GCR001

Overview
NameGCR001
Smed IDSMED30021907
Length (bp)1810
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GCR001 (SMED30021907) t-SNE clustered cells

Violin plots show distribution of expression levels for GCR001 (SMED30021907) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GCR001 (SMED30021907) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GCR001 (SMED30021907) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021907

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30021907h1SMcG0004817 SmedASXL_011421SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30021907h1SMcG0004817 dd_Smed_v4_18195_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30021907h1SMcG0004817 dd_Smed_v4_18195_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30021907h1SMcG0004817 dd_Smed_v4_18195_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30021907h1SMcG0004817 dd_Smed_v6_18195_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GCR001 vs. Ensembl Human
Match: ADRB2 (adrenoceptor beta 2 [Source:HGNC Symbol;Acc:HGNC:286])

HSP 1 Score: 142.124 bits (357), Expect = 2.723e-36
Identity = 74/181 (40.88%), Postives = 112/181 (61.88%), Query Frame = 1
Query:  247 VGVLFGILVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISF-PAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPL 786
            +G++  ++VL  + GN+LVI ++     L+T+TN+FI SLACADL+MG  V+PF A + +    W FG  WC+ W + DVL  TASI  LC+IA++R++A  +P  Y S ++  +  V+I +VW+ S L SF P  + W+    Q+    I      T C+F  ++AY I SS +SFY+PL
Sbjct:   36 MGIVMSLIVLAIVFGNVLVITAIAKFERLQTVTNYFITSLACADLVMGLAVVPFGA-AHILMKMWTFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYFAITSPFKYQSLLTKNKARVIILMVWIVSGLTSFLPIQMHWYRATHQE---AINCYANETCCDFFTNQAYAIASSIVSFYVPL 212          

HSP 2 Score: 81.2629 bits (199), Expect = 8.652e-16
Identity = 40/87 (45.98%), Postives = 56/87 (64.37%), Query Frame = 1
Query: 1261 KKFKKFA-REQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFGQSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHILC 1518
            ++  KF  +E KA KTLGI+MG F +CWLPFF+ NI+  + +    +    V I++ W+GY+NS  NP+IY  S  DFR AF  +LC
Sbjct:  259 RRSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIQDNLIRKE---VYILLNWIGYVNSGFNPLIYCRS-PDFRIAFQELLC 341          
BLAST of GCR001 vs. Ensembl Human
Match: DRD1 (dopamine receptor D1 [Source:HGNC Symbol;Acc:HGNC:3020])

HSP 1 Score: 137.502 bits (345), Expect = 1.753e-34
Identity = 75/170 (44.12%), Postives = 111/170 (65.29%), Query Frame = 1
Query:  289 GNILVIVSVIMERNLRT-ITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISF-PAILWWHVME--SQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPL 786
            GN LV  +VI  R+LR+ +TNFF++SLA +DLL+  +VMP+ A +E+ AG+W FG  +C++W AFD++ STASILNLC+I+++R+WA  +P  Y  +M+ K   ++I++ W  S LISF P  L WH  +  S  +     L +    C+    + Y I SS ISFYIP+
Sbjct:   40 GNTLVCAAVIRFRHLRSKVTNFFVISLAVSDLLVAVLVMPWKAVAEI-AGFWPFG-SFCNIWVAFDIMCSTASILNLCVISVDRYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTSPSDGNATSLAETIDNCDSSLSRTYAISSSVISFYIPV 207          

HSP 2 Score: 69.3218 bits (168), Expect = 7.562e-12
Identity = 38/90 (42.22%), Postives = 51/90 (56.67%), Query Frame = 1
Query: 1276 FAREQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFGQS---KGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHIL-C-GLCP 1530
            F RE K  KTL ++MG+F+ CWLPFF+ N +         Q          V  W G+ NS++NP+IYA +  DFR+AF  +L C  LCP
Sbjct:  264 FKRETKVLKTLSVIMGVFVCCWLPFFILNCILPFCGSGETQPFCIDSNTFDVFVWFGWANSSLNPIIYAFNA-DFRKAFSTLLGCYRLCP 352          
BLAST of GCR001 vs. Ensembl Human
Match: ADRB1 (adrenoceptor beta 1 [Source:HGNC Symbol;Acc:HGNC:285])

