Potassium channel subfamily K member

Overview
NamePotassium channel subfamily K member
Smed IDSMED30021920
Length (bp)1500
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Potassium channel subfamily K member (SMED30021920) t-SNE clustered cells

Violin plots show distribution of expression levels for Potassium channel subfamily K member (SMED30021920) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Potassium channel subfamily K member (SMED30021920) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Potassium channel subfamily K member (SMED30021920) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021920

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30021920SMESG000023436.1 Contig2970GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30021920SMESG000074840.1 Contig2970GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30021920SMESG000074840.1 dd_Smed_v4_9028_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30021920SMESG000074840.1 dd_Smed_v4_9028_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30021920SMESG000074840.1 dd_Smed_v4_9028_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Potassium channel subfamily K member vs. Ensembl Human
Match: KCNK1 (potassium two pore domain channel subfamily K member 1 [Source:HGNC Symbol;Acc:HGNC:6272])

HSP 1 Score: 141.354 bits (355), Expect = 3.603e-37
Identity = 94/289 (32.53%), Postives = 159/289 (55.02%), Query Frame = 1
Query:  376 GALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYKMQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTTXXXXXXXXXXXXXXAKRNSSRILATVYIFTGLLATSFCIRAF---HRHPKWNLGDRFIYLYKESSPTDEFTISESSTLSDPLSFHNSSEQLQSFPVD 1233
            GA+ F ++EL  E   R    K +  F++ H C+ +++LE+ + ++   S  G++ L NA+  ++NWD  +A+FF++++++T GYG+  P++D GK FCI Y + GIP  ++  +AVV+R+ + V      L++ ++W  ++     +  V   F+   CFF IP+  F  +E   W+ L+S YFC ISL+TIGLGD +PG+G +   R   +I  T Y+  GL+A    +  F   H   K+    R ++  K+    D+  I E     D LSF + ++Q      D
Sbjct:   37 GAVVFSSVELPYEDLLRQELRKLKRRFLEEHECLSEQQLEQFLGRVLEASNYGVSVLSNASG-NWNWDFTSALFFASTVLSTTGYGHTVPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRITVHVTR-RPVLYFHIRWGFSKQVVAIVHAVLLGFVTVSCFFFIPAAVFSVLE-DDWNFLESFYFCFISLSTIGLGDYVPGEGYNQKFRELYKIGITCYLLLGLIAMLVVLETFCELHELKKF----RKMFYVKKDKDEDQVHIIE----HDQLSFSSITDQAAGMKED 314          
BLAST of Potassium channel subfamily K member vs. Ensembl Human
Match: KCNK2 (potassium two pore domain channel subfamily K member 2 [Source:HGNC Symbol;Acc:HGNC:6277])

HSP 1 Score: 131.724 bits (330), Expect = 5.226e-33
Identity = 81/239 (33.89%), Postives = 128/239 (53.56%), Query Frame = 1
Query:  247 LSFSEK---FESIKENKKSIRQLVFPKKSTFILFIYLIIFVSYLYVGALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYK-MQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTT 951
            LSFS K     S  E+  +I  + +   ST  L + L     YL +GA  F+ +E   E   R+     +  FI  HSCV   +L+ELI +I A    GI  LGN + +  +WDL ++ FF+ +++TTIG+GN  P T+ GKIFCI Y + GIP+   + + V ++L  +     + +    ++W +++ K R I  +       + F  +P++ F  +E   WS LD++YF VI+LTT
Sbjct:   35 LSFSTKPTVLASRVESDTTINVMKWKTVSTIFLVVVL-----YLIIGATVFKALEQPHEISQRTTIVIQKQTFISQHSCVNSTELDELIQQIVAAINAGIIPLGNTSNQISHWDLGSSFFFAGTVITTIGFGNISPRTEGGKIFCIIYALLGIPLFGFLLAGVGDQLGTIFGKGIAKVEDTFIKWNVSQTKIRIISTIIFILFGCVLFVALPAIIFKHIE--GWSALDAIYFVVITLTT 266          
BLAST of Potassium channel subfamily K member vs. Ensembl Human
Match: KCNK2 (potassium two pore domain channel subfamily K member 2 [Source:HGNC Symbol;Acc:HGNC:6277])

HSP 1 Score: 131.339 bits (329), Expect = 5.893e-33
Identity = 81/239 (33.89%), Postives = 128/239 (53.56%), Query Frame = 1
Query:  247 LSFSEK---FESIKENKKSIRQLVFPKKSTFILFIYLIIFVSYLYVGALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYK-MQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTT 951
            LSFS K     S  E+  +I  + +   ST  L + L     YL +GA  F+ +E   E   R+     +  FI  HSCV   +L+ELI +I A    GI  LGN + +  +WDL ++ FF+ +++TTIG+GN  P T+ GKIFCI Y + GIP+   + + V ++L  +     + +    ++W +++ K R I  +       + F  +P++ F  +E   WS LD++YF VI+LTT
Sbjct:   20 LSFSTKPTVLASRVESDTTINVMKWKTVSTIFLVVVL-----YLIIGATVFKALEQPHEISQRTTIVIQKQTFISQHSCVNSTELDELIQQIVAAINAGIIPLGNTSNQISHWDLGSSFFFAGTVITTIGFGNISPRTEGGKIFCIIYALLGIPLFGFLLAGVGDQLGTIFGKGIAKVEDTFIKWNVSQTKIRIISTIIFILFGCVLFVALPAIIFKHIE--GWSALDAIYFVVITLTT 251          
BLAST of Potassium channel subfamily K member vs. Ensembl Human
Match: KCNK2 (potassium two pore domain channel subfamily K member 2 [Source:HGNC Symbol;Acc:HGNC:6277])

HSP 1 Score: 131.339 bits (329), Expect = 6.225e-33
Identity = 81/239 (33.89%), Postives = 128/239 (53.56%), Query Frame = 1
Query:  247 LSFSEK---FESIKENKKSIRQLVFPKKSTFILFIYLIIFVSYLYVGALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYK-MQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTT 951
            LSFS K     S  E+  +I  + +   ST  L + L     YL +GA  F+ +E   E   R+     +  FI  HSCV   +L+ELI +I A    GI  LGN + +  +WDL ++ FF+ +++TTIG+GN  P T+ GKIFCI Y + GIP+   + + V ++L  +     + +    ++W +++ K R I  +       + F  +P++ F  +E   WS LD++YF VI+LTT
Sbjct:   31 LSFSTKPTVLASRVESDTTINVMKWKTVSTIFLVVVL-----YLIIGATVFKALEQPHEISQRTTIVIQKQTFISQHSCVNSTELDELIQQIVAAINAGIIPLGNTSNQISHWDLGSSFFFAGTVITTIGFGNISPRTEGGKIFCIIYALLGIPLFGFLLAGVGDQLGTIFGKGIAKVEDTFIKWNVSQTKIRIISTIIFILFGCVLFVALPAIIFKHIE--GWSALDAIYFVVITLTT 262          
BLAST of Potassium channel subfamily K member vs. Ensembl Human
Match: KCNK10 (potassium two pore domain channel subfamily K member 10 [Source:HGNC Symbol;Acc:HGNC:6273])

HSP 1 Score: 132.109 bits (331), Expect = 1.406e-32
Identity = 73/201 (36.32%), Postives = 115/201 (57.21%), Query Frame = 1
Query:  364 YLYVGALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFS---ALFYKMQWKITENKYREIQIVCSFFILALC--FFIIPSLAFYKMELPKWSLLDSLYFCVISLTT 951
            YL  G L FR +E   E   ++     + EF+++H CV  ++LE LI         G++ +GN++    +WDL +A FF+ +++TTIGYGN  P T+ GKIFCI Y IFGIP+   + + + ++L  +     +    +F K Q  +++ K R I  +   FILA C  F  IP++ F  +E   W+ L+S+YF V++LTT
Sbjct:   87 YLVTGGLVFRALEQPFESSQKNTIALEKAEFLRDHVCVSPQELETLIQHALDADNAGVSPIGNSSNNSSHWDLGSAFFFAGTVITTIGYGNIAPSTEGGKIFCILYAIFGIPLFGFLLAGIGDQLGTIFGKSIARVEKVFRKKQ--VSQTKIRVISTI--LFILAGCIVFVTIPAVIFKYIE--GWTALESIYFVVVTLTT 281          
BLAST of Potassium channel subfamily K member vs. Ensembl Celegans
Match: twk-46 (Two pore potassium channel protein sup-9 [Source:UniProtKB/TrEMBL;Acc:B2FDA9])

HSP 1 Score: 115.546 bits (288), Expect = 1.527e-28
Identity = 88/269 (32.71%), Postives = 143/269 (53.16%), Query Frame = 1
Query:  316 KKSTFILFIYLIIFVSYLYVGALCFRTIELGKEKEDRSAFYKFRMEFIKN--HSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYKMQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTTXXXXXXXXXXXXXXAKRNSSRILATVYIFTGLLATSFCIRAFHRHPKWNLGDRFI 1116
            ++S   + + L + V YL+VGA+ F  IE   EK +R A+  ++ ++        +++ ++++L   I+  +  GI    N T++  NW    A FF+ +L++T+GYG   P T+ GK+F I Y + GIP+ + + SA+V R+          L  ++    T N  + I +   F  L L  F IP+  F  +E   WS LD+ Y+C +SLTTIGLGD  PGD P+ + R   +I ATVY+  GL      +   +  P++NL   F+
Sbjct:   21 RESNMRILVGLGVAVVYLFVGAIVFVRIEYPLEKIEREAYLDYQNQWRDRLIQLDIDESEIDKLFLNIREAALNGIWMDRNLTSDP-NWTFGQAFFFAGTLISTVGYGRVSPRTEYGKLFTILYCVIGIPLTLALLSAIVARMREPSHKLRGLLNQRLGHLFTVNHIQLIHVGVVFASLLLFVFAIPAWVFSSIE-TDWSYLDAFYYCFVSLTTIGLGDFEPGDDPNQSFRGLYKIGATVYLMGGLCCMMLFLATLYDIPQFNLTSFFV 287          
BLAST of Potassium channel subfamily K member vs. Ensembl Celegans
Match: twk-46 (Two pore potassium channel protein sup-9 [Source:UniProtKB/TrEMBL;Acc:B2FDA9])

HSP 1 Score: 106.686 bits (265), Expect = 1.931e-25
Identity = 89/273 (32.60%), Postives = 143/273 (52.38%), Query Frame = 1
Query:  334 LFIYLIIFVSYLYVGALCFRTIELGKEKEDRSAFYKFRMEF-IKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYKMQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTTXXXXXXXXXXXXXXAKRNSSRILATVYIFTGLLATSFCIRAFHRHPKWNLGDRFIYLYKESSPTDE 1149
            +FI + +   +L  GA   + IE+  +   RS F+    +F I+N+  V+  ++++L   I+  +  GI    N T++  NW    A FF+ +L++T+GYG   P T+ GK+F I Y + GIP+ + + SA+V R+          L  ++    T N  + I +   F  L L  F IP+  F  +E   WS LD+ Y+C +SLTTIGLGD  PGD P+ + R   +I ATVY+  GL      +   +  P++NL   F+   +E   ++E
Sbjct:   21 IFIGIFLQTFFLIFGARFIQLIEIDNDLRARSKFHHELEQFMIRNN--VDQSEIDKLFLNIREAALNGIWMDRNLTSDP-NWTFGQAFFFAGTLISTVGYGRVSPRTEYGKLFTILYCVIGIPLTLALLSAIVARMREPSHKLRGLLNQRLGHLFTVNHIQLIHVGVVFASLLLFVFAIPAWVFSSIE-TDWSYLDAFYYCFVSLTTIGLGDFEPGDDPNQSFRGLYKIGATVYLMGGLCCMMLFLATLYDIPQFNLTSFFVKSDEEMRFSEE 289          
BLAST of Potassium channel subfamily K member vs. Ensembl Celegans
Match: twk-4 (TWiK family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q23386])

HSP 1 Score: 91.2781 bits (225), Expect = 1.282e-19
Identity = 66/218 (30.28%), Postives = 107/218 (49.08%), Query Frame = 1
Query:  334 LFIYLIIF--VSYLYVGALCFRTIELGKEKEDRSAFYKFRMEFIKN-----HSCVEDKKLEELISKIQALSGRGINSLGNAT-----AEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYKMQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTT 951
            LF  ++IF  V+Y+  GA  F  IE   E +   +++     FI N     +  V D  +E LI    +++ R        T      E   W + +A+FF+T+++T+IGYGN  P++  GKIFC+ Y IFGIP+ ++  + + +    + D+             TE+     Q++   F+L    ++  S   Y +  P WS LDS YFC++SL T
Sbjct:   89 LFHLVLIFATVAYIIAGAYLFTKIEHQAELDRYQSYHTIYRNFINNLYQSSNRSVAD--VENLIDTFTSINFRAFKEGLKPTDFLVPQETSRWSMISAIFFTTTVLTSIGYGNLIPISTGGKIFCVGYAIFGIPLTLVTIADLAK---FVADMLI--------MDPTEDPKTGRQLLVLVFLLG---YMTISACVYTILEPMWSFLDSFYFCLVSLLT 290          
BLAST of Potassium channel subfamily K member vs. Ensembl Celegans
Match: twk-20 (Two pore potassium channel protein sup-9 [Source:UniProtKB/TrEMBL;Acc:G5ECW6])

