LTS++F  +L++ L    +NPE                +  G+ EAPLAYDA+WA+A+AL+K    LK++   L +F Y+ +  +I  E++RAMN + F GVS  V FD+ G+R++WT IEQ+  GSY  +G++     NL+      W     P D   +I + R L   +++      ++ I+ G+VC+ F    +      + +  L  + ++GC++ +  +  LG D +   +      F V+CQ ++  + LGFSL YGS+F  IW V+ V T + +    R                                +SW++   +G     DV++L+ W+  DPL      F +E    D D+  QP +E C    +  WLG+++G+KGL+L+LG+ L+YET++I      D R+ GMA+YNV VL LITAPV++++  +Q A F F S +I+ +  ++L +++IP+++R   +     D  E + S   T      +EE+  +   EN++L++ I + E  +  L++QL+
Sbjct:   30 LYIGALFPMSGGWPGGQACLPATQMALQLVNKRTDILPDYELELIHYDSMCDPGEATKLLYDLLYTEPIKVVLMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVQLFQKWKWTKIATIQQTTEVFTSTLDDLEERTKEAGIDISVRQSFLTDPA---VAVKNLKRQDARIIVGLFYETEARKVFCEVYKEKLYGKKYVWFLIGWYADNWFK--IKDPSINCTLEQMSEAVEGHVTTEIVMLNPETVRGASKLTSQEFLTQLMSKLGG--KNPE----------------ETGGFQEAPLAYDAVWALALALNKTVGPLKARGYRLEDFNYNNR--DITSEIYRAMNTSSFEGVSGHVVFDAQGSRMAWTLIEQLQGGSYKKIGYYDSTKGNLSWYGNDKWIGQGPPADQTVVIEEFRYLSQRLFVSMSVFAVVGILLGIVCLTFNIYNSRVRYIQNSQPYLNNMTAVGCMMALAAVFPLGIDGLHVHRRH----FPVVCQFRLWLIGLGFSLAYGSMFTKIWWVHTVFTKKDEKKEKR-----------------------------KHLDSWKLYATVGVLLSVDVLLLMIWQIVDPLHVTVEKFTREAPKEDLDVLIQPLLEHCSSEKMTTWLGVVYGYKGLLLLLGIFLAYETKSISTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDASFAFASLAIIFSVYITLVVLFIPKMRRLITRGEWQSDAQETVKSGSST---NNHDEEKSRQLERENQELEKIIQEKEERVSELRNQLS 778          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Medaka
Match: gabbr1b (gamma-aminobutyric acid type B receptor subunit 1 [Source:NCBI gene;Acc:101172346])

HSP 1 Score: 486.878 bits (1252), Expect = 1.297e-156
Identity = 304/784 (38.78%), Postives = 459/784 (58.55%), Query Frame = 2
Query:  617 LHIGAVFPMSGDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRIKRQFRKTGDQDENIISDDETIQLRK-----TEEEQHN 2953
            L+IGA+FPMSG W GG +C PA  MAL  VN +TDILPDY L +   DS C  G  ++++Y+L+YT P+K++ + GCS+V+T VAEAA  WNLIV+++G+SSPALSNR RFP+FFRTHPSA+L NPTR++L ++W W K++ I +  EVF+ST+ D E   KE  I I  RQ          +A+K+LK +DARII+GLFYE  ARKVFCE YK  LYG K VW +IGWY D+W+K  +K   INCT ++M  AVEGH+TTE +M N +     S LTS++F  +L++ L    +NPE                +  G+ EAPLAYDA+WA+A+AL+K    LK++   L +F Y+ +  +I  E++RAMN + F GVS  V FD+ G+R++WT IEQ+  GSY  +G++     NL+      W     P D   +I + R L   +++      ++ I+ G+VC+ F    +      + +  L  + ++GC++ +  +  LG D +   +      F V+CQ ++  + LGFSL YGS+F  IW V+ V T + +    R                                +SW++   +G     DV++L+ W+  DPL      F +E    D D+  QP +E C    +  WLG+++G+KGL+L+LG+ L+YET++I      D R+ GMA+YNV VL LITAPV++++  +Q A F F S +I+ +  ++L +++IP+ + +  +  +Q    +S+   ++ RK     T+ + H+
Sbjct:   30 LYIGALFPMSGGWPGGQACLPATQMALQLVNKRTDILPDYELELIHYDSMCDPGEATKLLYDLLYTEPIKVVLMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVQLFQKWKWTKIATIQQTTEVFTSTLDDLEERTKEAGIDISVRQSFLTDPA---VAVKNLKRQDARIIVGLFYETEARKVFCEVYKEKLYGKKYVWFLIGWYADNWFK--IKDPSINCTLEQMSEAVEGHVTTEIVMLNPETVRGASKLTSQEFLTQLMSKLGG--KNPE----------------ETGGFQEAPLAYDAVWALALALNKTVGPLKARGYRLEDFNYNNR--DITSEIYRAMNTSSFEGVSGHVVFDAQGSRMAWTLIEQLQGGSYKKIGYYDSTKGNLSWYGNDKWIGQGPPADQTVVIEEFRYLSQRLFVSMSVFAVVGILLGIVCLTFNIYNSRVRYIQNSQPYLNNMTAVGCMMALAAVFPLGIDGLHVHRRH----FPVVCQFRLWLIGLGFSLAYGSMFTKIWWVHTVFTKKDEKKEKR-----------------------------KHLDSWKLYATVGVLLSVDVLLLMIWQIVDPLHVTVEKFTREAPKEDLDVLIQPLLEHCSSEKMTTWLGVVYGYKGLLLLLGIFLAYETKSISTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDASFAFASLAIIFSVYITLVVLFIPKKEERVSELRNQ----LSERHALRTRKPPSTITQNQNHS 751          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Medaka
Match: ENSORLT00000020060.2 (pep primary_assembly:ASM223467v1:16:27948053:28004636:1 gene:ENSORLG00000016024.2 transcript:ENSORLT00000020060.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 386.726 bits (992), Expect = 7.293e-122
Identity = 204/428 (47.66%), Postives = 284/428 (66.36%), Query Frame = 2
Query:  608 EKQLHIGAVFPMSGDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSW 1891