HSP 1 Score: 135.576 bits (340), Expect = 1.484e-33
Identity = 74/185 (40.00%), Postives = 113/185 (61.08%), Query Frame = 1
Query:  238 TYFVGVLFGILVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISFPAIL--WWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPL 786
            T  +G+L  ++VL  ++GN+LVIV++     L+T+TN FI+SLA ADL+MG +V+PF A + +  G W +G  +C+LW + DVL  TASI  LC+IA++R+ A  +P  Y S ++  R   ++  VW  S+L+SF  IL  WW     +         +    C+F  ++AY I SS +SFY+PL
Sbjct:   58 TAGMGLLMALIVLLIVAGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGA-TIVVWGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARGLVCTVWAISALVSFLPILMHWWRAESDEARRC----YNDPKCCDFVTNRAYAIASSVVSFYVPL 237          

HSP 2 Score: 87.0409 bits (214), Expect = 2.154e-17
Identity = 45/99 (45.45%), Postives = 60/99 (60.61%), Query Frame = 1
Query: 1222 KKRYKRSVSISLGKKFKKFAREQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFGQSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHILC 1518
            K+R  R V++          REQKA KTLGI+MG+F +CWLPFF+ N++ A + E        + +   WLGY NSA NP+IY  S  DFR+AF  +LC
Sbjct:  308 KRRPSRLVAL----------REQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRELVPDR---LFVFFNWLGYANSAFNPIIYCRS-PDFRKAFQGLLC 392          
BLAST of GCR001 vs. Ensembl Human
Match: ADRA1D (adrenoceptor alpha 1D [Source:HGNC Symbol;Acc:HGNC:280])

HSP 1 Score: 135.576 bits (340), Expect = 3.925e-33
Identity = 74/221 (33.48%), Postives = 122/221 (55.20%), Query Frame = 1
Query:  136 AENNYQSSTASETRFLLMNSNGDTNSSLIGPGM----GTYFVGVLFGILVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISFPAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPL 786
             E+N  S+    +      + GD N +    G+        VGV     +L  ++GN+LVI+SV   R+L+T+TN+FIV+LA ADLL+   V+PFSA  E+  G+W FG  +CD+W A DVL  TASIL+LC I+++R+    + + Y + M+ ++   ++A++W+ + ++S   +L W          K  +      C   ++  Y + SS  SFY+P+
Sbjct:   62 GEDNRSSAGEPGS----AGAGGDVNGTAAVGGLVVSAQGVGVGVFLAAFILMAVAGNLLVILSVACNRHLQTVTNYFIVNLAVADLLLSATVLPFSATMEV-LGFWAFGRAFCDVWAAVDVLCCTASILSLCTISVDRYVGVRHSLKYPAIMTERKAAAILALLWVVALVVSVGPLLGW----------KEPVPPDERFCGITEEAGYAVFSSVCSFYLPM 267          

HSP 2 Score: 87.0409 bits (214), Expect = 2.368e-17
Identity = 42/84 (50.00%), Postives = 59/84 (70.24%), Query Frame = 1
Query: 1252 SLGKKFKKFAREQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFGQSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAF 1503
            SL  +  KF+RE+KAAKTL IV+G+F++CW PFF    L +++ +    S+GV  ++  WLGY NS VNP+IY  S R+F+RAF
Sbjct:  332 SLSVRLLKFSREKKAAKTLAIVVGVFVLCWFPFFFVLPLGSLFPQ-LKPSEGVFKVIF-WLGYFNSCVNPLIYPCSSREFKRAF 413          
BLAST of GCR001 vs. Ensembl Human
Match: ADRA1A (adrenoceptor alpha 1A [Source:HGNC Symbol;Acc:HGNC:277])

HSP 1 Score: 129.798 bits (325), Expect = 1.083e-32
Identity = 68/181 (37.57%), Postives = 110/181 (60.77%), Query Frame = 1
Query:  244 FVGVLFGILVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISFPAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPL 786
             +GV+ G L+L  + GNILVI+SV   R+L ++T+++IV+LA ADLL+   V+PFSA  E+  GYW FG  +C++W A DVL  TASI+ LC+I+I+R+     P+ Y + ++ +R ++ +  VW  S +IS   +  W     +            T+C+  ++  Y++ S+  SFY+PL
Sbjct:   28 LLGVILGGLILFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEV-LGYWAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDE----------TICQINEEPGYVLFSALGSFYLPL 197          

HSP 2 Score: 53.1434 bits (126), Expect = 7.801e-7
Identity = 21/31 (67.74%), Postives = 28/31 (90.32%), Query Frame = 1
Query: 1264 KFKKFAREQKAAKTLGIVMGIFIICWLPFFV 1356
            +  KF+RE+KAAKTLGIV+G F++CWLPFF+
Sbjct:  260 RLLKFSREKKAAKTLGIVVGCFVLCWLPFFL 290          
BLAST of GCR001 vs. Ensembl Celegans
Match: dop-4 (Dopamine receptor 4 [Source:UniProtKB/Swiss-Prot;Acc:Q18775])