HSP 1 Score: 86.6557 bits (213), Expect = 2.533e-18
Identity = 74/256 (28.91%), Postives = 124/256 (48.44%), Query Frame = 1
Query:  319 KSTFILFIYLIIFVSYLYVGALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVE-DKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYKMQWKITENKYREIQIVCSFFI----LALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTTXXXXXXXXXXXXXXAKRNSSRILATV-YIFTGLLATSFCI 1068
            KS   L + L  F +YL  GA+ F  +E  K+   R    +        ++  E D  L E I+         I S+       Y W    A +F+T ++TT+GYG+  P T+ GK+FC+ + +FG+PM +IM  ++ ER    V+   +   +K +  + +  +  +Q V    +    L + F +I S  +    + KWS+ D+ YFC+I+ +TIG GDL+P    +  +     + AT+ +I  GL   S C+
Sbjct:    7 KSARALLLILSTF-TYLLFGAMVFDKLESEKDTWVRDEIERITDRLKHKYNFSERDLHLFEAIA---------IKSIPQQAG--YQWQFAGAFYFATVVITTVGYGHSAPSTNAGKLFCMIFALFGVPMGLIMFQSIGER----VNTFIAYSLHKFRDSLHQQGFTCLQEVTPTHLLMVSLTIGFMVIVSGTYMFHTIEKWSIFDAYYFCMITFSTIGFGDLVPLQQVNALQDQPLYVFATIMFILIGLAVFSACV 246          
BLAST of Potassium channel subfamily K member vs. Ensembl Celegans
Match: sup-9 (Two pore potassium channel protein sup-9 [Source:UniProtKB/Swiss-Prot;Acc:O17185])

HSP 1 Score: 82.8037 bits (203), Expect = 4.122e-17
Identity = 58/206 (28.16%), Postives = 99/206 (48.06%), Query Frame = 1
Query:  346 LIIFVSYLYVGALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYKMQWKITENKYREIQIVCSFFILALCF----FIIPSLAFYKMELPKWSLLDSLYFCVISLTT 951
            ++  ++YL VGA  F  +E   E   R    + R E +K    + +   E L + I       + S+ +     Y W    A +F+T+++TTIGYG+  P+TD GK+FC+ Y + GIP+ +IM  ++ ER+       F+A   +   +    +     IV S  ++  C      +I   AF       W+  D++Y+C ++LTT
Sbjct:   12 IVCTLTYLLVGAAVFDALETENEILQRKLVQRVR-EKLKTKYNMSNADYEILEATI-------VKSVPHKAG--YQWKFSGAFYFATTVITTIGYGHSTPMTDAGKVFCMLYALAGIPLGLIMFQSIGERMN-----TFAAKLLRFIRRAAGKQ----PIVTSSDLIIFCTGWGGLLIFGGAFMFSSYENWTYFDAVYYCFVTLTT 198          
BLAST of Potassium channel subfamily K member vs. Ensembl Fly
Match: Task6 (gene:FBgn0038165 transcript:FBtr0301654)

HSP 1 Score: 82.4185 bits (202), Expect = 1.109e-16
Identity = 60/214 (28.04%), Postives = 101/214 (47.20%), Query Frame = 1
Query:  316 KKSTFILFIYLIIFVSYLYVGALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVED--KKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYKMQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTT 951
            KK        ++   +YL VGA  F  +E   EK    A        I+ ++  ++  K +E ++ K ++      +  G        W    A +++T+++TTIGYG+  P T  GK+F + Y I GIP+ ++M  ++ ER+  L      A+   ++ K T     E+ ++C    L+       + AF K E   WS  DS+Y+C I+LTT
Sbjct:    2 KKQNVRTISLIVCTFTYLLVGAAVFDALESETEKRRWEALQDAEDMIIRKYNISQEDFKVMETVVLKSES------HKAGQ------QWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGIPLGLVMFQSIGERVNRLSSYVIKAVRSSLRCKRTVAS--EVDLICVVTTLSSLTIAGGAAAFSKFE--GWSYFDSVYYCFITLTT 199          
BLAST of Potassium channel subfamily K member vs. Ensembl Fly
Match: Task6 (gene:FBgn0038165 transcript:FBtr0334494)

HSP 1 Score: 82.4185 bits (202), Expect = 1.109e-16
Identity = 60/214 (28.04%), Postives = 101/214 (47.20%), Query Frame = 1
Query:  316 KKSTFILFIYLIIFVSYLYVGALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVED--KKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYKMQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTT 951
            KK        ++   +YL VGA  F  +E   EK    A        I+ ++  ++  K +E ++ K ++      +  G        W    A +++T+++TTIGYG+  P T  GK+F + Y I GIP+ ++M  ++ ER+  L      A+   ++ K T     E+ ++C    L+       + AF K E   WS  DS+Y+C I+LTT
Sbjct:    2 KKQNVRTISLIVCTFTYLLVGAAVFDALESETEKRRWEALQDAEDMIIRKYNISQEDFKVMETVVLKSES------HKAGQ------QWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGIPLGLVMFQSIGERVNRLSSYVIKAVRSSLRCKRTVAS--EVDLICVVTTLSSLTIAGGAAAFSKFE--GWSYFDSVYYCFITLTT 199          
BLAST of Potassium channel subfamily K member vs. Ensembl Fly
Match: Task6 (gene:FBgn0038165 transcript:FBtr0334493)

HSP 1 Score: 82.0333 bits (201), Expect = 1.469e-16
Identity = 60/214 (28.04%), Postives = 101/214 (47.20%), Query Frame = 1
Query:  316 KKSTFILFIYLIIFVSYLYVGALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVED--KKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYKMQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTT 951
            KK        ++   +YL VGA  F  +E   EK    A        I+ ++  ++  K +E ++ K ++      +  G        W    A +++T+++TTIGYG+  P T  GK+F + Y I GIP+ ++M  ++ ER+  L      A+   ++ K T     E+ ++C    L+       + AF K E   WS  DS+Y+C I+LTT
Sbjct:    2 KKQNVRTISLIVCTFTYLLVGAAVFDALESETEKRRWEALQDAEDMIIRKYNISQEDFKVMETVVLKSES------HKAGQ------QWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGIPLGLVMFQSIGERVNRLSSYVIKAVRSSLRCKRTVAS--EVDLICVVTTLSSLTIAGGAAAFSKFE--GWSYFDSVYYCFITLTT 199          
BLAST of Potassium channel subfamily K member vs. Ensembl Fly
Match: Task6 (gene:FBgn0038165 transcript:FBtr0334492)

HSP 1 Score: 82.0333 bits (201), Expect = 1.469e-16
Identity = 60/214 (28.04%), Postives = 101/214 (47.20%), Query Frame = 1
Query:  316 KKSTFILFIYLIIFVSYLYVGALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVED--KKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYKMQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTT 951
            KK        ++   +YL VGA  F  +E   EK    A        I+ ++  ++  K +E ++ K ++      +  G        W    A +++T+++TTIGYG+  P T  GK+F + Y I GIP+ ++M  ++ ER+  L      A+   ++ K T     E+ ++C    L+       + AF K E   WS  DS+Y+C I+LTT
Sbjct:    2 KKQNVRTISLIVCTFTYLLVGAAVFDALESETEKRRWEALQDAEDMIIRKYNISQEDFKVMETVVLKSES------HKAGQ------QWKFTGAFYYATTVLTTIGYGHSTPSTVGGKLFTMCYAIVGIPLGLVMFQSIGERVNRLSSYVIKAVRSSLRCKRTVAS--EVDLICVVTTLSSLTIAGGAAAFSKFE--GWSYFDSVYYCFITLTT 199          
BLAST of Potassium channel subfamily K member vs. Ensembl Fly
Match: CG43155 (gene:FBgn0262685 transcript:FBtr0305607)

HSP 1 Score: 73.559 bits (179), Expect = 8.920e-14
Identity = 80/280 (28.57%), Postives = 120/280 (42.86%), Query Frame = 1
Query:  340 IYLIIFVS-YLYVGALCFRTIELGKEKEDRSAFYKFRMEFIKNH---------SCVEDKKLEELIS--------KIQALSGRGINSLGNAT-AEHYN-WDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYKMQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMEL-----------PKWSLLDSLYFCVISLTTXXXXXXXXXXXXXXAKRNSSRILATVYIFTGLLATSFCIRAFHRH 1086
            I L++ +S Y  VG L FR +E   E E  S       + +K H         +  E   L+EL+S         +Q  +  G+  + +    E Y  W +  AVFFS++++TTIGYGN  PVT  G++FCI + + GIP  + +  A   RLF      F              K+   +   + FI    F+ I ++ F  + L             W+  D  YFC I++TT        G G  + K+ +  +L T+YI  GL  TS  I    R 
Sbjct:   66 IGLLVSLSIYCGVGGLIFRHLERPAEVERLSHL----KDIVKTHRERFLHTILNNTEVHNLDELLSFELAKYEAAVQQAAEGGLLIVADKDFPEPYERWSILQAVFFSSTVLTTIGYGNIVPVTTGGRVFCICFALIGIPFTLTVI-ADWGRLFATAVSVF-------------GKHMPTKPKFTNFIGKTWFYAILAVGFLGVYLAAGAGLLLLWEDDWTFFDGFYFCFITMTT-------IGFGDLVPKKPNYMLLCTLYILIGLALTSTIIELVRRQ 320          
BLAST of Potassium channel subfamily K member vs. Ensembl Zebrafish
Match: kcnk6 (potassium channel, subfamily K, member 6 [Source:ZFIN;Acc:ZDB-GENE-050309-213])

HSP 1 Score: 148.673 bits (374), Expect = 3.223e-40
Identity = 103/327 (31.50%), Postives = 171/327 (52.29%), Query Frame = 1
Query:  319 KSTFILFIYLIIFVSYLYVGALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERL-----FLLVDLCFSALFYKMQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTTXXXXXXXXXXXXXXAKRNSSRILATVYIFTGLLATSFCIRAFHRHPKWNLGDRFIYLYK-ESSPTDEFTISESSTLSDPLSFHNSSEQLQSFPVDPNAMYSNRAKRIRYNS 1281
            +S F+L  +++ + +YL +GAL F  IE   E+  ++     + EF+ N SCV    LE  + ++   +  G++ L NA+    NWDL +++FF+ ++VTT+GYG+  P++D GK F I Y + G+P  M++ +A V+RL     +  +  C      + +  + +     +  +   F++ LCFF++PSL F  +E   WS LD+ YFC ISL TIGLGD +P + P  + R   +I   VY+F GL+     +R FH+         F +L   E    D+  I E+    D       +E+    P+DP++       ++ YNS
Sbjct:   15 RSCFMLIGFILAYFTYLLLGALVFSAIERPIEESLKADLSSLKAEFL-NLSCVNSTALETFLERVLKANKYGVSVLENASLRT-NWDLASSLFFANTMVTTVGYGHTTPLSDAGKAFSIVYALIGVPFTMLVLTACVQRLMHPLTYRPISAC------QRRAGLQQRSASVVHFIVLLFLVVLCFFVVPSLVFSAIE-ETWSFLDAFYFCFISLCTIGLGDFVPAEKPGQSLRALYKISVMVYLFVGLMVMFLVLRTFHKLADVYGWTAFFHLPSCEEDEEDKEPIIEAGPEDD----SPEAEKASIKPLDPSS-------QVSYNS 321          
BLAST of Potassium channel subfamily K member vs. Ensembl Zebrafish
Match: kcnk1a (potassium channel, subfamily K, member 1a [Source:ZFIN;Acc:ZDB-GENE-070620-26])

HSP 1 Score: 148.673 bits (374), Expect = 4.684e-40
Identity = 101/316 (31.96%), Postives = 173/316 (54.75%), Query Frame = 1
Query:  319 KSTFILFIYLIIFVSYLYVGALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSAL----FYKMQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTTXXXXXXXXXXXXXXAKRNSSRILATVYIFTGLLATSFCIRAFHRHPKWNLGDRFIYLYKESSPTDEFTISESSTLSDPLSFHNSSEQLQSFPVDPNAMYSN 1254
            KST+   + ++ +V YL  GAL F  +EL  E++ R      + +F++++ C+ + +LEE + K    S  G++ L NA++ ++NWD  +A+FF++++++T GYG+  P++D GK FCI Y + GIP  ++  +AVV+R+     + FS      F   +W  ++     +       I   CFF+IP++ F  +E  +W+ L+S YFC ISL+TIGLGD +PG+G     R   ++  T Y+  GL+A    +  F    +     +  YL K+ +  D+  I +     D LSF + S+Q  SF  D   ++ +
Sbjct:   18 KSTWYFLVLVLAYVLYLIFGALVFSAVELPYEEQLRQELRTVKQQFLEDNECLSNDRLEEFLIKALEASNYGVSVLNNASS-NWNWDFTSALFFASTVLSTTGYGHTVPLSDGGKAFCIIYSVVGIPFTLLFLTAVVQRI-----MEFSTRRPIEFLHRRWGTSKPLLAAMHATLLAIITVSCFFLIPAIIFSVLE-EEWNFLESFYFCFISLSTIGLGDYVPGEGYHQRFRELYKLGITFYLILGLIAMLVVLETFCELQQLKKLRKMFYLRKQKTE-DQLNIVD----HDHLSFASVSDQAASFREDKTELFPD 321          
BLAST of Potassium channel subfamily K member vs. Ensembl Zebrafish
Match: kcnk1a (potassium channel, subfamily K, member 1a [Source:ZFIN;Acc:ZDB-GENE-070620-26])

HSP 1 Score: 148.673 bits (374), Expect = 4.684e-40
Identity = 101/316 (31.96%), Postives = 173/316 (54.75%), Query Frame = 1
Query:  319 KSTFILFIYLIIFVSYLYVGALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSAL----FYKMQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTTXXXXXXXXXXXXXXAKRNSSRILATVYIFTGLLATSFCIRAFHRHPKWNLGDRFIYLYKESSPTDEFTISESSTLSDPLSFHNSSEQLQSFPVDPNAMYSN 1254
            KST+   + ++ +V YL  GAL F  +EL  E++ R      + +F++++ C+ + +LEE + K    S  G++ L NA++ ++NWD  +A+FF++++++T GYG+  P++D GK FCI Y + GIP  ++  +AVV+R+     + FS      F   +W  ++     +       I   CFF+IP++ F  +E  +W+ L+S YFC ISL+TIGLGD +PG+G     R   ++  T Y+  GL+A    +  F    +     +  YL K+ +  D+  I +     D LSF + S+Q  SF  D   ++ +
Sbjct:   18 KSTWYFLVLVLAYVLYLIFGALVFSAVELPYEEQLRQELRTVKQQFLEDNECLSNDRLEEFLIKALEASNYGVSVLNNASS-NWNWDFTSALFFASTVLSTTGYGHTVPLSDGGKAFCIIYSVVGIPFTLLFLTAVVQRI-----MEFSTRRPIEFLHRRWGTSKPLLAAMHATLLAIITVSCFFLIPAIIFSVLE-EEWNFLESFYFCFISLSTIGLGDYVPGEGYHQRFRELYKLGITFYLILGLIAMLVVLETFCELQQLKKLRKMFYLRKQKTE-DQLNIVD----HDHLSFASVSDQAASFREDKTELFPD 321          
BLAST of Potassium channel subfamily K member vs. Ensembl Zebrafish
Match: kcnk1b (potassium channel, subfamily K, member 1b [Source:ZFIN;Acc:ZDB-GENE-090312-78])