            +K+L+IGA+FPMSG W GG +C P+A MAL+ VNN++DILPDY L +   DS C  G  ++++Y+L+YT P+KI+ + GCS V+T VAEAA  WNLIV+++G+SSPALSNR RFP+FFRTHPSA+L NPTR++L ++W W +++ I +  EVF+ST+ D E  VKE  I I  RQ          +A+K+LK +DARII+GLFYE  ARKVFCE YK  LYG K VW +IGWY D+W+K  +K   INCT + M  AVEGH+TTE +M N +     S +TS++F   L++ L    +NPE                +  G+ EAPLAYDA+WA+A+AL+K    LK++   L +F Y+   ++I  E++RA+N + F GVS  V FD+ G+R++ T IEQ+  GSY  +G++     NL+      W
Sbjct:  143 KKKLYIGALFPMSGGWPGGQACMPSAQMALDLVNNRSDILPDYELELIHYDSMCDPGEATKLLYDLLYTEPIKIVLMPGCSGVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVQLFQKWKWTRIATIQQTTEVFTSTLDDLEQRVKEAGIEISVRQSFLTDPA---VAVKNLKRQDARIIVGLFYETEARKVFCEVYKEKLYGKKYVWFLIGWYADNWFK--IKDPAINCTAENMAEAVEGHVTTEIVMLNPETVRGVSNMTSQEFLAALMSRLGG--KNPE----------------ETGGFQEAPLAYDAVWALALALNKTVAPLKARGRRLEDFNYN--NHDITSEIYRALNTSSFEGVSGQVVFDAQGSRMAMTLIEQLQGGSYKKIGYYDSSQKNLSWFGNDVW 545          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Medaka
Match: gabbr2 (gamma-aminobutyric acid type B receptor subunit 2 [Source:NCBI gene;Acc:101162936])

HSP 1 Score: 259.996 bits (663), Expect = 3.316e-72
Identity = 217/830 (26.14%), Postives = 397/830 (47.83%), Query Frame = 2
Query:  611 KQLHIGAVFPMS-GDWAGGIS--CRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTG-CSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISE--GLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEP-SWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRI------------KRQFRKTGDQ-DENIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREIEHLKSQLTN 3040
            + L I  + PM+      GIS    PA  +A+  +         ++L   + D++C    G R  ++ I   P  +M   G C +VT+ +AE+   WNL+ ++F A++P L+++ ++P+FFRT PS +  NP  +K L    W +V  + +  + FS   +D    +++  I I   +     S    + +K LK+ D RIIIG F E LA KVFC AY L ++G+K  W+I GWY  +WW+   + +  NCT K++  A+EG+I+           V F  L+SR  K           R P+    E  G +++K  + +K  G+A     YD IW IA  L +  + L+ K+       + +   E+ + +   MNET F GV+  V F  +G R+   +  Q   G    +G ++ + D L L+     +     P+D   +  QRR + + +Y     + ++ ++     ++F  +     +       +  L  +G +L+   I L G D        S  +F  LC ++   + +G++  +G++F   W V+ +  + K        K K         IKD+ L I                 ++G   + D+ +L+ W+  DPL R    ++ E D    D+   P++E C+  ++ +WLGI++ +KGL+++ G  L++ETRN+      D++  GM+VYNV ++ +I A VS + +D+ +  F  V+  I+  S ++L L+++P++             R+ + T +Q  E+  +      + +    + +   T+N +L+ +I+++++E+E +  QL +
Sbjct:   44 ENLPIMVLMPMNESALMSGISQGIEPAVQLAIQHIRESRKY--SFSLITKIYDTECDNAKGLRAFFDAICYGPKHLMIFGGVCPSVTSIIAESLEGWNLVQLSFAATTPVLADKKKYPNFFRTVPSDNAVNPAVVKFLNYHNWTRVGTLTQDVQRFSEVRNDLTNELEKAEIQIADTESF---SNDPCVNVKKLKDNDVRIIIGQFDENLASKVFCCAYNLNMFGSKYQWIIPGWYQGNWWE---QANNTNCTTKKLLTAMEGYIS-----------VDFEPLSSRPIKGI-------SGRTPKEYEREYSGELQQKGVESSKFHGFA-----YDGIWVIAKTLTRVRELLRIKQRQNIYHNFTVDDREVGKMVLDVMNETNFYGVTGQVMF-RNGERMGTIKFNQFQEGREVKVGEYNAIADVLDLINNAIKFQGVEPPKDRTIVRPQRRHINVPLYSILSTITILGMLMAGAFLFFNIKNRNHRLIKMSSPYMNNLIILGGMLSYASIFLFGLDG----GFVSERVFETLCTVRTWILIVGYTTAFGAMFAKTWRVHAIFKNVK-------MKKKI--------IKDQKLLI-----------------IVGGMLLIDLCILICWQIVDPLRRTVEEYSLEADPQGRDLAILPFLEHCENTHMTIWLGIVYAYKGLLMLFGCFLAWETRNVSIPALNDSKYIGMSVYNVGIMCIIGAAVSFLTRDQPNVQFCIVALVIIFCSTITLCLVFVPKLITMRTNPDAATQNRRLKFTQNQKKEDSKTSTSVTSVNQANTSRLDGLQTDNHRLRMRITELDKELEEVTMQLQD 805          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Medaka
Match: gabbr2 (gamma-aminobutyric acid type B receptor subunit 2 [Source:NCBI gene;Acc:101162936])

HSP 1 Score: 259.61 bits (662), Expect = 5.083e-72
Identity = 217/830 (26.14%), Postives = 397/830 (47.83%), Query Frame = 2
Query:  611 KQLHIGAVFPMS-GDWAGGIS--CRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTG-CSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISE--GLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEP-SWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRI------------KRQFRKTGDQ-DENIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREIEHLKSQLTN 3040