HSP 1 Score: 152.525 bits (384), Expect = 1.356e-39
Identity = 74/178 (41.57%), Postives = 117/178 (65.73%), Query Frame = 1
Query:  253 VLFGILVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISFPAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPL 786
             LF I +LT ++GN LV+++V  ++ LR  T + I+SLA ADL++G +VMP ++  E++   W+FG   CD++HA D+L+STASI NLC+I+++R+ A ++PI Y  ++S +R ++ I  VW+ S+++SFP I+WW             L +  + C F D K Y+  SS +SFYIPL
Sbjct:   48 ALFSICLLT-VAGNCLVVIAVCTKKYLRNPTGYLIISLAIADLIVGVIVMPMNSLFEIANHTWLFGLMMCDVFHAMDILASTASIWNLCVISLDRYMAGQDPIGYRDKVSKRRILMAILSVWVLSAILSFPGIIWWRTSSPH-------LYEDQSQCLFTDSKMYVSFSSLVSFYIPL 217          

HSP 2 Score: 88.1965 bits (217), Expect = 3.802e-18
Identity = 40/86 (46.51%), Postives = 56/86 (65.12%), Query Frame = 1
Query: 1258 GKKFKKFAREQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFGQSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHIL 1515
             ++  ++  EQ+AA+TL IV+G FI+CW PFFV   L+A     F  +K  +   VTW G++NS +NP+IY+   RDFRRAF  IL
Sbjct:  394 SRQMMRYVHEQRAARTLSIVVGAFILCWTPFFVFTPLTAFCESCFS-NKETIFTFVTWAGHLNSMLNPLIYSRFSRDFRRAFKQIL 478          
BLAST of GCR001 vs. Ensembl Celegans
Match: tyra-3 (TYRAmine receptor [Source:UniProtKB/TrEMBL;Acc:Q2L6V9])

HSP 1 Score: 119.013 bits (297), Expect = 4.162e-28
Identity = 70/188 (37.23%), Postives = 102/188 (54.26%), Query Frame = 1
Query:  229 GMGTYFVGVLFGILVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISFPA--ILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPL 786
            G+   F+ +   +L+L TI GNILV++SV++ + +RT TN  + SLA ADLL+G +VMP S    L    W  G   C +W   DVL  TASILNLC+I+++R++A  +P+ Y    S K    ++  VW  S ++  P   I  W++     N T          C +    AY I S+  SFY+PL
Sbjct:   68 GIHDVFIALFLVMLILLTIFGNILVVLSVVVYKRMRTFTNILLTSLATADLLVGLIVMPMSLLDLLHNHRWPLGRFLCRMWATSDVLLCTASILNLCVISLDRYFAITSPLKYPRTRSRKMAAGLLTAVWAISFVVCSPPWVIPSWNLFIDNNNNTG---SSEDFKCAYSPSVAYRIYSALGSFYLPL 252          

HSP 2 Score: 68.5514 bits (166), Expect = 6.380e-12
Identity = 38/93 (40.86%), Postives = 53/93 (56.99%), Query Frame = 1
Query: 1258 GKKFKK-FAREQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFGQSK--GVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHILCGLC 1527
            G K K  + RE+KA KT+GIV+  FIICW+PFF+  ++    ++   +S    +      WLGY NS +NP+IY     DFRR F  +L   C
Sbjct:  452 GSKEKMVYMRERKALKTIGIVVLGFIICWMPFFIMYLVEVFISDPVAESPIYRITSEFFLWLGYSNSVLNPIIYTMYNGDFRRCFRDLLSFGC 544          
BLAST of GCR001 vs. Ensembl Celegans
Match: tyra-3 (TYRAmine receptor [Source:UniProtKB/TrEMBL;Acc:Q2L6V9])

HSP 1 Score: 118.627 bits (296), Expect = 7.432e-28
Identity = 70/188 (37.23%), Postives = 102/188 (54.26%), Query Frame = 1
Query:  229 GMGTYFVGVLFGILVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISFPA--ILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPL 786
            G+   F+ +   +L+L TI GNILV++SV++ + +RT TN  + SLA ADLL+G +VMP S    L    W  G   C +W   DVL  TASILNLC+I+++R++A  +P+ Y    S K    ++  VW  S ++  P   I  W++     N T          C +    AY I S+  SFY+PL
Sbjct:   96 GIHDVFIALFLVMLILLTIFGNILVVLSVVVYKRMRTFTNILLTSLATADLLVGLIVMPMSLLDLLHNHRWPLGRFLCRMWATSDVLLCTASILNLCVISLDRYFAITSPLKYPRTRSRKMAAGLLTAVWAISFVVCSPPWVIPSWNLFIDNNNNTG---SSEDFKCAYSPSVAYRIYSALGSFYLPL 280          