HSP 1 Score: 145.976 bits (367), Expect = 3.706e-39
Identity = 93/297 (31.31%), Postives = 161/297 (54.21%), Query Frame = 1
Query:  289 KSIRQLVFPKKSTFILFIYLIIFVSYLYVGALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYKMQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTTXXXXXXXXXXXXXXAKRNSSRILATVYIFTGLLATSFCIRAFHRHPKWNLGDRFIYLYKESSPTDEFTISESSTLS 1179
             S  +L+   KS +     ++ +V YL  GA+ F ++EL  E + R    + +  F++ H C+ +++LE  +SK    S  G++ L NA+A  +NWD  +++FF++++++T GYG+  P++D GK FCI Y + GIP  ++  +AVV+R+ ++       ++   +W +++     +       +   CFF+IP+  F  +E   W+ L+S YFC ISL+TIGLGD +PG+  +   R   ++  TVY+  GL+A    +  F    +     +  YL KE  P D   I E   L+
Sbjct:    8 NSCVRLIQSNKSAWYFLFLVLGYVLYLIFGAVVFSSVELPYEDDLRQQLREIKRLFLQEHQCLSEERLERFLSKALEASNYGVSILNNASAS-WNWDFTSSLFFASTVLSTTGYGHTAPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRI-MVYSTWRPIMYVHTRWGLSKPLVALVHATLLAVVAVSCFFLIPAAIFSALE-ENWNFLESFYFCFISLSTIGLGDYVPGEAFNQRFRELYKLGITVYLLLGLIAMLVVLETFCELQQLKQLRKMFYLKKE-KPQDRLAIMEHDHLA 300          
BLAST of Potassium channel subfamily K member vs. Ensembl Zebrafish
Match: kcnk1a (potassium channel, subfamily K, member 1a [Source:ZFIN;Acc:ZDB-GENE-070620-26])

HSP 1 Score: 134.035 bits (336), Expect = 6.576e-36
Identity = 73/227 (32.16%), Postives = 131/227 (57.71%), Query Frame = 1
Query:  283 NKKSIRQLVFPKKSTFILFIYLIIFVSYLYVGALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSAL----FYKMQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTT 951
            +  S  +++   KST+   + ++ +V YL  GAL F  +EL  E++ R      + +F++++ C+ + +LEE + K    S  G++ L NA++ ++NWD  +A+FF++++++T GYG+  P++D GK FCI Y + GIP  ++  +AVV+R+     + FS      F   +W  ++     +       I   CFF+IP++ F  +E  +W+ L+S YFC ISL+T
Sbjct:    6 SGSSCMRVIDGYKSTWYFLVLVLAYVLYLIFGALVFSAVELPYEEQLRQELRTVKQQFLEDNECLSNDRLEEFLIKALEASNYGVSVLNNASS-NWNWDFTSALFFASTVLSTTGYGHTVPLSDGGKAFCIIYSVVGIPFTLLFLTAVVQRI-----MEFSTRRPIEFLHRRWGTSKPLLAAMHATLLAIITVSCFFLIPAIIFSVLE-EEWNFLESFYFCFISLST 225          
BLAST of Potassium channel subfamily K member vs. Ensembl Xenopus
Match: KCNK4 (potassium channel, two pore domain subfamily K, member 4 [Source:NCBI gene;Acc:100488063])

HSP 1 Score: 134.806 bits (338), Expect = 1.801e-34
Identity = 75/219 (34.25%), Postives = 120/219 (54.79%), Query Frame = 1
Query:  316 KKSTFILFIYLIIFVSYLYVGALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERL-------FLLVDLCFSALFYKMQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTT 951
            KK+   LF    + + YL  GA+ F+ +E   E   +S   + R  F+  H C+++ +L+E I +++   G G++   NAT     WD+ +  FF+ +++TTIGYGN+ P TD G+IFCIFY + GIP+  I+ + V + L          V++ F      ++W ++    R I  +    I  L F +IP   F K+E   W+LL+S+YF VI+LTT
Sbjct:    3 KKTVLALFG---VVLGYLVTGAVVFQMLEQPFEALKQSQLNEHRRAFLDEHICLQEDRLDEFIEQVKEAIGSGVDPSANATNVTTRWDIGSCFFFAGTIITTIGYGNNAPKTDGGQIFCIFYALVGIPLFGILLAGVGDHLGSSLRKGIGKVEMLF------LKWHVSATIVRVISALLFILIGCLLFVLIPMFIFQKIE--NWTLLESIYFVVITLTT 210          
BLAST of Potassium channel subfamily K member vs. Ensembl Xenopus
Match: KCNK4 (potassium channel, two pore domain subfamily K, member 4 [Source:NCBI gene;Acc:100488063])

HSP 1 Score: 130.954 bits (328), Expect = 5.328e-33
Identity = 76/219 (34.70%), Postives = 120/219 (54.79%), Query Frame = 1
Query:  316 KKSTFILFIYLIIFVSYLYVGALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERL-------FLLVDLCFSALFYKMQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTT 951
            KK+   LF    + + YL  GA+ F+ +E   E   +S   + R  F+  H C+++ +L+E I   +A+ G G++   NAT     WD+ +  FF+ +++TTIGYGN+ P TD G+IFCIFY + GIP+  I+ + V + L          V++ F      ++W ++    R I  +    I  L F +IP   F K+E   W+LL+S+YF VI+LTT
Sbjct:    3 KKTVLALFG---VVLGYLVTGAVVFQMLEQPFEALKQSQLNEHRRAFLDEHICLQEDRLDEFIEVKEAI-GSGVDPSANATNVTTRWDIGSCFFFAGTIITTIGYGNNAPKTDGGQIFCIFYALVGIPLFGILLAGVGDHLGSSLRKGIGKVEMLF------LKWHVSATIVRVISALLFILIGCLLFVLIPMFIFQKIE--NWTLLESIYFVVITLTT 209          
BLAST of Potassium channel subfamily K member vs. Ensembl Xenopus
Match: nkx3-2 (NK3 homeobox 2 [Source:Xenbase;Acc:XB-GENE-876834])

HSP 1 Score: 130.568 bits (327), Expect = 4.460e-32
Identity = 75/229 (32.75%), Postives = 127/229 (55.46%), Query Frame = 1
Query:  280 ENKKSIRQLVFPKKSTFILFIYLIIFVSYLYVGALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFS---ALFYKMQWKITENKYREIQIVCSFFILALC--FFIIPSLAFYKMELPKWSLLDSLYFCVISLTT 951
            +N  S  + V   K+   +F+ +++   YL  G L F  +E   E   +    + + +F+ NH CV  ++L+ LI +       G+N +GN +    +WD+ +A FF+ +++TTIG+GN  P T+ GKIFCI Y IFGIP+   + + + ++L  +     +    +F K Q  +++ K R I  +   FI+A C  F  IP++ F ++E   W+ L+SLYF V++LTT
Sbjct:   67 DNTSSGLRSVMKWKTVLAIFVLVVL---YLVTGGLVFGALEQPFENSQKYIIAQEKADFLLNHPCVTQQELDALIKRAIDADNAGVNPIGNNSNSSSHWDIGSAFFFAGTVITTIGFGNIAPSTEGGKIFCILYAIFGIPLFGFLLAGIGDQLGTIFGKSIARVEKVFLKKQ--VSQTKIRVISTI--LFIVAGCLVFVTIPAVIFKQIE--GWTELESLYFVVVTLTT 286          
BLAST of Potassium channel subfamily K member vs. Ensembl Xenopus
Match: wnt2b (Wnt family member 2B [Source:Xenbase;Acc:XB-GENE-960148])

HSP 1 Score: 126.716 bits (317), Expect = 5.602e-32
Identity = 84/285 (29.47%), Postives = 151/285 (52.98%), Query Frame = 1
Query:  373 VGALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSAL-FYKMQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTTXXXXXXXXXXXXXXAKRNSSRILATVYIFTGLLATSFCIRAFHRHPKWNLGDRFIYLYKESSPTDEFTISESSTLSDPLSFHNSSEQLQSF 1224
            +GA  F ++EL  E   R      +  +++ + C+ +++LE  +S++   S  G++ L N +  + NWD  +A+FF +++++T GYG+  P+++ GK FCI Y I GIP+ +++ +A+V+R  ++V +    + ++ ++W   +     +  +   F+  LCFF+IP+  F  +E   W+ L+S YFC ISL+TIGLGD +P +G +   R   +   T Y+  GL+     +  F          +  Y  K+    D+  I E     D L+  + SEQ  S 
Sbjct:   37 IGAAIFSSVELPHEHVLREELLDLKHRYLQENECLSEERLESFLSRVLEASNYGVSMLNNVSG-NPNWDFTSALFFVSTVLSTTGYGHTVPLSNAGKTFCIIYSIIGIPLTLLLFTALVQR--IMVHVTHRPISYFHLRWGYNKQTVAVVHALVIGFVAILCFFLIPAAIFSALE-DDWNFLESFYFCFISLSTIGLGDYVPAEGQNQRYRQLYKFGITCYLILGLIVMLVVLETFCELQGLKKFRKMFY-RKKMKEGDQLNIIE----HDQLTLASISEQAASL 312          
BLAST of Potassium channel subfamily K member vs. Ensembl Xenopus
Match: kcnk6 (potassium channel, two pore domain subfamily K, member 6 [Source:NCBI gene;Acc:100145504])

HSP 1 Score: 123.25 bits (308), Expect = 5.165e-31
Identity = 95/287 (33.10%), Postives = 149/287 (51.92%), Query Frame = 1
Query:  328 FILFIYLII--FVSYLYVGALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFY-KMQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTTXXXXXXXXXXXXXXAKRNSSRILATVYIFTGLLATSFCIRAFHRHPKWNLGDRFIYLYKESSPTDEFTISESSTLS 1179
            F L + L++  +V YL +GAL    IE   E   R    + +  F+    CV    LE  + KI   +  G++ L NA+ +   WD+ +++FF+++LVTT+GYG   P+TD GK FCIFY + G+P  M++ S+ V+R  L+V      + Y ++Q         ++       ++ + F IIPS  F  +E   WS LD+ YFC ISL TIGLGD +PG+  D   R   ++    Y+F GL+A    ++ FH+    +      YL +     D+  I E++  S
Sbjct:    3 FWLLLTLLVCAYVIYLLLGALVISVIESPYEASLRDELRQLKSVFLNESPCVNVSSLEAFLEKIINANKYGVSVLHNASNDS-KWDIASSMFFASTLVTTVGYGYTTPLTDSGKAFCIFYALIGVPFTMLVLSSFVQR--LMVMFTHKPIHYLQVQRGFDRKMVTQLHFFFLLILVLVFFLIIPSAIFNTIE-TTWSFLDAFYFCFISLCTIGLGDYVPGEQNDQWLRKLYKVSVAFYLFIGLMAMLLIVQTFHKAADLHGLTDIFYLPRLQDQDDQEPILETTDYS 285          
BLAST of Potassium channel subfamily K member vs. Ensembl Mouse
Match: Kcnk1 (potassium channel, subfamily K, member 1 [Source:MGI Symbol;Acc:MGI:109322])

HSP 1 Score: 140.198 bits (352), Expect = 5.114e-37
Identity = 94/283 (33.22%), Postives = 157/283 (55.48%), Query Frame = 1
Query:  376 GALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYKMQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTTXXXXXXXXXXXXXXAKRNSSRILATVYIFTGLLATSFCIRAF---HRHPKWNLGDRFIYLYKESSPTDEFTISESSTLSDPLSFHNSSEQL 1215
            GA+ F ++EL  E   R    K +  F++ H C+ + +LE+ + ++   S  G++ L NA+  ++NWD  +A+FF++++++T GYG+  P++D GK FCI Y + GIP  ++  +AVV+R+ + V      L++ ++W  ++     +  V   F+   CFF IP+  F  +E   W+ L+S YFC ISL+TIGLGD +PG+G +   R   +I  T Y+  GL+A    +  F   H   K+    R ++  K+    D   I E     D LSF + +EQ+
Sbjct:   37 GAVVFSSVELPYEDLLRQELRKLKRRFLEEHECLSEPQLEQFLGRVLEASNYGVSVLSNASG-NWNWDFTSALFFASTVLSTTGYGHTVPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRVTVHVTR-RPVLYFHIRWGFSKQVVAIVHAVLLGFVTVSCFFFIPAAVFSVLE-DDWNFLESFYFCFISLSTIGLGDYVPGEGYNQKFRELYKIGITCYLLLGLIAMLVVLETFCELHELKKF----RKMFYVKKDKDEDLVHIME----HDQLSFSSVTEQV 308          
BLAST of Potassium channel subfamily K member vs. Ensembl Mouse
Match: Kcnk1 (potassium channel, subfamily K, member 1 [Source:MGI Symbol;Acc:MGI:109322])