            + L I  + PM+      GIS    PA  +A+  +         ++L   + D++C    G R  ++ I   P  +M   G C +VT+ +AE+   WNL+ ++F A++P L+++ ++P+FFRT PS +  NP  +K L    W +V  + +  + FS   +D    +++  I I   +     S    + +K LK+ D RIIIG F E LA KVFC AY L ++G+K  W+I GWY  +WW+   + +  NCT K++  A+EG+I+           V F  L+SR  K           R P+    E  G +++K  + +K  G+A     YD IW IA  L +  + L+ K+       + +   E+ + +   MNET F GV+  V F  +G R+   +  Q   G    +G ++ + D L L+     +     P+D   +  QRR + + +Y     + ++ ++     ++F  +     +       +  L  +G +L+   I L G D        S  +F  LC ++   + +G++  +G++F   W V+ +  + K        K K         IKD+ L I                 ++G   + D+ +L+ W+  DPL R    ++ E D    D+   P++E C+  ++ +WLGI++ +KGL+++ G  L++ETRN+      D++  GM+VYNV ++ +I A VS + +D+ +  F  V+  I+  S ++L L+++P++             R+ + T +Q  E+  +      + +    + +   T+N +L+ +I+++++E+E +  QL +
Sbjct:   53 ENLPIMVLMPMNESALMSGISQGIEPAVQLAIQHIRESRKY--SFSLITKIYDTECDNAKGLRAFFDAICYGPKHLMIFGGVCPSVTSIIAESLEGWNLVQLSFAATTPVLADKKKYPNFFRTVPSDNAVNPAVVKFLNYHNWTRVGTLTQDVQRFSEVRNDLTNELEKAEIQIADTESF---SNDPCVNVKKLKDNDVRIIIGQFDENLASKVFCCAYNLNMFGSKYQWIIPGWYQGNWWE---QANNTNCTTKKLLTAMEGYIS-----------VDFEPLSSRPIKGI-------SGRTPKEYEREYSGELQQKGVESSKFHGFA-----YDGIWVIAKTLTRVRELLRIKQRQNIYHNFTVDDREVGKMVLDVMNETNFYGVTGQVMF-RNGERMGTIKFNQFQEGREVKVGEYNAIADVLDLINNAIKFQGVEPPKDRTIVRPQRRHINVPLYSILSTITILGMLMAGAFLFFNIKNRNHRLIKMSSPYMNNLIILGGMLSYASIFLFGLDG----GFVSERVFETLCTVRTWILIVGYTTAFGAMFAKTWRVHAIFKNVK-------MKKKI--------IKDQKLLI-----------------IVGGMLLIDLCILICWQIVDPLRRTVEEYSLEADPQGRDLAILPFLEHCENTHMTIWLGIVYAYKGLLMLFGCFLAWETRNVSIPALNDSKYIGMSVYNVGIMCIIGAAVSFLTRDQPNVQFCIVALVIIFCSTITLCLVFVPKLITMRTNPDAATQNRRLKFTQNQKKEDSKTSTSVTSVNQANTSRLDGLQTDNHRLRMRITELDKELEEVTMQLQD 814          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Planmine SMEST
Match: SMESG000036774.1 (SMESG000036774.1)

HSP 1 Score: 1784.62 bits (4621), Expect = 0.000e+0
Identity = 915/918 (99.67%), Postives = 917/918 (99.89%), Query Frame = 2
Query:  569 MIIFYVDIVDNFKEKQLHIGAVFPMSGDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRIKRQFRKTGDQDENIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREIEHLKSQLTNVYDVENLGISSQSIVAIHGGFSSYENLNHPKNNSFNRKKLKITGKIKSERKTLLKHSFLTKQQTIALEKEFNDKFSGAMESTSGVYSEFGMISI 3322
            MIIFYVDIVDNFKEKQLHIGAVFPMSGDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTRLKLLKRWGWKKVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVW+IIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRL+NMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCLGFSLGYGSLFLSIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDI DEDIHYQPYMEICDCRNLGLWLGIIFGWKGLVLILGLLLSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVSTSILLTSALSLGLIYIPRIKRQFRKTGDQDENIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREIEHLKSQLTNVYDVENLGISSQSIVAIHGGFSSYENLNHPKNNSFNRKKLKITGKIKSERKTLLKHSFLTKQQTIALEKEFNDKFSGAMESTSGVYSEFGMISI
Sbjct:    1 MIIFYVDIVDNFKEKQLHIGAVFPMSGDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTRLKLLKRWGWKKVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWIIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLLNMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCLGFSLGYGSLFLSIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDIFDEDIHYQPYMEICDCRNLGLWLGIIFGWKGLVLILGLLLSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVSTSILLTSALSLGLIYIPRIKRQFRKTGDQDENIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREIEHLKSQLTNVYDVENLGISSQSIVAIHGGFSSYENLNHPKNNSFNRKKLKITGKIKSERKTLLKHSFLTKQQTIALEKEFNDKFSGAMESTSGVYSEFGMISI 918          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Planmine SMEST
Match: SMESG000036774.1 (SMESG000036774.1)

HSP 1 Score: 1733.77 bits (4489), Expect = 0.000e+0
Identity = 891/894 (99.66%), Postives = 893/894 (99.89%), Query Frame = 2
Query:  641 MSGDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRIKRQFRKTGDQDENIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREIEHLKSQLTNVYDVENLGISSQSIVAIHGGFSSYENLNHPKNNSFNRKKLKITGKIKSERKTLLKHSFLTKQQTIALEKEFNDKFSGAMESTSGVYSEFGMISI 3322
            MSGDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTRLKLLKRWGWKKVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVW+IIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRL+NMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCLGFSLGYGSLFLSIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDI DEDIHYQPYMEICDCRNLGLWLGIIFGWKGLVLILGLLLSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVSTSILLTSALSLGLIYIPRIKRQFRKTGDQDENIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREIEHLKSQLTNVYDVENLGISSQSIVAIHGGFSSYENLNHPKNNSFNRKKLKITGKIKSERKTLLKHSFLTKQQTIALEKEFNDKFSGAMESTSGVYSEFGMISI
Sbjct:    1 MSGDWAGGISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTPPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTRLKLLKRWGWKKVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWIIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLLNMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCLGFSLGYGSLFLSIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDIFDEDIHYQPYMEICDCRNLGLWLGIIFGWKGLVLILGLLLSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVSTSILLTSALSLGLIYIPRIKRQFRKTGDQDENIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREIEHLKSQLTNVYDVENLGISSQSIVAIHGGFSSYENLNHPKNNSFNRKKLKITGKIKSERKTLLKHSFLTKQQTIALEKEFNDKFSGAMESTSGVYSEFGMISI 894          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Planmine SMEST
Match: SMESG000036774.1 (SMESG000036774.1)

HSP 1 Score: 1548.87 bits (4009), Expect = 0.000e+0
Identity = 804/807 (99.63%), Postives = 806/807 (99.88%), Query Frame = 2
Query:  902 MAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRIKRQFRKTGDQDENIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREIEHLKSQLTNVYDVENLGISSQSIVAIHGGFSSYENLNHPKNNSFNRKKLKITGKIKSERKTLLKHSFLTKQQTIALEKEFNDKFSGAMESTSGVYSEFGMISI 3322
            MAFGASSPALSNRARFPSFFRTHPSASLQNPTRLKLLKRWGWKKVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVW+IIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRL+NMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCLGFSLGYGSLFLSIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDI DEDIHYQPYMEICDCRNLGLWLGIIFGWKGLVLILGLLLSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVSTSILLTSALSLGLIYIPRIKRQFRKTGDQDENIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREIEHLKSQLTNVYDVENLGISSQSIVAIHGGFSSYENLNHPKNNSFNRKKLKITGKIKSERKTLLKHSFLTKQQTIALEKEFNDKFSGAMESTSGVYSEFGMISI
Sbjct:    1 MAFGASSPALSNRARFPSFFRTHPSASLQNPTRLKLLKRWGWKKVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWIIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLLNMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEPSWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCLGFSLGYGSLFLSIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDIFDEDIHYQPYMEICDCRNLGLWLGIIFGWKGLVLILGLLLSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVSTSILLTSALSLGLIYIPRIKRQFRKTGDQDENIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREIEHLKSQLTNVYDVENLGISSQSIVAIHGGFSSYENLNHPKNNSFNRKKLKITGKIKSERKTLLKHSFLTKQQTIALEKEFNDKFSGAMESTSGVYSEFGMISI 807          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Planmine SMEST
Match: SMESG000036762.1 (SMESG000036762.1)

HSP 1 Score: 560.451 bits (1443), Expect = 0.000e+0
Identity = 283/289 (97.92%), Postives = 287/289 (99.31%), Query Frame = 2
Query:  902 MAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYF 1768
            MAFGASSPALSNRARFPSFFRTHPSASLQNPTRLKLLKRWGWKKVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVW+IIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVS  +++
Sbjct:    1 MAFGASSPALSNRARFPSFFRTHPSASLQNPTRLKLLKRWGWKKVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWIIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSVSLFY 289          
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Planmine SMEST
Match: SMESG000049232.1 (SMESG000049232.1)

HSP 1 Score: 130.183 bits (326), Expect = 2.245e-30
Identity = 197/864 (22.80%), Postives = 389/864 (45.02%), Query Frame = 2