HSP 2 Score: 68.9366 bits (167), Expect = 5.893e-12
Identity = 38/93 (40.86%), Postives = 53/93 (56.99%), Query Frame = 1
Query: 1258 GKKFKK-FAREQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFGQSK--GVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHILCGLC 1527
            G K K  + RE+KA KT+GIV+  FIICW+PFF+  ++    ++   +S    +      WLGY NS +NP+IY     DFRR F  +L   C
Sbjct:  480 GSKEKMVYMRERKALKTIGIVVLGFIICWMPFFIMYLVEVFISDPVAESPIYRITSEFFLWLGYSNSVLNPIIYTMYNGDFRRCFRDLLSFGC 572          
BLAST of GCR001 vs. Ensembl Celegans
Match: ser-2 (Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-Prot;Acc:O02213])

HSP 1 Score: 116.316 bits (290), Expect = 1.127e-27
Identity = 65/178 (36.52%), Postives = 105/178 (58.99%), Query Frame = 1
Query:  253 VLFGILVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISFPAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPL 786
            + + +++  T+ GN LV+V+V   R L+ + N+F+VSLA +DL +   VMP    + L+ G W+ G   C  +   D+L  T+SILNLC IA++R+WA  NPI Y  + + K   ++I IVW+ S LIS P I+ W+      N  + ++ D    C    +KA+++ S+  SF++PL
Sbjct:   51 ITYLVIIAMTVVGNTLVVVAVFSYRPLKKVQNYFLVSLAASDLAVAIFVMPLHVVTFLAGGKWLLGVTVCQFFTTADILLCTSSILNLCAIALDRYWAIHNPINYAQKRTTKFVCIVIVIVWILSMLISVPPIIGWN------NWQENMMEDS---CGLSTEKAFVVFSAAGSFFLPL 219          

HSP 2 Score: 72.7886 bits (177), Expect = 2.123e-13
Identity = 37/93 (39.78%), Postives = 55/93 (59.14%), Query Frame = 1
Query: 1279 AREQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFGQSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHILCGLCPLRSQIFRLT 1557
            A+E++AAKT+ +++ +F  CWLPFFV  ++          +K  V    TWLGYINS++NP +Y     +FRRAF  ILC    L  +  R++
Sbjct:  328 AKEKRAAKTIAVIIFVFSFCWLPFFVAYVIRPFCETCKLHAK--VEQAFTWLGYINSSLNPFLYGILNLEFRRAFKKILCPKAVLEQRRRRMS 418          
BLAST of GCR001 vs. Ensembl Celegans
Match: ser-2 (Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-Prot;Acc:O02213])

HSP 1 Score: 116.316 bits (290), Expect = 1.201e-27
Identity = 65/178 (36.52%), Postives = 105/178 (58.99%), Query Frame = 1
Query:  253 VLFGILVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISFPAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPL 786
            + + +++  T+ GN LV+V+V   R L+ + N+F+VSLA +DL +   VMP    + L+ G W+ G   C  +   D+L  T+SILNLC IA++R+WA  NPI Y  + + K   ++I IVW+ S LIS P I+ W+      N  + ++ D    C    +KA+++ S+  SF++PL
Sbjct:   62 ITYLVIIAMTVVGNTLVVVAVFSYRPLKKVQNYFLVSLAASDLAVAIFVMPLHVVTFLAGGKWLLGVTVCQFFTTADILLCTSSILNLCAIALDRYWAIHNPINYAQKRTTKFVCIVIVIVWILSMLISVPPIIGWN------NWQENMMEDS---CGLSTEKAFVVFSAAGSFFLPL 230          

HSP 2 Score: 72.7886 bits (177), Expect = 2.005e-13
Identity = 37/93 (39.78%), Postives = 55/93 (59.14%), Query Frame = 1
Query: 1279 AREQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFGQSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHILCGLCPLRSQIFRLT 1557
            A+E++AAKT+ +++ +F  CWLPFFV  ++          +K  V    TWLGYINS++NP +Y     +FRRAF  ILC    L  +  R++
Sbjct:  339 AKEKRAAKTIAVIIFVFSFCWLPFFVAYVIRPFCETCKLHAK--VEQAFTWLGYINSSLNPFLYGILNLEFRRAFKKILCPKAVLEQRRRRMS 429          
BLAST of GCR001 vs. Ensembl Fly
Match: Dop1R2 (gene:FBgn0266137 transcript:FBtr0085467)