HSP 1 Score: 140.198 bits (352), Expect = 5.793e-37
Identity = 94/283 (33.22%), Postives = 157/283 (55.48%), Query Frame = 1
Query:  376 GALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYKMQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTTXXXXXXXXXXXXXXAKRNSSRILATVYIFTGLLATSFCIRAF---HRHPKWNLGDRFIYLYKESSPTDEFTISESSTLSDPLSFHNSSEQL 1215
            GA+ F ++EL  E   R    K +  F++ H C+ + +LE+ + ++   S  G++ L NA+  ++NWD  +A+FF++++++T GYG+  P++D GK FCI Y + GIP  ++  +AVV+R+ + V      L++ ++W  ++     +  V   F+   CFF IP+  F  +E   W+ L+S YFC ISL+TIGLGD +PG+G +   R   +I  T Y+  GL+A    +  F   H   K+    R ++  K+    D   I E     D LSF + +EQ+
Sbjct:   37 GAVVFSSVELPYEDLLRQELRKLKRRFLEEHECLSEPQLEQFLGRVLEASNYGVSVLSNASG-NWNWDFTSALFFASTVLSTTGYGHTVPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRVTVHVTR-RPVLYFHIRWGFSKQVVAIVHAVLLGFVTVSCFFFIPAAVFSVLE-DDWNFLESFYFCFISLSTIGLGDYVPGEGYNQKFRELYKIGITCYLLLGLIAMLVVLETFCELHELKKF----RKMFYVKKDKDEDLVHIME----HDQLSFSSVTEQV 308          
BLAST of Potassium channel subfamily K member vs. Ensembl Mouse
Match: Kcnk2 (potassium channel, subfamily K, member 2 [Source:MGI Symbol;Acc:MGI:109366])

HSP 1 Score: 132.109 bits (331), Expect = 2.468e-33
Identity = 80/239 (33.47%), Postives = 130/239 (54.39%), Query Frame = 1
Query:  247 LSFSEK---FESIKENKKSIRQLVFPKKSTFILFIYLIIFVSYLYVGALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYK-MQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTT 951
            LSFS K     S  E+  +I  + +   ST  L + L     YL +GA  F+ +E  +E   R+     +  FI  H+CV   +L+ELI +I A    GI  LGN++ +  +WDL ++ FF+ +++TTIG+GN  P T+ GKIFCI Y + GIP+   + + V ++L  +     + +    ++W +++ K R I  +       + F  +P++ F  +E   WS LD++YF VI+LTT
Sbjct:   35 LSFSSKPTVLASRVESDSAINVMKWKTVSTIFLVVVL-----YLIIGATVFKALEQPQEISQRTTIVIQKQTFIAQHACVNSTELDELIQQIVAAINAGIIPLGNSSNQVSHWDLGSSFFFAGTVITTIGFGNISPRTEGGKIFCIIYALLGIPLFGFLLAGVGDQLGTIFGKGIAKVEDTFIKWNVSQTKIRIISTIIFILFGCVLFVALPAVIFKHIE--GWSALDAIYFVVITLTT 266          
BLAST of Potassium channel subfamily K member vs. Ensembl Mouse
Match: Kcnk2 (potassium channel, subfamily K, member 2 [Source:MGI Symbol;Acc:MGI:109366])

HSP 1 Score: 131.724 bits (330), Expect = 2.541e-33
Identity = 80/239 (33.47%), Postives = 130/239 (54.39%), Query Frame = 1
Query:  247 LSFSEK---FESIKENKKSIRQLVFPKKSTFILFIYLIIFVSYLYVGALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYK-MQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTT 951
            LSFS K     S  E+  +I  + +   ST  L + L     YL +GA  F+ +E  +E   R+     +  FI  H+CV   +L+ELI +I A    GI  LGN++ +  +WDL ++ FF+ +++TTIG+GN  P T+ GKIFCI Y + GIP+   + + V ++L  +     + +    ++W +++ K R I  +       + F  +P++ F  +E   WS LD++YF VI+LTT
Sbjct:   23 LSFSSKPTVLASRVESDSAINVMKWKTVSTIFLVVVL-----YLIIGATVFKALEQPQEISQRTTIVIQKQTFIAQHACVNSTELDELIQQIVAAINAGIIPLGNSSNQVSHWDLGSSFFFAGTVITTIGFGNISPRTEGGKIFCIIYALLGIPLFGFLLAGVGDQLGTIFGKGIAKVEDTFIKWNVSQTKIRIISTIIFILFGCVLFVALPAVIFKHIE--GWSALDAIYFVVITLTT 254          
BLAST of Potassium channel subfamily K member vs. Ensembl Mouse
Match: Kcnk2 (potassium channel, subfamily K, member 2 [Source:MGI Symbol;Acc:MGI:109366])

HSP 1 Score: 132.109 bits (331), Expect = 2.560e-33
Identity = 80/239 (33.47%), Postives = 130/239 (54.39%), Query Frame = 1
Query:  247 LSFSEK---FESIKENKKSIRQLVFPKKSTFILFIYLIIFVSYLYVGALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYK-MQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTT 951
            LSFS K     S  E+  +I  + +   ST  L + L     YL +GA  F+ +E  +E   R+     +  FI  H+CV   +L+ELI +I A    GI  LGN++ +  +WDL ++ FF+ +++TTIG+GN  P T+ GKIFCI Y + GIP+   + + V ++L  +     + +    ++W +++ K R I  +       + F  +P++ F  +E   WS LD++YF VI+LTT
Sbjct:   31 LSFSSKPTVLASRVESDSAINVMKWKTVSTIFLVVVL-----YLIIGATVFKALEQPQEISQRTTIVIQKQTFIAQHACVNSTELDELIQQIVAAINAGIIPLGNSSNQVSHWDLGSSFFFAGTVITTIGFGNISPRTEGGKIFCIIYALLGIPLFGFLLAGVGDQLGTIFGKGIAKVEDTFIKWNVSQTKIRIISTIIFILFGCVLFVALPAVIFKHIE--GWSALDAIYFVVITLTT 262          
BLAST of Potassium channel subfamily K member vs. UniProt/SwissProt
Match: sp|Q9Z2T2|KCNK1_RAT (Potassium channel subfamily K member 1 OS=Rattus norvegicus OX=10116 GN=Kcnk1 PE=1 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 1.074e-36
Identity = 94/282 (33.33%), Postives = 157/282 (55.67%), Query Frame = 1
Query:  376 GALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYKMQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTTXXXXXXXXXXXXXXAKRNSSRILATVYIFTGLLATSFCIRAF---HRHPKWNLGDRFIYLYKESSPTDEFTISESSTLSDPLSFHNSSEQ 1212
            GA+ F ++EL  E   R    K +  F++ H C+ + +LE+ + ++   S  G++ L NA+  ++NWD  +A+FF++++++T GYG+  P++D GK FCI Y + GIP  ++  +AVV+R+ + V      L++ ++W  ++     +  V   F+   CFF IP+  F  +E   W+ L+S YFC ISL+TIGLGD +PG+G +   R   +I  T Y+  GL+A    +  F   H   K+    R ++  K+    D+  I E     D LSF + +EQ
Sbjct:   37 GAVVFSSVELPYEDLLRQELRKLKRRFLEEHECLSEPQLEQFLGRVLEASNYGVSVLSNASG-NWNWDFTSALFFASTVLSTTGYGHTVPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRVTVHVTR-RPVLYFHIRWGFSKQVVAIVHAVLLGFVTVSCFFFIPAAVFSVLE-DDWNFLESFYFCFISLSTIGLGDYVPGEGYNQKFRELYKIGITCYLLLGLIAMLVVLETFCELHELKKF----RKMFYVKKDKDEDQVHIME----HDQLSFSSITEQ 307          
BLAST of Potassium channel subfamily K member vs. UniProt/SwissProt
Match: sp|Q8R454|KCNK1_CAVPO (Potassium channel subfamily K member 1 OS=Cavia porcellus OX=10141 GN=KCNK1 PE=2 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 1.226e-36
Identity = 94/285 (32.98%), Postives = 158/285 (55.44%), Query Frame = 1
Query:  376 GALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYKMQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTTXXXXXXXXXXXXXXAKRNSSRILATVYIFTGLLATSFCIRAF---HRHPKWNLGDRFIYLYKESSPTDEFTISESSTLSDPLSFHNSSEQLQS 1221
            GA+ F ++EL  E   R    K +  F++ H C+ + +LE+ + ++   S  G++ L NA+  ++NWD  +A+FF++++++T GYG+  P++D GK FCI Y + GIP  ++  +AVV+R+ + V      L++ ++W  ++     +  V   F+   CFF IP+  F  +E   W+ L+S YFC ISL+TIGLGD +PG+G +   R   +I  T Y+  GL+A    +  F   H   K+    R ++  K+    D+  I E     D LSF + ++Q  S
Sbjct:   37 GAVVFSSVELPYEDLLRQELRKLKRRFLEEHECLSEPQLEQFLGRVLEASNYGVSVLSNASG-NWNWDFTSALFFASTVLSTTGYGHTVPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRITVHVTR-RPVLYFHIRWGFSKQMVGIVHAVVLGFVTVSCFFFIPAAVFSVLE-DDWNFLESFYFCFISLSTIGLGDYVPGEGYNQKFRELYKIGITCYLLLGLIAMLVVLETFCELHELKKF----RKMFYVKKDKDEDQVHIVE----HDQLSFSSITDQAAS 310          
BLAST of Potassium channel subfamily K member vs. UniProt/SwissProt
Match: sp|Q5RD07|KCNK1_PONAB (Potassium channel subfamily K member 1 OS=Pongo abelii OX=9601 GN=KCNK1 PE=2 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 1.263e-36
Identity = 94/289 (32.53%), Postives = 159/289 (55.02%), Query Frame = 1
Query:  376 GALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYKMQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTTXXXXXXXXXXXXXXAKRNSSRILATVYIFTGLLATSFCIRAF---HRHPKWNLGDRFIYLYKESSPTDEFTISESSTLSDPLSFHNSSEQLQSFPVD 1233
            GA+ F ++EL  E   R    K +  F++ H C+ +++LE+ + ++   S  G++ L NA+  ++NWD  +A+FF++++++T GYG+  P++D GK FCI Y + GIP  ++  +AVV+R+ + V      L++ ++W  ++     +  V   F+   CFF IP+  F  +E   W+ L+S YFC ISL+TIGLGD +PG+G +   R   +I  T Y+  GL+A    +  F   H   K+    R ++  K+    D+  I E     D LSF + ++Q      D
Sbjct:   37 GAVVFSSVELPYEDLLRQELRKLKRRFLEEHECLSEQQLEQFLGRVLEASNYGVSVLSNASG-NWNWDFTSALFFASTVLSTTGYGHTVPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRITVHVTR-RPVLYFHIRWGFSKQVVAIVHAVLLGFVTVSCFFFIPAAVFSVLE-DDWNFLESFYFCFISLSTIGLGDYVPGEGYNQKFRELYKIGITCYLLLGLIAMLVVLETFCELHELKKF----RKMFYVKKDKDEDQVHIIE----HDQLSFSSITDQAAGMKED 314          
BLAST of Potassium channel subfamily K member vs. UniProt/SwissProt
Match: sp|O00180|KCNK1_HUMAN (Potassium channel subfamily K member 1 OS=Homo sapiens OX=9606 GN=KCNK1 PE=1 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 1.730e-36
Identity = 94/289 (32.53%), Postives = 159/289 (55.02%), Query Frame = 1
Query:  376 GALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYKMQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTTXXXXXXXXXXXXXXAKRNSSRILATVYIFTGLLATSFCIRAF---HRHPKWNLGDRFIYLYKESSPTDEFTISESSTLSDPLSFHNSSEQLQSFPVD 1233
            GA+ F ++EL  E   R    K +  F++ H C+ +++LE+ + ++   S  G++ L NA+  ++NWD  +A+FF++++++T GYG+  P++D GK FCI Y + GIP  ++  +AVV+R+ + V      L++ ++W  ++     +  V   F+   CFF IP+  F  +E   W+ L+S YFC ISL+TIGLGD +PG+G +   R   +I  T Y+  GL+A    +  F   H   K+    R ++  K+    D+  I E     D LSF + ++Q      D
Sbjct:   37 GAVVFSSVELPYEDLLRQELRKLKRRFLEEHECLSEQQLEQFLGRVLEASNYGVSVLSNASG-NWNWDFTSALFFASTVLSTTGYGHTVPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRITVHVTR-RPVLYFHIRWGFSKQVVAIVHAVLLGFVTVSCFFFIPAAVFSVLE-DDWNFLESFYFCFISLSTIGLGDYVPGEGYNQKFRELYKIGITCYLLLGLIAMLVVLETFCELHELKKF----RKMFYVKKDKDEDQVHIIE----HDQLSFSSITDQAAGMKED 314          
BLAST of Potassium channel subfamily K member vs. UniProt/SwissProt
Match: sp|O08581|KCNK1_MOUSE (Potassium channel subfamily K member 1 OS=Mus musculus OX=10090 GN=Kcnk1 PE=1 SV=2)