Query:  692 ALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYTP-PVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFRTHPSASLQNPTXXXXXXXXXXXXVSLIWEMEEVFSSTIHDFEMSVKELNITIVKRQPLQKHSQAVY----LALKSLKNKDARIIIGLFYEKLARKVFCEAYKLGLYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMWNNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKISGYAEAPLAYDAIWAIAIALDKAAKRL-KSKKVSLSEFEYHIQPNEIYEELHRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDNLTLLKEP-SWTNSRIPRDSVALIFQRRALPLSIYIGF-----CCLVLICIISGVVCIYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKSNTLFMVLCQLKVAFVCXXXXXXXXXXXXXIWIVYRVATDRKKLTTDRCTKNKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLLAWRYFDPLSRYKVYFNQEKDI-LDEDIHYQPYMEICDCRNLGLWLGIIFGWKXXXXXXXXXXSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMIKDKQSAHFVFVXXXXXXXXXXXXXXXYIPRI-------------KRQFRKTGDQDENIISDDETIQLRKTEEEQHNKYFTENEQLKRQISQIEREIEHLKSQLTNVYDVENLGISSQSIVAIHGGFSSY-ENLNHPKNNSFNRKKL-KITGKIKSERKTL 3199
            AL  +NN + IL    L +    ++C     +     L+ +   + I+F  GC  +T  ++E +  WN+  + +  +   LS++ ++P+  RT  S    N   + +LKR+ W +V ++++ E  +  T  +  ++   ++   ++++  + +S   +      L +LK  + RII+G+F ++L  +V C+AY  GL G   VW+I G     +++   +     C +K   +  + H   + L   +++  + S LT  ++                      +I    S  T    +A    A+DA+W IA+AL++  + L +S+K+ + EF     P +I                       S G R     + Q ING+Y+ +G+ + + D+L L+ +   W + +IP D   ++ + +++ + IY+ F     C +V   I+ G+   +  HR    S      + +     IG +L+   +I+LG  R  ++  +S     V+C +K   +CLGF+L +G++F   W V+++ T+         + NK   I DS                       ++IGM+    + DVV+L      DP+ + K+  + E  I L+ +I Y  + E C      +W+G+I+  KGL+L +G  L +ETR +      D++  G++VY VV++    A V+ +I+D    +F+ +++ I+L++ ++L L+++P++             K+   +   +  N  S  +++      +    K   E E++K  + Q   EI     +  N +    L +   S ++I      + +N + P N   N K + K  G+   +R ++
Sbjct:   64 ALEIINNSSVILAKKKLKVVYTVTECKMPRATEQFLNLMNSSVKINIIFGCGCYELTGALSEISSYWNITQITYSDTDFTLSSKNKYPNLIRTVVSDYCFNFASIAMLKRFNWTRVGILYQDEVSYLRTSSNALVNAHLVHE--MEKKGYKPYSFGFFNDPTKGLVNLKRLNVRIIMGIFQQRLNEEVLCKAYTEGLIGRNYVWIIFG-QGQTFFESSKEDVQAKCNKK---IVYQYHFVLDYLQIWSENKKSVSNLTPNEY--------------------SAMITGSSSSNTTTIFHA---YAFDAVWGIALALNERERLLDRSEKLVIPEFFGITGPFKI-----------------------SKGERNCLVNVRQYINGNYNYIGYFNDIEDDLHLMNDTLIWPHGQIPSDRSKIVRKWKSINIIIYVIFIAITSCGIVFAFILMGINIKFRKHRYIKMSSPNMNNIII-----IGSVLSYVSVIILGTSR--TIVGESKFAMRVICSMKAWTLCLGFTLSFGAMFSKTWRVHQIFTN--------ISLNK-KVIRDS-----------------------KLIGMVCFLLLLDVVILSLQTIIDPV-QLKIQNSTEISIELNIEIIY--FWEFCSSEKQSIWVGVIYAHKGLLLAIGCFLVWETRQVNIPALNDSKHIGLSVYMVVIMCASGAAVNAVIQDSIDFNFIIIASFIILSTTITLSLVFLPKLIQIKNDPKGISKRKQATVRKSSKYSNECSKAQSVHTETIIKGLLMKRLAEKEKIKSDLEQSISEIRKKNLKKKNSFSNVLLNLRKSSTISIAKSSDQHSDNSSKPSNTFVNHKAVDKDNGQDGCKRNSI 833          
The following BLAST results are available for this feature:
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GABBR18.878e-16540.00gamma-aminobutyric acid type B receptor subunit 1 ... [more]
GABBR18.878e-16540.00gamma-aminobutyric acid type B receptor subunit 1 ... [more]
GABBR18.878e-16540.00gamma-aminobutyric acid type B receptor subunit 1 ... [more]
GABBR18.878e-16540.00gamma-aminobutyric acid type B receptor subunit 1 ... [more]
GABBR18.878e-16540.00gamma-aminobutyric acid type B receptor subunit 1 ... [more]
back to top
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gbb-11.064e-14136.17Gamma-aminobutyric acid type B receptor subunit 1 ... [more]
gbb-11.346e-14036.34Gamma-aminobutyric acid type B receptor subunit 1 ... [more]
gbb-12.068e-13935.20Gamma-aminobutyric acid type B receptor subunit 1 ... [more]
gbb-14.498e-11138.85Gamma-aminobutyric acid type B receptor subunit 1 ... [more]
gbb-21.443e-3623.54Gamma-aminobutyric acid type B receptor subunit 2 ... [more]
back to top
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GABA-B-R11.083e-17839.35gene:FBgn0260446 transcript:FBtr0304732[more]
GABA-B-R11.083e-17839.35gene:FBgn0260446 transcript:FBtr0304731[more]
GABA-B-R36.439e-5926.92gene:FBgn0031275 transcript:FBtr0343787[more]
GABA-B-R36.439e-5926.92gene:FBgn0031275 transcript:FBtr0343785[more]
GABA-B-R36.439e-5926.92gene:FBgn0031275 transcript:FBtr0078001[more]
back to top
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gabbr1b7.023e-16638.50gamma-aminobutyric acid (GABA) B receptor, 1b [Sou... [more]
gabbr1b9.365e-16638.50gamma-aminobutyric acid (GABA) B receptor, 1b [Sou... [more]
gabbr1a3.904e-16438.92gamma-aminobutyric acid (GABA) B receptor, 1a [Sou... [more]
gabbr1a5.414e-14237.34gamma-aminobutyric acid (GABA) B receptor, 1a [Sou... [more]
gabbr21.800e-7326.00gamma-aminobutyric acid (GABA) B receptor, 2 [Sour... [more]
back to top
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tonsl3.506e-16138.96tonsoku like, DNA repair protein [Source:Xenbase;A... [more]
tonsl5.591e-16138.96tonsoku like, DNA repair protein [Source:Xenbase;A... [more]
tonsl1.895e-16039.08tonsoku like, DNA repair protein [Source:Xenbase;A... [more]
tonsl3.014e-16038.96tonsoku like, DNA repair protein [Source:Xenbase;A... [more]
tonsl5.240e-16038.96tonsoku like, DNA repair protein [Source:Xenbase;A... [more]
back to top
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Gabbr13.899e-16439.51gamma-aminobutyric acid (GABA) B receptor, 1 [Sour... [more]
Gabbr12.142e-16239.29gamma-aminobutyric acid (GABA) B receptor, 1 [Sour... [more]
Gabbr21.461e-7025.72gamma-aminobutyric acid (GABA) B receptor, 2 [Sour... [more]
Gabbr11.960e-4144.13gamma-aminobutyric acid (GABA) B receptor, 1 [Sour... [more]
back to top
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9UBS5|GABR1_HUMAN2.160e-16239.78Gamma-aminobutyric acid type B receptor subunit 1 ... [more]
sp|Q9WV18|GABR1_MOUSE1.499e-16139.29Gamma-aminobutyric acid type B receptor subunit 1 ... [more]
sp|Q9Z0U4|GABR1_RAT1.288e-15537.97Gamma-aminobutyric acid type B receptor subunit 1 ... [more]
sp|H2L0Q3|GABR1_CAEEL2.630e-13835.20Gamma-aminobutyric acid type B receptor subunit 1 ... [more]
sp|O75899|GABR2_HUMAN2.790e-7126.21Gamma-aminobutyric acid type B receptor subunit 2 ... [more]
back to top
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2Z5X7890.000e+079.78Gamma-aminobutyric acid B receptor A OS=Dugesia ja... [more]
A0A2C9JYZ80.000e+041.96G_PROTEIN_RECEP_F3_4 domain-containing protein OS=... [more]
A0A0L8H9G10.000e+042.32G_PROTEIN_RECEP_F3_4 domain-containing protein (Fr... [more]
V4CE550.000e+041.26G_PROTEIN_RECEP_F3_4 domain-containing protein OS=... [more]
A0A2T7NKE50.000e+042.10G_PROTEIN_RECEP_F3_4 domain-containing protein OS=... [more]
back to top
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gabbr1b2.312e-16838.62gamma-aminobutyric acid type B receptor subunit 1 ... [more]
gabbr1a2.817e-16638.77gamma-aminobutyric acid type B receptor subunit 1 ... [more]
gabbr1b7.337e-16638.62gamma-aminobutyric acid type B receptor subunit 1 ... [more]
gabbr1a4.297e-16338.42gamma-aminobutyric acid type B receptor subunit 1 ... [more]
gabbr1a2.937e-15737.95gamma-aminobutyric acid type B receptor subunit 1 ... [more]
back to top
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007580.12.921e-8133.51pep scaffold:Pmarinus_7.0:GL479777:49246:63453:-1 ... [more]
ENSPMAT00000010341.13.097e-5451.56pep scaffold:Pmarinus_7.0:GL478021:14492:51134:1 g... [more]
GABBR23.478e-3927.88gamma-aminobutyric acid type B receptor subunit 2 ... [more]
ENSPMAT00000007583.17.256e-2529.43pep scaffold:Pmarinus_7.0:GL479777:50633:55489:-1 ... [more]
ENSPMAT00000004054.12.733e-1026.47pep scaffold:Pmarinus_7.0:GL487958:4015:7652:1 gen... [more]
back to top
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO471117.557e-7629.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO490515.089e-7230.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO389815.114e-6126.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO466092.923e-5727.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO475531.406e-4825.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gabbr1b7.007e-16338.64gamma-aminobutyric acid type B receptor subunit 1 ... [more]
gabbr1b1.297e-15638.78gamma-aminobutyric acid type B receptor subunit 1 ... [more]