HSP 1 Score: 140.198 bits (352), Expect = 4.052e-36
Identity = 94/283 (33.22%), Postives = 157/283 (55.48%), Query Frame = 1
Query:  376 GALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYKMQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTTXXXXXXXXXXXXXXAKRNSSRILATVYIFTGLLATSFCIRAF---HRHPKWNLGDRFIYLYKESSPTDEFTISESSTLSDPLSFHNSSEQL 1215
            GA+ F ++EL  E   R    K +  F++ H C+ + +LE+ + ++   S  G++ L NA+  ++NWD  +A+FF++++++T GYG+  P++D GK FCI Y + GIP  ++  +AVV+R+ + V      L++ ++W  ++     +  V   F+   CFF IP+  F  +E   W+ L+S YFC ISL+TIGLGD +PG+G +   R   +I  T Y+  GL+A    +  F   H   K+    R ++  K+    D   I E     D LSF + +EQ+
Sbjct:   37 GAVVFSSVELPYEDLLRQELRKLKRRFLEEHECLSEPQLEQFLGRVLEASNYGVSVLSNASG-NWNWDFTSALFFASTVLSTTGYGHTVPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRVTVHVTR-RPVLYFHIRWGFSKQVVAIVHAVLLGFVTVSCFFFIPAAVFSVLE-DDWNFLESFYFCFISLSTIGLGDYVPGEGYNQKFRELYKIGITCYLLLGLIAMLVVLETFCELHELKKF----RKMFYVKKDKDEDLVHIME----HDQLSFSSVTEQV 308          
BLAST of Potassium channel subfamily K member vs. TrEMBL
Match: A0A1S3JIR4 (potassium channel subfamily K member 1 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106173627 PE=3 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 1.415e-43
Identity = 103/261 (39.46%), Postives = 154/261 (59.00%), Query Frame = 1
Query:  373 VGALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYKMQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTTXXXXXXXXXXXXXXAKRNSSRILATVYIFTGLLATSFCIRAFHRHPKWNLGDRFIYLYKESSPTDEFT 1155
            +G++ F  +E   E+++     K R EF+ NHSC+ D +LE LI KI   S RG++++ NAT E  NW    + FF+ +++TTIGYG+  P++D GK FCIFY + GIP+ +IM +A+VERL + V +    L  KMQ   +    R + +     ++ L  F+IP+  F  +E+ +W+ LDS Y+C IS+TTIGLGD IPG+ PD   R   +I  T+Y++ GL+     I   +  P+ NLG  F Y+    S   E T
Sbjct:   27 IGSVVFSALEGPMEQKEIDEIKKLRAEFLGNHSCISDAELERLIVKIVKYSERGVSAVRNATMEP-NWSFGQSFFFAGTVLTTIGYGHVAPLSDGGKAFCIFYALIGIPLTLIMFTAIVERLNIPVTVFLQYLLNKMQHLASPFHIRLVHLFLVIGLVLLFIFLIPAAIFTALEV-EWNYLDSFYYCFISMTTIGLGDYIPGEHPDQQSRTVYKIATTIYLYLGLIFMMLMIAVLYEIPELNLGIHF-YMATAGSGDGETT 284          
BLAST of Potassium channel subfamily K member vs. TrEMBL
Match: A0A1S3JIP3 (potassium channel subfamily K member 1 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106173627 PE=3 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 4.915e-43
Identity = 103/261 (39.46%), Postives = 154/261 (59.00%), Query Frame = 1
Query:  373 VGALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYKMQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTTXXXXXXXXXXXXXXAKRNSSRILATVYIFTGLLATSFCIRAFHRHPKWNLGDRFIYLYKESSPTDEFT 1155
            +G++ F  +E   E+++     K R EF+ NHSC+ D +LE LI KI   S RG++++ NAT E  NW    + FF+ +++TTIGYG+  P++D GK FCIFY + GIP+ +IM +A+VERL + V +    L  KMQ   +    R + +     ++ L  F+IP+  F  +E+ +W+ LDS Y+C IS+TTIGLGD IPG+ PD   R   +I  T+Y++ GL+     I   +  P+ NLG  F Y+    S   E T
Sbjct:   55 IGSVVFSALEGPMEQKEIDEIKKLRAEFLGNHSCISDAELERLIVKIVKYSERGVSAVRNATMEP-NWSFGQSFFFAGTVLTTIGYGHVAPLSDGGKAFCIFYALIGIPLTLIMFTAIVERLNIPVTVFLQYLLNKMQHLASPFHIRLVHLFLVIGLVLLFIFLIPAAIFTALEV-EWNYLDSFYYCFISMTTIGLGDYIPGEHPDQQSRTVYKIATTIYLYLGLIFMMLMIAVLYEIPELNLGIHF-YMATAGSGDGETT 312          
BLAST of Potassium channel subfamily K member vs. TrEMBL
Match: A0A3Q1H577 (Potassium channel subfamily K member OS=Anabas testudineus OX=64144 PE=3 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 6.135e-43
Identity = 83/212 (39.15%), Postives = 133/212 (62.74%), Query Frame = 1
Query:  316 KKSTFILFIYLIIFVSYLYVGALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYKMQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTT 951
            ++S     + ++ +V+YL +GA  F  IEL  E E R      RMEF+ N++CV + +LEEL+++    +  G++ LGN+T  + NWD  +++FF+++++TT GYG+  P+TD GK FCIFY +FGIP+ +   SAVV+R+ +LV       +++ +W ++++K   I  VC   I+   F IIP+  F  +E   W+ L+SLYFC ISL T
Sbjct:   17 RQSALSFALLVVGYVAYLIIGAGLFSAIELPYEHELRREMKAVRMEFLSNNTCVSEARLEELLARALEANNYGVSMLGNST--NRNWDFVSSLFFTSTVLTTTGYGHSVPLTDEGKAFCIFYSLFGIPVTLFFLSAVVQRIMVLVSH-RPVSYFQHRWAMSKSKLATIHAVCLAIIVTTVFLIIPAWIFITLE-KDWNFLESLYFCFISLAT 224          
BLAST of Potassium channel subfamily K member vs. TrEMBL
Match: A0A1S3JK27 (potassium channel subfamily K member 1 isoform X3 OS=Lingula unguis OX=7574 GN=LOC106173627 PE=3 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 5.718e-42
Identity = 108/275 (39.27%), Postives = 160/275 (58.18%), Query Frame = 1
Query:  343 YLIIFVSYLY---VGALCFRTIELGKEKEDRSAFYKFRMEFIKNH-SCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYKMQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTTXXXXXXXXXXXXXXAKRNSSRILATVYIFTGLLATSFCIRAFHRHPKWNLGDRFIYLYKESSPTDEFT 1155
            +LI+ VSY++   +GA  F  IE   E E      +FR +++  H SC+ D +LE LI KI   S RG++++ NAT E  NW    + FF+ +++TTIGYG+  P++D GK FCIFY + GIP+ +IM +A+VERL + V +    L  KMQ   +    R + +     ++ L  F+IP+  F  +E+ +W+ LDS Y+C IS+TTIGLGD IPG+ PD   R   +I  T+Y++ GL+     I   +  P+ NLG  F Y+    S   E T
Sbjct:    8 FLILVVSYVFFVVMGAAVFSAIEGQIENEKTKELREFRQDYLDLHKSCLTDAELERLIVKIVKYSERGVSAVRNATMEP-NWSFGQSFFFAGTVLTTIGYGHVAPLSDGGKAFCIFYALIGIPLTLIMFTAIVERLNIPVTVFLQYLLNKMQHLASPFHIRLVHLFLVIGLVLLFIFLIPAAIFTALEV-EWNYLDSFYYCFISMTTIGLGDYIPGEHPDQQSRTVYKIATTIYLYLGLIFMMLMIAVLYEIPELNLGIHF-YMATAGSGDGETT 279          
BLAST of Potassium channel subfamily K member vs. TrEMBL
Match: A0A3P8U4B5 (Potassium channel subfamily K member OS=Amphiprion percula OX=161767 PE=3 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 7.372e-42
Identity = 83/204 (40.69%), Postives = 126/204 (61.76%), Query Frame = 1
Query:  340 IYLIIFVSYLYVGALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYKMQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTT 951
            + ++ ++ YL VGA  F  IEL  E+E R    + R +F+    CV D +LEEL+++    S  G++ LGN T    NWD  +++FF+++++TT GYG+  P++D GK FCIFY +FGIP+ +   SAVV+RL +LV     + F++ +W +  +K   I   C   +L L FFI+P+  F  +E   W+ L+SLYFC ISLTT
Sbjct:   26 LLVVCYILYLIVGAGIFSAIELPYEQELREELKEARQDFLTESPCVSDARLEELLARALEASNYGVSVLGNDTGR--NWDFVSSLFFTSTVLTTTGYGHTVPLSDGGKAFCIFYTLFGIPVTLFFLSAVVQRLMVLVSRRPVSYFHR-RWAVDRSKLAVIHATCLAILLTLLFFIVPACIFVTLE-SDWNFLESLYFCFISLTT 225          
BLAST of Potassium channel subfamily K member vs. Ensembl Cavefish
Match: kcnk1b (potassium two pore domain channel subfamily K member 1 [Source:NCBI gene;Acc:103046790])

HSP 1 Score: 139.428 bits (350), Expect = 6.264e-37
Identity = 90/279 (32.26%), Postives = 155/279 (55.56%), Query Frame = 1
Query:  376 GALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYKMQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTTXXXXXXXXXXXXXXAKRNSSRILATVYIFTGLLATSFCIRAFHRHPKWNLGDRFIYLYKESSPTDEFTISESSTLSDPLSFHNSSEQ 1212
            GA+ F ++EL  E   R      + +F+ ++ C+ +++LEE +++    S  G++ L NA+A ++NWD  +++FF++++++T GYG+  P++D GK FCI Y + GIP  ++  +AVV+R+ ++       L+   +W +++     I      F+   CFF+IP+  F  +E   W+ L+S YFC ISL+TIGLGD +PG+  +   R   ++  TVY+  GL+A    +  F    +     +  YL KE  P D+  I E   L+     H +S Q
Sbjct:   37 GAVVFSSVELPYEDLLRQELRALKRQFLLDNECLSEERLEEFLARALDASNYGVSILNNASA-NWNWDFTSSLFFASTVLSTTGYGHTAPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRI-MVYSTRKPVLYVHTRWGLSKPLVALIHANLLAFVAVSCFFLIPAAIFSALE-ENWNFLESFYFCFISLSTIGLGDYVPGEAVNQRFRELYKLGITVYLLLGLIAMLVVLETFCELQQLKQLRKMFYLKKE-KPQDQQAIMEHDHLAFSSVDHATSPQ 311          
BLAST of Potassium channel subfamily K member vs. Ensembl Cavefish
Match: kcnk1b (potassium two pore domain channel subfamily K member 1 [Source:NCBI gene;Acc:103046790])

HSP 1 Score: 139.428 bits (350), Expect = 7.691e-37
Identity = 90/279 (32.26%), Postives = 155/279 (55.56%), Query Frame = 1
Query:  376 GALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYKMQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTTXXXXXXXXXXXXXXAKRNSSRILATVYIFTGLLATSFCIRAFHRHPKWNLGDRFIYLYKESSPTDEFTISESSTLSDPLSFHNSSEQ 1212
            GA+ F ++EL  E   R      + +F+ ++ C+ +++LEE +++    S  G++ L NA+A ++NWD  +++FF++++++T GYG+  P++D GK FCI Y + GIP  ++  +AVV+R+ ++       L+   +W +++     I      F+   CFF+IP+  F  +E   W+ L+S YFC ISL+TIGLGD +PG+  +   R   ++  TVY+  GL+A    +  F    +     +  YL KE  P D+  I E   L+     H +S Q
Sbjct:   37 GAVVFSSVELPYEDLLRQELRALKRQFLLDNECLSEERLEEFLARALDASNYGVSILNNASA-NWNWDFTSSLFFASTVLSTTGYGHTAPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRI-MVYSTRKPVLYVHTRWGLSKPLVALIHANLLAFVAVSCFFLIPAAIFSALE-ENWNFLESFYFCFISLSTIGLGDYVPGEAVNQRFRELYKLGITVYLLLGLIAMLVVLETFCELQQLKQLRKMFYLKKE-KPQDQQAIMEHDHLAFSSVDHATSPQ 311          
BLAST of Potassium channel subfamily K member vs. Ensembl Cavefish
Match: kcnk1a (potassium channel subfamily K member 1-like [Source:NCBI gene;Acc:103029028])

HSP 1 Score: 135.191 bits (339), Expect = 3.008e-35
Identity = 93/298 (31.21%), Postives = 165/298 (55.37%), Query Frame = 1
Query:  376 GALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFS----ALFYKMQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTTXXXXXXXXXXXXXXAKRNSSRILATVYIFTGLLATSFCIRAFHRHPKWNLGDRFIYLYKESSPTDEFTISES-----STLSDPL----SFHNSSEQLQSFPV 1230
            GA+ F  +E   E   R      + +F++++ C+ +++LE+ ++K    S  G++ L N T+ +YNWD  +A+FF++++++T GYG+  P++D GK FCI Y + GIP  ++  +AVV+R+     + FS      + + +W +++     +       I+  CFF+IP++ F  ME  +W+ L+S YFC ISL+TIGLGD +PG+G +   R   ++  TVY+  GL+A    +  F    +     +  YL KE +  D+  I +      +++SDP+    S +N  + +  F V
Sbjct:   37 GAVVFSLVESPYEDLLREELGTLKQQFLQDNDCLSEERLEQFLAKALEASNYGVSVL-NDTSTNYNWDFTSALFFASTVLSTTGYGHTVPLSDEGKAFCILYSVVGIPFTLLFLTAVVQRI-----MVFSTRRPVAYVQRRWALSKPLVSGVHAGLMALIVVSCFFLIPAIIFSVME-EEWNFLESFYFCFISLSTIGLGDYVPGEGYNQKFRQLYKVGITVYLLLGLIAMLVVLETFCELQQLKKLRKMFYLKKEITE-DQLNIVDHDHFSFASVSDPVASLYSMNNGDQSILFFNV 326          
BLAST of Potassium channel subfamily K member vs. Ensembl Cavefish
Match: kcnk1a (potassium channel subfamily K member 1-like [Source:NCBI gene;Acc:103029028])

HSP 1 Score: 135.191 bits (339), Expect = 3.155e-35
Identity = 89/281 (31.67%), Postives = 159/281 (56.58%), Query Frame = 1
Query:  376 GALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFS----ALFYKMQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTTXXXXXXXXXXXXXXAKRNSSRILATVYIFTGLLATSFCIRAFHRHPKWNLGDRFIYLYKESSPTDEFTISES-----STLSDPLS 1191
            GA+ F  +E   E   R      + +F++++ C+ +++LE+ ++K    S  G++ L N T+ +YNWD  +A+FF++++++T GYG+  P++D GK FCI Y + GIP  ++  +AVV+R+     + FS      + + +W +++     +       I+  CFF+IP++ F  ME  +W+ L+S YFC ISL+TIGLGD +PG+G +   R   ++  TVY+  GL+A    +  F    +     +  YL KE +  D+  I +      +++SDP++
Sbjct:   37 GAVVFSLVESPYEDLLREELGTLKQQFLQDNDCLSEERLEQFLAKALEASNYGVSVL-NDTSTNYNWDFTSALFFASTVLSTTGYGHTVPLSDEGKAFCILYSVVGIPFTLLFLTAVVQRI-----MVFSTRRPVAYVQRRWALSKPLVSGVHAGLMALIVVSCFFLIPAIIFSVME-EEWNFLESFYFCFISLSTIGLGDYVPGEGYNQKFRQLYKVGITVYLLLGLIAMLVVLETFCELQQLKKLRKMFYLKKEITE-DQLNIVDHDHFSFASVSDPVA 309          
BLAST of Potassium channel subfamily K member vs. Ensembl Cavefish
Match: kcnk6 (potassium two pore domain channel subfamily K member 6 [Source:NCBI gene;Acc:103034804])