ENSORLT00000020060.27.293e-12247.66pep primary_assembly:ASM223467v1:16:27948053:28004... [more]
gabbr23.316e-7226.14gamma-aminobutyric acid type B receptor subunit 2 ... [more]
gabbr25.083e-7226.14gamma-aminobutyric acid type B receptor subunit 2 ... [more]
back to top
BLAST of gamma-aminobutyric acid type B receptor subunit 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000036774.10.000e+099.67SMESG000036774.1[more]
SMESG000036774.10.000e+099.66SMESG000036774.1[more]
SMESG000036774.10.000e+099.63SMESG000036774.1[more]
SMESG000036762.10.000e+097.92SMESG000036762.1[more]
SMESG000049232.12.245e-3022.80SMESG000049232.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021921 ID=SMED30021921|Name=gamma-aminobutyric acid type B receptor subunit 1|organism=Schmidtea mediterranea sexual|type=transcript|length=3332bp
TTTAAAACAAAATTTCAATTTTTATTCCAAAAATTTATTCCTACAAATTT
TTTTGTGCTGATATAAAATATTGATTAATTAAAATGAATGCGTTATCTGG
TAACTGCTGCATCCCGTTAAGATTGTTTGCTAATTGCAAAAAATCAGTTT
ATAGTAACCTCAATTTTCTTTAAATTCCGATCTGTTGGTATTTGTGTGGA
CACAGTTCTAAGATTTTGAATATCTATTCAATTCCAAATAATGACGATGA
TTTTGAGAATCAATGCTGTGAGACATTTTCTAAGTCAAAAAAAATAGCAG
TATAGAATAGCGTGGTTGATCTAGCGGATTTGACAGAGAACTTGCATTGG
GGAATTTATATGGAATGGTAAAAAGTAAGTATCAAAATCTAATTTAGTCC
TATAAATCTACAAGTCAAAGTTCAAAGTGACATTGCTTGACGCGTAGACT
TCCTAAACCACAAGGAGATCCGAATCAACCAGGTAGATTATTTTGCTATC
AGTACTGACAGCCAATGTTTTCTTGTATTTTTTTTTCAAATAATTATTAT
TCAAAAATATATTTTTGTATGATAATTTTTTATGTTGACATTGTTGACAA
TTTCAAAGAAAAACAACTGCATATTGGCGCTGTTTTTCCTATGAGTGGAG
ATTGGGCAGGTGGAATATCTTGTCGACCCGCTGCTATAATGGCTTTAAAT
GACGTTAATAATCAAACCGACATTCTTCCTGATTATAACTTAACGATGAC
TATGAAAGATAGCCAATGCATTGCTGGTTTAGGTTCAAGAATGATGTATG
AACTTATTTATACTCCCCCTGTTAAGATTATGTTCTTAACTGGTTGCTCT
ACTGTTACTACATTTGTTGCCGAAGCAGCTCCAAGATGGAATCTTATTGT
CATGGCGTTTGGTGCAAGTAGTCCAGCATTATCAAATAGAGCAAGATTTC
CGAGCTTTTTTCGAACTCATCCGTCGGCTTCTTTGCAAAACCCAACAAGA
CTTAAGCTTCTCAAAAGATGGGGTTGGAAAAAGGTTTCATTAATATGGGA
AATGGAAGAGGTTTTCTCTTCAACAATTCACGATTTTGAAATGAGCGTAA
AAGAGTTGAATATTACAATTGTCAAAAGGCAACCACTGCAAAAACATTCA
CAAGCAGTATATTTAGCGCTTAAATCACTTAAAAATAAAGATGCAAGAAT
AATAATTGGTCTATTTTATGAAAAATTAGCAAGAAAGGTTTTTTGTGAAG
CTTACAAGTTAGGATTATATGGTGCAAAGGTTGTATGGGTCATAATTGGT
TGGTATCCTGATGATTGGTGGAAATATCATTTAAAGAAGGATGGAATTAA
TTGCACTGAAAAAGAAATGAAAATGGCTGTTGAAGGACACATTACTACGG
AAAGTCTAATGTGGAACAACGACGACGCTGTTACATTTTCAGGACTTACA
TCGCGGAAATTCAAAGATAGACTTATAAATATGCTTAAGGATCAATGGAG
AAATCCGGAGAATAAAATTTCAGAAGGCTTAATCAAGGAGAAATTAAGTC
AATTGACGAAAATATCTGGATATGCTGAAGCACCATTAGCATATGATGCA
ATATGGGCTATAGCCATCGCTCTTGACAAAGCTGCAAAAAGATTAAAAAG
TAAAAAAGTATCATTGAGCGAGTTTGAATATCATATTCAACCAAATGAAA
TTTATGAAGAACTTCATCGAGCAATGAATGAAACTTATTTCATGGGCGTA
TCTACACTAGTTTATTTCGATTCGAGTGGAAATAGAATATCTTGGACAAG
AATTGAACAAATGATAAATGGATCCTATCACGTATTAGGACACCATCATA
TATTAACAGATAATTTAACTTTATTGAAAGAGCCATCATGGACAAATTCA
AGAATTCCCCGAGATTCAGTTGCATTGATTTTTCAACGTCGAGCACTTCC
ATTATCAATTTATATTGGATTCTGTTGTCTTGTTTTAATTTGCATTATTT
CTGGAGTAGTTTGTATTTATTTTGTTCACAGATGCGCTCCTTCATCGATG
AAAACTGACGGTAAATTAAAGTTAAAACTTCTATGCTCCATTGGCTGTTT
ATTGAATATGTTTGTAATTATCCTTTTGGGAGCTGATAGAATTTCTTCAG
TAAAAATTAAGTCAAATACTTTATTCATGGTATTATGTCAGTTGAAAGTA
GCGTTTGTATGTTTGGGATTCAGTTTGGGTTATGGATCTTTGTTTTTGAG
TATTTGGATTGTTTACCGAGTTGCCACTGACCGAAAGAAGCTGACCACTG
ATAGATGTACGAAAAACAAATGTGGTACAATTGAAGATAGTTTCCAAATT
AAAGACAAACTTTTAAAGATTGCTCCTGTGAGCAAAATTGGTGTTAAGTA
TAATTCTTGGGAAGTTATCGGAATGTTAGGATCATTTTGTATGGCAGATG
TTGTAGTATTATTAGCGTGGCGGTATTTTGACCCACTTTCTCGGTATAAA
GTGTATTTTAATCAAGAAAAAGATATATTAGACGAAGACATCCATTATCA
GCCATATATGGAAATATGTGATTGTAGAAATCTTGGACTGTGGTTAGGTA
TAATATTTGGTTGGAAAGGTTTGGTTCTAATATTGGGTCTTCTGTTATCT
TATGAAACTAGAAATATTAAATTCTCTTTTGCCATTGACACAAGATCAAC
TGGAATGGCAGTTTATAATGTTGTTGTACTTTCTCTCATTACTGCCCCAG
TATCTGTTATGATTAAAGATAAACAATCTGCTCATTTTGTGTTCGTATCT
ACTTCGATTTTATTGACTAGTGCTCTTTCTTTGGGGCTTATTTATATACC
TCGGATAAAACGACAATTCAGAAAAACAGGCGACCAAGACGAAAATATTA
TATCCGATGACGAAACTATTCAATTGCGTAAAACGGAAGAAGAGCAGCAT
AATAAATATTTTACTGAAAACGAACAATTAAAGAGACAAATATCTCAGAT
CGAAAGAGAGATCGAACACTTAAAAAGTCAGCTTACGAATGTGTATGATG
TTGAAAACCTTGGTATTTCCAGCCAATCAATCGTTGCGATTCACGGCGGA
TTTTCATCCTATGAAAATTTGAATCACCCGAAAAATAATTCGTTTAACAG
GAAAAAATTGAAAATAACTGGCAAAATTAAATCAGAACGTAAAACTTTAT
TGAAGCACTCTTTTTTAACAAAACAGCAAACAATAGCATTAGAAAAAGAG
TTCAATGATAAATTTTCTGGAGCAATGGAAAGCACCAGTGGTGTTTACTC
AGAATTTGGAATGATAAGTATTTGAATGGGAT
back to top

protein sequence of SMED30021921-orf-1

>SMED30021921-orf-1 ID=SMED30021921-orf-1|Name=SMED30021921-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=937bp
MFSCIFFSNNYYSKIYFCMIIFYVDIVDNFKEKQLHIGAVFPMSGDWAGG
ISCRPAAIMALNDVNNQTDILPDYNLTMTMKDSQCIAGLGSRMMYELIYT
PPVKIMFLTGCSTVTTFVAEAAPRWNLIVMAFGASSPALSNRARFPSFFR
THPSASLQNPTRLKLLKRWGWKKVSLIWEMEEVFSSTIHDFEMSVKELNI
TIVKRQPLQKHSQAVYLALKSLKNKDARIIIGLFYEKLARKVFCEAYKLG
LYGAKVVWVIIGWYPDDWWKYHLKKDGINCTEKEMKMAVEGHITTESLMW
NNDDAVTFSGLTSRKFKDRLINMLKDQWRNPENKISEGLIKEKLSQLTKI
SGYAEAPLAYDAIWAIAIALDKAAKRLKSKKVSLSEFEYHIQPNEIYEEL
HRAMNETYFMGVSTLVYFDSSGNRISWTRIEQMINGSYHVLGHHHILTDN
LTLLKEPSWTNSRIPRDSVALIFQRRALPLSIYIGFCCLVLICIISGVVC
IYFVHRCAPSSMKTDGKLKLKLLCSIGCLLNMFVIILLGADRISSVKIKS
NTLFMVLCQLKVAFVCLGFSLGYGSLFLSIWIVYRVATDRKKLTTDRCTK
NKCGTIEDSFQIKDKLLKIAPVSKIGVKYNSWEVIGMLGSFCMADVVVLL
AWRYFDPLSRYKVYFNQEKDILDEDIHYQPYMEICDCRNLGLWLGIIFGW
KGLVLILGLLLSYETRNIKFSFAIDTRSTGMAVYNVVVLSLITAPVSVMI
KDKQSAHFVFVSTSILLTSALSLGLIYIPRIKRQFRKTGDQDENIISDDE
TIQLRKTEEEQHNKYFTENEQLKRQISQIEREIEHLKSQLTNVYDVENLG
ISSQSIVAIHGGFSSYENLNHPKNNSFNRKKLKITGKIKSERKTLLKHSF
LTKQQTIALEKEFNDKFSGAMESTSGVYSEFGMISI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0003001lateral region of the whole animal
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR002455GPCR3_GABA-B
IPR019774Aromatic-AA_hydroxylase_C
IPR002456GPCR_3_GABA_rcpt_B1
IPR001828ANF_lig-bd_rcpt
IPR017978GPCR_3_C
IPR028082Peripla_BP_I
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0007186G-protein coupled receptor signaling pathway
Vocabulary: molecular function
TermDefinition
GO:0016714oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced pteridine as one donor, and incorporation of one atom of oxygen
GO:0004965G-protein coupled GABA receptor activity
GO:0004930G-protein coupled receptor activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 798..839
NoneNo IPR availablePRINTSPR01177GABAB1RECPTRcoord: 474..499
score: 26.92
coord: 416..439
score: 41.67
coord: 721..743
score: 60.87
coord: 516..537
score: 31.82
coord: 803..821
score: 26.32
coord: 23..44
score: 50.0
coord: 748..771
score: 29.17
coord: 348..366
score: 78.95
NoneNo IPR availablePRINTSPR01176GABABRECEPTRcoord: 234..257
score: 65.15
coord: 43..59
score: 53.48
coord: 104..132
score: 63.95
coord: 204..227
score: 45.08
coord: 570..587
score: 31.31
coord: 717..740
score: 62.88
coord: 139..158
score: 76.36
coord: 551..570
score: 52.73
coord: 751..773
score: 30.43
NoneNo IPR availableGENE3DG3DSA:3.40.50.2300coord: 149..441
e-value: 4.7E-130
score: 435.5
NoneNo IPR availableGENE3DG3DSA:3.40.50.2300coord: 35..421
e-value: 4.7E-130
score: 435.5
NoneNo IPR availablePANTHERPTHR10519:SF42GAMMA-AMINOBUTYRIC ACID TYPE B RECEPTOR SUBUNIT 1coord: 20..835
NoneNo IPR availableCDDcd152917tmC_GABA-B-R1coord: 474..776
e-value: 3.40638E-57
score: 196.017
NoneNo IPR availableCDDcd06366PBP1_GABAb_receptorcoord: 29..436
e-value: 3.57544E-102
score: 320.363
NoneNo IPR availableTMHMMTMhelixcoord: 749..771
NoneNo IPR availableTMHMMTMhelixcoord: 476..498
NoneNo IPR availableTMHMMTMhelixcoord: 726..743
NoneNo IPR availableTMHMMTMhelixcoord: 683..705
NoneNo IPR availableTMHMMTMhelixcoord: 627..649
NoneNo IPR availableTMHMMTMhelixcoord: 555..577
NoneNo IPR availableTMHMMTMhelixcoord: 511..533
IPR001828Receptor, ligand binding regionPFAMPF01094ANF_receptorcoord: 46..427
e-value: 4.9E-57
score: 193.6
IPR017978GPCR family 3, C-terminalPFAMPF000037tm_3coord: 486..774
e-value: 1.1E-30
score: 107.1
IPR017978GPCR family 3, C-terminalPROSITEPS50259G_PROTEIN_RECEP_F3_4coord: 551..774
score: 16.485
IPR002455GPCR family 3, GABA-B receptorPANTHERPTHR10519GABA-B RECEPTORcoord: 20..835
IPR028082Periplasmic binding protein-like ISUPERFAMILYSSF53822Periplasmic binding protein-like Icoord: 26..460