HSP 1 Score: 130.568 bits (327), Expect = 8.615e-34
Identity = 91/262 (34.73%), Postives = 145/262 (55.34%), Query Frame = 1
Query:  313 PKKSTFILFIYLII-FVSYLYVGALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYKMQWKITENKYREIQIVCSFFIL----ALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTTXXXXXXXXXXXXXXAKRNSSRILATVYIFTGLLATSFCIRAFHR 1083
            P   +F+L   L++ +V YL +GAL F  IE   E    S     + + ++  SC+    LE+ + K+   +  G++ L N +    NWDL +++FF+ +LVTT+GYG+  P++D GK F I Y +FG+P  M++ +A V+R  L+  L +  + +   W+        +     F IL     L FF++P++ F  +E   WS L++ YFC ISL TIGLGD +PG+ PD + R   +I   VY+F GL+     +R FH+
Sbjct:    3 PFLRSFLLLGGLVLAYVVYLLLGALVFSAIERPVEDSLHSELSSLKAQILQ-LSCINASTLEDFLEKVLRANKYGVSVLRNVSVGS-NWDLASSLFFANTLVTTVGYGHTTPLSDAGKTFSIVYALFGVPFTMLVLTACVQR--LMRPLTYKPIAF---WQQRSGWQPHVAATGHFIILLLVVVLAFFVLPAVIFSTIE-ESWSFLEAFYFCFISLCTIGLGDFVPGEQPDQSLRPLYKISVMVYLFVGLMVMYLVLRTFHK 256          
BLAST of Potassium channel subfamily K member vs. Ensembl Sea Lamprey
Match: kcnk7 (potassium channel, subfamily K, member 7 [Source:ZFIN;Acc:ZDB-GENE-110304-2])

HSP 1 Score: 114.775 bits (286), Expect = 6.192e-29
Identity = 73/235 (31.06%), Postives = 124/235 (52.77%), Query Frame = 1
Query:  346 LIIFVSYLYVGALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLF------LLVDLCFSALFYKMQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTTXXXXXXXXXXXXXXAKRNSSRILATVY 1032
            L  +  YL +GA+ F T+E   E+  R    + R  F++ H+C+ D+ LE  +         G+++L NATA  + WD  +A+FF+++++TT+GYG+  P++D GK  CI Y + GIP  +++ +++V+RL        L  L  ++         +               +A+ FF++P+  F  +E   W  L + YFC ISL+T+GLGD +PG+      R   ++  TVY
Sbjct:   13 LATYALYLVLGAIVFSTLERPYEERLRMDVRRLRDAFVRQHACLSDEALEGFLRDALEARTHGVSALRNATAGPH-WDFVSALFFASTVLTTVGYGHTVPLSDAGKALCILYAVLGIPFTLLLLTSIVQRLMEHLTRRPLRSLAAASSSSSSPPPQSPELLAAAHAALLLACVAVLFFVVPAAVFASLE-EGWGFLGAFYFCFISLSTVGLGDYVPGEADRQPSRELYKVCVTVY 245          
BLAST of Potassium channel subfamily K member vs. Ensembl Sea Lamprey
Match: KCNK10 (potassium two pore domain channel subfamily K member 10 [Source:HGNC Symbol;Acc:HGNC:6273])

HSP 1 Score: 114.39 bits (285), Expect = 1.280e-28
Identity = 66/196 (33.67%), Postives = 108/196 (55.10%), Query Frame = 1
Query:  376 GALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYN-WDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYK-MQWKITENKYREIQIVCSFFILALC--FFIIPSLAFYKMELPKWSLLDSLYFCVISLTT 951
            GAL F+ +E   E   RS+    R++F+  H CV   ++  LI  ++     G++ L N T    + WDL +A FF+ +++TTIGYGN  P TD G+IFC  Y + GIP+   + + V ++L  +       +    M+W ++    R I  +   FI+  C  F ++P++ F  +EL  W+ L+++YF VI+LTT
Sbjct:   35 GALVFQALEQPFEMSQRSSMNAERVDFLVKHECVSRHEMMSLIQHVKDAISAGVDPLANNTNHSSSLWDLGSAFFFAGTVLTTIGYGNVSPSTDWGRIFCTAYALVGIPIFGFLLAGVGDQLGTIFGKAIGRVEKVFMKWHVSATWIRVISTI--IFIMMGCGLFVVLPTIIFMHIEL--WTPLEAIYFVVITLTT 226          
BLAST of Potassium channel subfamily K member vs. Ensembl Sea Lamprey
Match: KCNK16 (potassium two pore domain channel subfamily K member 16 [Source:HGNC Symbol;Acc:HGNC:14464])

HSP 1 Score: 98.5969 bits (244), Expect = 2.900e-23
Identity = 56/199 (28.14%), Postives = 95/199 (47.74%), Query Frame = 1
Query:  355 FVSYLYVGALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYKMQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTT 951
            +V+YL  GA  F+ +EL  E+  R         FI+NHSCV+D  L+  + ++      G+       +   NWD  +A+ F+ ++VTTIGYG+  P +  G+  C FY + GIP+ + + S       +      +  + +++    E K+    I    F++   F ++P       E   WS   SLY+  I+L+T
Sbjct:   12 YVAYLLAGAAVFQVLELPAEQNIRQRLTDSWAAFIQNHSCVDDGTLDLFLQEVLDARSHGVRVAAGQASSPSNWDFSSALLFTVTVVTTIGYGSTAPGSTWGRASCAFYALLGIPLNLQLLSRGAPT--VAAPTRAARRWLRLRGVRQEMKWSSWCIASVIFVVGKAFVLLPVAVLPVTE--GWSHAKSLYYAFITLST 206          
BLAST of Potassium channel subfamily K member vs. Ensembl Sea Lamprey
Match: KCNK16 (potassium two pore domain channel subfamily K member 16 [Source:HGNC Symbol;Acc:HGNC:14464])

HSP 1 Score: 92.0485 bits (227), Expect = 2.422e-21
Identity = 41/122 (33.61%), Postives = 66/122 (54.10%), Query Frame = 1
Query:  355 FVSYLYVGALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTS 720
            +V+YL  GA  F+ +EL  E+  R         FI+NHSCV+D  L+  + ++      G+       +   NWD  +A+ F+ ++VTTIGYG+  P +  G+  C FY + GIP+ + + S
Sbjct:   22 YVAYLLAGAAVFQVLELPAEQNIRQRLTDSWAAFIQNHSCVDDGTLDLFLQEVLDARSHGVRVAAGQASSPSNWDFSSALLFTVTVVTTIGYGSTAPGSTWGRASCAFYALLGIPLNLQLLS 143          
BLAST of Potassium channel subfamily K member vs. Ensembl Sea Lamprey
Match: kcnk13a (potassium channel, subfamily K, member 13a [Source:ZFIN;Acc:ZDB-GENE-080219-46])

HSP 1 Score: 65.0846 bits (157), Expect = 1.247e-11
Identity = 59/230 (25.65%), Postives = 95/230 (41.30%), Query Frame = 1
Query:  322 STFILFIYLIIFVSYLYVGALCFRTIELGKE--KEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYKMQWKITENKYREI------------------QIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTT 951
            + F L   LI+   YL  GA  F  +E   E   ++R   +  R+E    H  V    L+ L+   +  +  G+     A      WD   A +F  ++V+TIG+G   P T  GKIF IFY +FG    ++  +  +ERL  L+     +   +   ++     R+                    ++    I A+      S  F  +E   WS +DSLYFC ++ +T
Sbjct:   38 ARFALLAALIL--CYLLCGAAVFSALERPSELVAQER---WLHRLENFTQHFGVPRADLDALLRDFELGATAGVR----AAPLRPRWDFTGAFYFVGTVVSTIGFGMTTPTTVSGKIFLIFYGLFGCAAGILFFNLFLERLITLLACVMRSCHRRQINRLVIQPGRKASDQSDAIECLAGWKPSVYHVMMILGIAAVAIACSASAMFSAVE--GWSYVDSLYFCFVAFST 256          
BLAST of Potassium channel subfamily K member vs. Ensembl Nematostella
Match: EDO35592 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL44])

HSP 1 Score: 122.479 bits (306), Expect = 4.946e-32
Identity = 75/205 (36.59%), Postives = 113/205 (55.12%), Query Frame = 1
Query:  346 LIIFVSYLYVGALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYKMQWKITENKY-REIQIVCSFFILALCFFI--IPSLAFYKMELPKWSLLDSLYFCVISLTT 951
            +I+++ YL +GA  F +IE   E+         R  F+  + CV D +LEE I  I     +GI+ L N +    +W+  +A FF+ +++TTIGYGN  P++  GKIFCI Y +FGIPM  IM +A+VERL L  +     +      +     Y R + +  +F +L +  FI  +P+L F  M L  W+  ++ YFC ISLTT
Sbjct:    2 IIVYIFYLAIGAAIFSSIEGPYERRVVKNLIAKRDRFLARNPCVTDFELEEFIKDIVVARDQGISPLRNVSVP--SWEFGSAFFFAGTVITTIGYGNIAPLSSGGKIFCIVYALFGIPMTAIMLTAIVERLLLAAERVQELMAGSCTVRGIPASYLRMVHL--TFIMLVVLMFIMFVPALVF--MNLEGWNYFEAFYFCFISLTT 200          
BLAST of Potassium channel subfamily K member vs. Ensembl Nematostella
Match: EDO35923 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK42])

HSP 1 Score: 93.2041 bits (230), Expect = 1.123e-21
Identity = 60/202 (29.70%), Postives = 100/202 (49.50%), Query Frame = 1
Query:  364 YLYVGALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLF-LLVDLCFSALFYKMQWKITENKY-----REIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTT 951
            YL  GA  F+TIE G+E+ +R  F   R   I+ ++ + +K +  L  +I     + I+  G     +  W    ++FF+ ++VTTIGYG   P T  G++FCIFY IFGIP+  +M  ++ ER+   + D           W+I + +      + I +     + AL   ++  LA   +E   W+    +YF  I+L+T
Sbjct:    3 YLLFGAAVFQTIESGEERRERHHFEFVRQNLIEKYN-ISEKDMRNLFKEIS----KAIDE-GYFDVNYDRWSFAGSLFFTGTVVTTIGYGQMAPATVWGRVFCIFYAIFGIPITGLMLKSIGERITEGIADF----------WRIIDRRLFNRDPKSIHMKTVLTVFALVITMLLVLAALAVEYEGWTYFQGIYFGFITLST 188          
BLAST of Potassium channel subfamily K member vs. Ensembl Nematostella
Match: EDO33193 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSX6])

HSP 1 Score: 93.5893 bits (231), Expect = 1.373e-21
Identity = 61/202 (30.20%), Postives = 97/202 (48.02%), Query Frame = 1
Query:  358 VSYLYVGALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVE-DKKLEE--LISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYKMQWKITE-NKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTT 951
            +SYL VGA  F  +E   +++ RS   + +    + ++    D K  E  L++K             N  A  Y W    +V+F+T+++TTIGYG+  P T  GKIFC+ Y   GIP+ + M  ++ ER    +   F  L  K+  K T+ +    + +VC    + +    + S AF      KW    SLY+C I++TT
Sbjct:   16 LSYLLVGAAIFSALEYDADQKRRSMLVELQARLTRKYNITSTDLKSWEFFLVAK------------ANLKANLYQWSFAGSVYFATTVITTIGYGHTVPRTPRGKIFCMIYAAVGIPLALTMFQSIGERFNTFLACMFRRLKRKLGMKATDVSSTTNLVVVCGLLAMVI---TVSSGAFIFTHYEKWDYFHSLYYCFITVTT 202          
BLAST of Potassium channel subfamily K member vs. Ensembl Nematostella
Match: EDO47667 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLC4])

HSP 1 Score: 90.8929 bits (224), Expect = 3.789e-21
Identity = 51/202 (25.25%), Postives = 106/202 (52.48%), Query Frame = 1
Query:  346 LIIFVSYLYVGALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYKMQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTT 951
            + +F+SY+++GA+ F+ +E   E  +R A    R++F + ++ + D+ ++  + +I+ +   G +           W L  ++FF+ ++VTTIGYG+  P T  G++FCIFY + GIP+  ++ S + + +  ++      L+ +     +  +   + + C+     +   +I  +A +   L  WS  + +YF  I+LTT
Sbjct:    1 MALFLSYIFLGAVIFQALEAKNEMAERRAMSFARLKFQQRYN-ISDEDMKVFLERIEEIVDHGFSR-----EWSRRWSLLGSLFFAGTVVTTIGYGHVTPCTISGRVFCIFYALVGIPLTWLLLSTLAQGVNNMICASIRYLYDRF----SRTQPSRVGLKCALVTSCISMIMILIIATFAHYLEGWSFFNGIYFGFITLTT 192          
BLAST of Potassium channel subfamily K member vs. Ensembl Nematostella
Match: EDO47668 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLC5])

HSP 1 Score: 87.4261 bits (215), Expect = 3.705e-19
Identity = 55/206 (26.70%), Postives = 100/206 (48.54%), Query Frame = 1
Query:  334 LFIYLIIFVSYLYVGALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYKMQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTT 951
            L I    F+ YL +G + FR +E G EK++R    K  ++ I++   +  K+++E +  +Q  +     S G        W    ++FFS +++TTIGYG+  P T  G+IFC+ Y +FGIP+  +M +++ +++   +    S+            + +     C    + L F ++  +A   +    W+  +  YF  ISLTT
Sbjct:   12 LLIRSFFFILYLVMGMVVFRFLESGHEKKEREQVQK-DIQRIRHKFNISRKEMKEFVDVVQKAA-----SFGLTQDWLEKWSYTGSLFFSGTVITTIGYGHLSPETFFGRIFCMLYALFGIPITWLMLTSLGKKIVEHI----SSFLQGFSSSCCNTQSKSFNFFCLLAAIGLSFVVMVIVAIVGIFSENWTFFEGFYFAFISLTT 207          
BLAST of Potassium channel subfamily K member vs. Ensembl Medaka
Match: ENSORLT00000012559.2 (potassium channel subfamily K member 1-like [Source:NCBI gene;Acc:101155889])

HSP 1 Score: 154.836 bits (390), Expect = 2.575e-42
Identity = 82/213 (38.50%), Postives = 128/213 (60.09%), Query Frame = 1
Query:  316 KKSTFILFIYLII-FVSYLYVGALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYKMQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTT 951
            +  + I F +L++ ++ YL VGA  F  +EL  EKE R      R +F+ NH+CV D  L+ L+++    S  G++ LGN    H NWD  +++FF+++++TT GYG+  P++D GK FCIF+ + GIP+ +   S  VERL  L+     + F++ +W +++++   I       I+A+ F  IPS  F  +E  KW+ LDSLYFC ISLTT
Sbjct:   12 RHRSTINFAFLVVAYIFYLLVGAGIFSAVELPYEKELRDELKAIRRDFLSNHTCVSDAHLDNLLARALEASNYGVSVLGNNNTSH-NWDFVSSLFFASTVLTTTGYGHTVPLSDEGKGFCIFFSLLGIPVTLFFLSTCVERLVNLLSRRPVSYFHR-RWAMSKSRLALIHATVLAIIIAVLFIFIPSWIFVNLE-KKWNFLDSLYFCFISLTT 221          
BLAST of Potassium channel subfamily K member vs. Ensembl Medaka
Match: ENSORLT00000042015.1 (potassium channel subfamily K member 1-like [Source:NCBI gene;Acc:101155889])

HSP 1 Score: 154.066 bits (388), Expect = 4.379e-42
Identity = 82/213 (38.50%), Postives = 128/213 (60.09%), Query Frame = 1
Query:  316 KKSTFILFIYLII-FVSYLYVGALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYKMQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTT 951
            +  + I F +L++ ++ YL VGA  F  +EL  EKE R      R +F+ NH+CV D  L+ L+++    S  G++ LGN    H NWD  +++FF+++++TT GYG+  P++D GK FCIF+ + GIP+ +   S  VERL  L+     + F++ +W +++++   I       I+A+ F  IPS  F  +E  KW+ LDSLYFC ISLTT
Sbjct:   17 RHRSTINFAFLVVAYIFYLLVGAGIFSAVELPYEKELRDELKAIRRDFLSNHTCVSDAHLDNLLARALEASNYGVSVLGNNNTSH-NWDFVSSLFFASTVLTTTGYGHTVPLSDEGKGFCIFFSLLGIPVTLFFLSTCVERLVNLLSRRPVSYFHR-RWAMSKSRLALIHATVLAIIIAVLFIFIPSWIFVNLE-KKWNFLDSLYFCFISLTT 226          
BLAST of Potassium channel subfamily K member vs. Ensembl Medaka
Match: kcnk1b (potassium two pore domain channel subfamily K member 1 [Source:NCBI gene;Acc:101174617])

HSP 1 Score: 145.976 bits (367), Expect = 3.734e-39
Identity = 102/341 (29.91%), Postives = 178/341 (52.20%), Query Frame = 1
Query:  265 FESIKENKKSIRQLVFPKKSTFILFIYLIIFVSYLYVGALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYKMQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTTXXXXXXXXXXXXXXAKRNSSRILATVYIFTGLLATSFCIRAFHRHPKWNLGDRFIYLYKESSPTDEFTISES-----STLSDPLSFHNSSEQLQSFPVDPNAMYSNRAKRIR 1272
             +S+  N  S  +L+   KS +     ++ ++ YL  GA+ F ++EL  E   R      + +F++ + C+ +++LE  + K    S  G++ L NA+A ++NWD  +A+FF++++++T GYG+  P++D GK FCI Y + GIP  ++  +AVV+R+ +        ++   +W +++     +       +   CFF+IP+  F  +E   W+ L+S YFC ISL+TIGLGD +PG+  +   R   ++  TVY+  GL+     +  F    +     +  YL KE  P D   I E      +T+SD  + HN  E+ Q+F   P  +  N    I+
Sbjct:    2 LQSLASN--SCVRLIQNHKSMWYFLSLVLGYILYLIFGAVVFSSVELPYEDLLRQELRAIKRQFLQENDCLSEERLERFLKKALEASNYGVSILNNASA-NWNWDFTSALFFASTVLSTTGYGHTAPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRIMVFTTR-RPVVYIHTRWGLSKPLVAIVHATLLAMLAVSCFFLIPAAIFSALE-ENWNFLESFYFCFISLSTIGLGDYVPGEAANQKFRELYKVGITVYLILGLIVMLVVLETFCELQQLKQLRKMFYLRKE-KPQDRVHILEHDHLSFTTVSDSTAAHN-EEKTQTFVSVPTLVSPNDDPMIQ 335          
BLAST of Potassium channel subfamily K member vs. Ensembl Medaka
Match: kcnk1b (potassium two pore domain channel subfamily K member 1 [Source:NCBI gene;Acc:101174617])

HSP 1 Score: 143.665 bits (361), Expect = 1.825e-38
Identity = 99/325 (30.46%), Postives = 173/325 (53.23%), Query Frame = 1
Query:  265 FESIKENKKSIRQLVFPKKSTFILFIYLIIFVSYLYVGALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYKMQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTTXXXXXXXXXXXXXXAKRNSSRILATVYIFTGLLATSFCIRAFHRHPKWNLGDRFIYLYKESSPTDEFTISES-----STLSDPLSFHNSSEQLQSF 1224
             +S+  N  S  +L+   KS +     ++ ++ YL  GA+ F ++EL  E   R      + +F++ + C+ +++LE  + K    S  G++ L NA+A ++NWD  +A+FF++++++T GYG+  P++D GK FCI Y + GIP  ++  +AVV+R+ +        ++   +W +++     +       +   CFF+IP+  F  +E   W+ L+S YFC ISL+TIGLGD +PG+  +   R   ++  TVY+  GL+     +  F    +     +  YL KE  P D   I E      +T+SD  + HN  E+ Q+F
Sbjct:    2 LQSLASN--SCVRLIQNHKSMWYFLSLVLGYILYLIFGAVVFSSVELPYEDLLRQELRAIKRQFLQENDCLSEERLERFLKKALEASNYGVSILNNASA-NWNWDFTSALFFASTVLSTTGYGHTAPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRIMVFTTR-RPVVYIHTRWGLSKPLVAIVHATLLAMLAVSCFFLIPAAIFSALE-ENWNFLESFYFCFISLSTIGLGDYVPGEAANQKFRELYKVGITVYLILGLIVMLVVLETFCELQQLKQLRKMFYLRKE-KPQDRVHILEHDHLSFTTVSDSTAAHN-EEKTQTF 319          
BLAST of Potassium channel subfamily K member vs. Ensembl Medaka
Match: KCNK4 (potassium channel subfamily K member 4 [Source:NCBI gene;Acc:101166075])

HSP 1 Score: 138.658 bits (348), Expect = 1.434e-35
Identity = 80/212 (37.74%), Postives = 121/212 (57.08%), Query Frame = 1
Query:  346 LIIFVS---YLYVGALCFRTIELGKEK----EDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEH--YNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSAL-FYKMQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTT 951
            L IFV    YL +GA+ FRT+E+  E+    E      + R  F+ N SCVE + L + + K++ +    I  LG+++ E     WDL +A FFS +++TTIG+GN  P TD GK+FCIFY + GIPM  I+ + V + L  ++    + +    ++WK++    R I  + S  +  L F  +P L F ++E   W+LLDS YF VI+LTT
Sbjct:    7 LAIFVGVLLYLVLGAVVFRTLEIPNERKIQEESEKQLSRVREHFLGNFSCVEPESLLDFLQKVEEV----IEGLGSSSNETSFTKWDLASAFFFSGTIITTIGFGNISPQTDGGKLFCIFYALVGIPMFGILLAGVGDHLGTVLRKAIAKIELLFLKWKVSPTIVRVISAILSILLGCLVFVAVPILVFQEVE--GWTLLDSAYFVVITLTT 212          
BLAST of Potassium channel subfamily K member vs. Planmine SMEST
Match: SMESG000074840.1 (SMESG000074840.1)

HSP 1 Score: 746.503 bits (1926), Expect = 0.000e+0
Identity = 391/393 (99.49%), Postives = 393/393 (100.00%), Query Frame = 1
Query:  109 MLYHFNNVDNNDNDILSTSYRHVELEPIKYGNRNLALFRDPQKCLYLSFSEKFESIKENKKSIRQLVFPKKSTFILFIYLIIFVSYLYVGALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYKMQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTTXXXXXXXXXXXXXXAKRNSSRILATVYIFTGLLATSFCIRAFHRHPKWNLGDRFIYLYKESSPTDEFTISESSTLSDPLSFHNSSEQLQSFPVDPNAMYSNRAKRIRYNSFS 1287
            MLYHFNNVDNNDNDILSTSYRHVELEPIKYGNRNLALFRDPQKCLYLSFSEKFESIKENKKSIRQLVFPKKSTFILFIYLIIFVSYLYVGALCFRTIELGKEKEDRSAFYKFRMEF+KNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYKMQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTTIGLGDLIPGDGPDLAKRNSSR+LATVYIFTGLLATSFCIRAFHRHPKWNLGDRFIYLYKESSPTDEFTISESSTLSDPLSFHNSSEQLQSFPVDPNAMYSNRAKRIRYNSFS
Sbjct:    1 MLYHFNNVDNNDNDILSTSYRHVELEPIKYGNRNLALFRDPQKCLYLSFSEKFESIKENKKSIRQLVFPKKSTFILFIYLIIFVSYLYVGALCFRTIELGKEKEDRSAFYKFRMEFLKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYKMQWKITENKYREIQIVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTTIGLGDLIPGDGPDLAKRNSSRVLATVYIFTGLLATSFCIRAFHRHPKWNLGDRFIYLYKESSPTDEFTISESSTLSDPLSFHNSSEQLQSFPVDPNAMYSNRAKRIRYNSFS 393          
BLAST of Potassium channel subfamily K member vs. Planmine SMEST
Match: SMESG000057491.1 (SMESG000057491.1)

HSP 1 Score: 92.8189 bits (229), Expect = 5.967e-20
Identity = 55/216 (25.46%), Postives = 111/216 (51.39%), Query Frame = 1
Query:  316 KKSTFILFIYLIIFVSYLYVGALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATAEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYKMQWKITENKYREIQ----IVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTT 951
            K+        +++  +YL VGA  F  +E   E+  ++ F   + + +++++ +  K L+EL+  +  +      +          W    A +F+T+++TTIGYG+  P TD GKIFC+ Y + GIP+ ++M  ++ ER+    ++C +     ++ K+T++  +  Q    ++ S F+  +  F      +Y+     W+  +S+Y+C I+LTT
Sbjct:    2 KRQNVRTLALIVVTFTYLLVGAAIFDALESSHEENQKNEFEGIQDKLVRDYN-ITQKDLDELVKLVFKMKPFKAGT---------QWKFAGAFYFATTVITTIGYGHSTPKTDGGKIFCMIYALPGIPLTIVMFQSIGERM----NICITCFLQFLKRKLTKSTAKISQTKLILISSNFVSLVIIFGALIFTYYE----HWTFFNSVYYCFITLTT 199          
BLAST of Potassium channel subfamily K member vs. Planmine SMEST
Match: SMESG000024430.1 (SMESG000024430.1)

HSP 1 Score: 80.4925 bits (197), Expect = 4.344e-16
Identity = 68/252 (26.98%), Postives = 116/252 (46.03%), Query Frame = 1
Query:  574 WDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERL-----FLLVDLCFSALFYKMQWKI---TENKYR-------------------EIQ--------IVCSFFILALCFFIIPSLAFYKMELPKWSLLDSLYFCVISLTTXX-XXXXXXXXXXXXAKRNSSRILATVYIFTGLLATSFCIRAFHRHPKWNLGDRFIYLYKESSPTDEFTISESSTLSD---PLSFHNSSEQ 1212
            W+++N++FF  +++TTIGYGN  P+TD GKI  + Y IFGIP+M++  + V E +     F+ ++LC    F   + +I   TEN  +                   EI+        I  +  ++ L  +II     +++   +WS++D  YF  I+L TIG    +   DG + A+  +  I+  +Y   GL   S C+          +  +F +L  +    D+    +   L+D   P S+  S  Q
Sbjct:  126 WNIYNSIFFCVTIITTIGYGNITPLTDWGKINSMIYSIFGIPLMLLFLTNVGEIMATFFRFIYLNLCCCRCFISRRVEIVDSTENDKKLNIEGQPPPKINEGNHPDYEIEDDENVFVVIPITVVLIVLFIYIIVGACLFRIWEQEWSMVDGTYFSYITLATIGFGDFVPGKDGFEKAETGTELIVGGMYCLLGLAILSMCLNLIQDE----IASKFRWLGNKLGLIDDSDYLDKEELADDVEPFSYSTSQPQ 373          
BLAST of Potassium channel subfamily K member vs. Planmine SMEST
Match: SMESG000019203.1 (SMESG000019203.1)

HSP 1 Score: 64.6994 bits (156), Expect = 6.469e-11
Identity = 49/178 (27.53%), Postives = 81/178 (45.51%), Query Frame = 1
Query:  352 IFVSYLYVGALCFRTIELGKEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNATA---EH---------------------YNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERLFLLVDLCFSALFYKMQWKITENKYR 813
            + V+Y  +G   F  IE+  E        K +M+ ++N +   + KLE+++S            L N  A   EH                      NW    ++ +S +++TTIGYG+  P T LG+IF IFY IFGIP+ ++  + + + L  +  L +S L + +  K+   K R
Sbjct:   33 LVVAYTILGGFLFYNIEISGEIN-----VKNQMKIVRNET---ENKLEQILSSEMKADFNSSEILTNIRAILNEHERIFKENIFENGWNGRYEITENNWSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFRLVYSQLCHPLCMKLFTKKKR 202          
BLAST of Potassium channel subfamily K member vs. Planmine SMEST
Match: SMESG000016405.1 (SMESG000016405.1)

HSP 1 Score: 62.3882 bits (150), Expect = 3.461e-10
Identity = 31/77 (40.26%), Postives = 45/77 (58.44%), Query Frame = 1
Query:  574 WDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMMIMTSAVVERL-----FLLVDLCFSALFYKMQW 789
            W+L N++FF  +++TTIGYGN  P T  G+I CI Y   GIP+M++  S   E L     F+  +LC    F K ++
Sbjct:  118 WNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLCCCRCFVKGKY 194          
The following BLAST results are available for this feature:
BLAST of Potassium channel subfamily K member vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNK13.603e-3732.53potassium two pore domain channel subfamily K memb... [more]
KCNK25.226e-3333.89potassium two pore domain channel subfamily K memb... [more]
KCNK25.893e-3333.89potassium two pore domain channel subfamily K memb... [more]
KCNK26.225e-3333.89potassium two pore domain channel subfamily K memb... [more]
KCNK101.406e-3236.32potassium two pore domain channel subfamily K memb... [more]
back to top
BLAST of Potassium channel subfamily K member vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
twk-461.527e-2832.71Two pore potassium channel protein sup-9 [Source:... [more]
twk-461.931e-2532.60Two pore potassium channel protein sup-9 [Source:... [more]
twk-41.282e-1930.28TWiK family of potassium channels [Source:UniProt... [more]
twk-202.533e-1828.91Two pore potassium channel protein sup-9 [Source:... [more]
sup-94.122e-1728.16Two pore potassium channel protein sup-9 [Source:... [more]
back to top
BLAST of Potassium channel subfamily K member vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Task61.109e-1628.04gene:FBgn0038165 transcript:FBtr0301654[more]
Task61.109e-1628.04gene:FBgn0038165 transcript:FBtr0334494[more]
Task61.469e-1628.04gene:FBgn0038165 transcript:FBtr0334493[more]
Task61.469e-1628.04gene:FBgn0038165 transcript:FBtr0334492[more]
CG431558.920e-1428.57gene:FBgn0262685 transcript:FBtr0305607[more]
back to top
BLAST of Potassium channel subfamily K member vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnk63.223e-4031.50potassium channel, subfamily K, member 6 [Source:Z... [more]
kcnk1a4.684e-4031.96potassium channel, subfamily K, member 1a [Source:... [more]
kcnk1a4.684e-4031.96potassium channel, subfamily K, member 1a [Source:... [more]
kcnk1b3.706e-3931.31potassium channel, subfamily K, member 1b [Source:... [more]
kcnk1a6.576e-3632.16potassium channel, subfamily K, member 1a [Source:... [more]
back to top
BLAST of Potassium channel subfamily K member vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNK41.801e-3434.25potassium channel, two pore domain subfamily K, me... [more]
KCNK45.328e-3334.70potassium channel, two pore domain subfamily K, me... [more]
nkx3-24.460e-3232.75NK3 homeobox 2 [Source:Xenbase;Acc:XB-GENE-876834][more]
wnt2b5.602e-3229.47Wnt family member 2B [Source:Xenbase;Acc:XB-GENE-9... [more]
kcnk65.165e-3133.10potassium channel, two pore domain subfamily K, me... [more]
back to top
BLAST of Potassium channel subfamily K member vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kcnk15.114e-3733.22potassium channel, subfamily K, member 1 [Source:M... [more]
Kcnk15.793e-3733.22potassium channel, subfamily K, member 1 [Source:M... [more]
Kcnk22.468e-3333.47potassium channel, subfamily K, member 2 [Source:M... [more]
Kcnk22.541e-3333.47potassium channel, subfamily K, member 2 [Source:M... [more]
Kcnk22.560e-3333.47potassium channel, subfamily K, member 2 [Source:M... [more]
back to top
BLAST of Potassium channel subfamily K member vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Z2T2|KCNK1_RAT1.074e-3633.33Potassium channel subfamily K member 1 OS=Rattus n... [more]
sp|Q8R454|KCNK1_CAVPO1.226e-3632.98Potassium channel subfamily K member 1 OS=Cavia po... [more]
sp|Q5RD07|KCNK1_PONAB1.263e-3632.53Potassium channel subfamily K member 1 OS=Pongo ab... [more]
sp|O00180|KCNK1_HUMAN1.730e-3632.53Potassium channel subfamily K member 1 OS=Homo sap... [more]
sp|O08581|KCNK1_MOUSE4.052e-3633.22Potassium channel subfamily K member 1 OS=Mus musc... [more]
back to top
BLAST of Potassium channel subfamily K member vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JIR41.415e-4339.46potassium channel subfamily K member 1 isoform X2 ... [more]
A0A1S3JIP34.915e-4339.46potassium channel subfamily K member 1 isoform X1 ... [more]
A0A3Q1H5776.135e-4339.15Potassium channel subfamily K member OS=Anabas tes... [more]
A0A1S3JK275.718e-4239.27potassium channel subfamily K member 1 isoform X3 ... [more]
A0A3P8U4B57.372e-4240.69Potassium channel subfamily K member OS=Amphiprion... [more]
back to top
BLAST of Potassium channel subfamily K member vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnk1b6.264e-3732.26potassium two pore domain channel subfamily K memb... [more]
kcnk1b7.691e-3732.26potassium two pore domain channel subfamily K memb... [more]
kcnk1a3.008e-3531.21potassium channel subfamily K member 1-like [Sourc... [more]
kcnk1a3.155e-3531.67potassium channel subfamily K member 1-like [Sourc... [more]
kcnk68.615e-3434.73potassium two pore domain channel subfamily K memb... [more]
back to top
BLAST of Potassium channel subfamily K member vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnk76.192e-2931.06potassium channel, subfamily K, member 7 [Source:Z... [more]
KCNK101.280e-2833.67potassium two pore domain channel subfamily K memb... [more]
KCNK162.900e-2328.14potassium two pore domain channel subfamily K memb... [more]
KCNK162.422e-2133.61potassium two pore domain channel subfamily K memb... [more]
kcnk13a1.247e-1125.65potassium channel, subfamily K, member 13a [Source... [more]
back to top
BLAST of Potassium channel subfamily K member vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Potassium channel subfamily K member vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO355924.946e-3236.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO359231.123e-2129.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO331931.373e-2130.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476673.789e-2125.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476683.705e-1926.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Potassium channel subfamily K member vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000012559.22.575e-4238.50potassium channel subfamily K member 1-like [Sourc... [more]
ENSORLT00000042015.14.379e-4238.50potassium channel subfamily K member 1-like [Sourc... [more]
kcnk1b3.734e-3929.91potassium two pore domain channel subfamily K memb... [more]
kcnk1b1.825e-3830.46potassium two pore domain channel subfamily K memb... [more]
KCNK41.434e-3537.74potassium channel subfamily K member 4 [Source:NCB... [more]
back to top
BLAST of Potassium channel subfamily K member vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074840.10.000e+099.49SMESG000074840.1[more]
SMESG000057491.15.967e-2025.46SMESG000057491.1[more]
SMESG000024430.14.344e-1626.98SMESG000024430.1[more]
SMESG000019203.16.469e-1127.53SMESG000019203.1[more]
SMESG000016405.13.461e-1040.26SMESG000016405.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021920 ID=SMED30021920|Name=Potassium channel subfamily K member|organism=Schmidtea mediterranea sexual|type=transcript|length=1500bp
ATAAGTTAGTTTAAATTTCATAGTTAGAAATTGAATCGAAATCAGTTGTT
TTAAAATTTTATGAACAATATCCTAATTCAAACTTTGCATTCTGTTTTCA
ATTAGATTATGCTATACCATTTTAATAATGTTGATAACAATGACAATGAT
ATCCTGTCAACTTCGTATCGTCACGTGGAACTTGAACCAATAAAGTATGG
CAATAGAAATCTAGCACTATTTCGCGATCCTCAAAAGTGTCTCTATTTAT
CATTTTCTGAAAAATTTGAATCAATAAAAGAAAACAAAAAATCAATCAGA
CAACTAGTTTTCCCGAAAAAATCCACATTTATTTTATTCATTTATTTAAT
CATATTCGTATCGTATTTGTACGTGGGAGCCCTTTGTTTTAGAACAATAG
AATTGGGGAAAGAAAAAGAAGATAGATCTGCTTTCTATAAATTTCGTATG
GAATTTATAAAAAATCACAGCTGCGTTGAAGATAAGAAACTGGAAGAACT
TATTTCCAAAATTCAGGCACTTAGTGGTAGAGGAATAAATTCCTTGGGTA
ATGCAACGGCAGAACATTACAATTGGGATTTGTTTAATGCCGTATTTTTC
TCCACTAGCCTTGTGACCACAATAGGATATGGAAATGATAAACCAGTCAC
GGATTTGGGGAAAATATTTTGCATTTTCTATGTTATCTTTGGAATTCCAA
TGATGATGATTATGACATCAGCTGTTGTAGAGAGACTGTTTCTTTTAGTC
GATCTATGCTTCAGTGCTCTCTTTTATAAAATGCAATGGAAAATTACAGA
AAACAAATATCGAGAAATACAAATTGTCTGCAGCTTTTTTATTCTAGCTC
TCTGTTTTTTCATTATCCCTTCTTTAGCATTTTACAAAATGGAACTACCG
AAATGGTCTCTTTTGGATTCCCTTTATTTTTGTGTTATTTCGTTAACAAC
CATTGGCCTAGGTGATCTTATACCTGGAGATGGACCAGATTTAGCTAAAC
GAAACAGTTCAAGAATTTTAGCAACAGTGTATATTTTTACTGGATTATTG
GCAACTTCGTTTTGTATCCGTGCCTTTCATCGGCATCCCAAATGGAATCT
AGGTGACAGATTTATTTACCTTTACAAGGAATCTTCACCAACGGATGAAT
TCACGATCAGTGAGAGTTCGACTCTTTCAGACCCATTATCTTTCCATAAT
AGTTCCGAACAGTTGCAGTCGTTTCCTGTTGATCCAAATGCAATGTACTC
CAATCGTGCAAAAAGAATTAGATACAATAGTTTTTCTTGATCATAATATT
TAAAATTTATTTCAAAGTTCTTTAAGATGTGATATTATAAAATGTGTTTT
GTTTATTTTCCGTTTTATTGGACAATGTGAAACCTTAGGCAAGCTGCGGC
GCGAGGTCTCCTTTTTATAAAACTTAACGAAGTTCATTTTTGTGCCACCA
AATCGGTTGTGGTTTCTTTTGCTTGAAAATATATAACTTAATTTAAAAAG
back to top

protein sequence of SMED30021920-orf-1

>SMED30021920-orf-1 ID=SMED30021920-orf-1|Name=SMED30021920-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=394bp
MLYHFNNVDNNDNDILSTSYRHVELEPIKYGNRNLALFRDPQKCLYLSFS
EKFESIKENKKSIRQLVFPKKSTFILFIYLIIFVSYLYVGALCFRTIELG
KEKEDRSAFYKFRMEFIKNHSCVEDKKLEELISKIQALSGRGINSLGNAT
AEHYNWDLFNAVFFSTSLVTTIGYGNDKPVTDLGKIFCIFYVIFGIPMMM
IMTSAVVERLFLLVDLCFSALFYKMQWKITENKYREIQIVCSFFILALCF
FIIPSLAFYKMELPKWSLLDSLYFCVISLTTIGLGDLIPGDGPDLAKRNS
SRILATVYIFTGLLATSFCIRAFHRHPKWNLGDRFIYLYKESSPTDEFTI
SESSTLSDPLSFHNSSEQLQSFPVDPNAMYSNRAKRIRYNSFS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006813potassium ion transport
GO:0071805potassium ion transmembrane transport
GO:0006810transport
GO:0006811ion transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000028Category 2 cell
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR0054082pore_dom_K_chnl_TWIK
IPR0032802pore_dom_K_chnl
IPR013099K_chnl_dom
Vocabulary: molecular function
TermDefinition
GO:0005267potassium channel activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005408Two pore domain potassium channel, TWIK familyPRINTSPR01586TWIKCHANNELcoord: 136..152
score: 29.41
coord: 197..209
score: 34.62
coord: 122..134
score: 23.08
coord: 306..319
score: 38.1
coord: 289..302
score: 28.57
IPR003280Two pore domain potassium channelPRINTSPR013332POREKCHANELcoord: 167..195
score: 48.96
coord: 280..289
score: 64.17
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 67..327
e-value: 1.9E-63
score: 216.1
NoneNo IPR availablePANTHERPTHR11003POTASSIUM CHANNEL, SUBFAMILY Kcoord: 61..371
NoneNo IPR availablePANTHERPTHR11003:SF59POTASSIUM CHANNEL SUBFAMILY K MEMBER 1coord: 61..371
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 64..211
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 225..323
NoneNo IPR availableTMHMMTMhelixcoord: 266..288
NoneNo IPR availableTMHMMTMhelixcoord: 186..208
NoneNo IPR availableTMHMMTMhelixcoord: 72..94
NoneNo IPR availableTMHMMTMhelixcoord: 303..320
NoneNo IPR availableTMHMMTMhelixcoord: 237..259
IPR013099Potassium channel domainPFAMPF07885Ion_trans_2coord: 154..210
e-value: 3.5E-15
score: 55.7
coord: 247..323
e-value: 4.0E-16
score: 58.7