HSP 1 Score: 177.178 bits (448), Expect = 3.719e-48
Identity = 110/216 (50.93%), Postives = 139/216 (64.35%), Query Frame = 1
Query:  280 TISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISFPAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPLXXXXXXXXXXXXXXXXXXXXXXXXXKIVYKNSQSGEV-LRLGIHRGG 924
            T+ GN LVI++VI ER L T TN+FI SLA AD L+G VVMPFSA  E+    W FG  WCD+W + DVL STASILNLC+I+++R+WA  +P +Y  RM+ KR   +IA VW+CSS ISFPAI+WW      +             C F +   YL+ SSTISFY+PL++M+  Y RIYR A    ++L  GTK V     SGE+ L L IHRGG
Sbjct:  122 TVFGNSLVILAVIRERYLHTATNYFITSLAVADCLVGLVVMPFSALYEVLENTWFFGTDWCDIWRSLDVLFSTASILNLCVISLDRYWAITDPFSYPMRMTVKRAAGLIAAVWICSSAISFPAIVWWRAARDGEM--------PAYKCTFTEHLGYLVFSSTISFYLPLLVMVFTYCRIYRAAVIQTRSLKIGTKQVLM--ASGELQLTLRIHRGG 327          

HSP 2 Score: 97.8265 bits (242), Expect = 4.415e-21
Identity = 46/78 (58.97%), Postives = 58/78 (74.36%), Query Frame = 1
Query: 1303 TLGIVMGIFIICWLPFFVCNILSAVYNEAFGQSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHILCGLCPLR 1536
            TLGIVMG+FIICWLPFFV N+LS    E   + + +V  +VTWLG+INS +NP+IYA   RDFRRAF+ +LC  CP +
Sbjct:  420 TLGIVMGVFIICWLPFFVVNLLSGFCIECI-EHEEIVSAIVTWLGWINSCMNPVIYACWSRDFRRAFVRLLCMCCPRK 496          
BLAST of GCR001 vs. Ensembl Fly
Match: Dop1R2 (gene:FBgn0266137 transcript:FBtr0085468)

HSP 1 Score: 176.792 bits (447), Expect = 4.887e-48
Identity = 110/217 (50.69%), Postives = 139/217 (64.06%), Query Frame = 1
Query:  280 TISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISFPAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPLXXXXXXXXXXXXXXXXXXXXXXXXXKIVYKNSQSGEV-LRLGIHRGGV 927
            T+ GN LVI++VI ER L T TN+FI SLA AD L+G VVMPFSA  E+    W FG  WCD+W + DVL STASILNLC+I+++R+WA  +P +Y  RM+ KR   +IA VW+CSS ISFPAI+WW      +             C F +   YL+ SSTISFY+PL++M+  Y RIYR A    ++L  GTK V     SGE+ L L IHRGG 
Sbjct:  122 TVFGNSLVILAVIRERYLHTATNYFITSLAVADCLVGLVVMPFSALYEVLENTWFFGTDWCDIWRSLDVLFSTASILNLCVISLDRYWAITDPFSYPMRMTVKRAAGLIAAVWICSSAISFPAIVWWRAARDGEM--------PAYKCTFTEHLGYLVFSSTISFYLPLLVMVFTYCRIYRAAVIQTRSLKIGTKQVLM--ASGELQLTLRIHRGGT 328          

HSP 2 Score: 97.8265 bits (242), Expect = 4.375e-21
Identity = 46/76 (60.53%), Postives = 57/76 (75.00%), Query Frame = 1
Query: 1303 TLGIVMGIFIICWLPFFVCNILSAVYNEAFGQSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHILCGLCP 1530
            TLGIVMG+FIICWLPFFV N+LS    E   + + +V  +VTWLG+INS +NP+IYA   RDFRRAF+ +LC  CP
Sbjct:  420 TLGIVMGVFIICWLPFFVVNLLSGFCIECI-EHEEIVSAIVTWLGWINSCMNPVIYACWSRDFRRAFVRLLCMCCP 494          
BLAST of GCR001 vs. Ensembl Fly
Match: Dop1R2 (gene:FBgn0266137 transcript:FBtr0330293)

HSP 1 Score: 177.563 bits (449), Expect = 4.705e-47
Identity = 110/217 (50.69%), Postives = 139/217 (64.06%), Query Frame = 1
Query:  280 TISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISFPAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPLXXXXXXXXXXXXXXXXXXXXXXXXXKIVYKNSQSGEV-LRLGIHRGGV 927
            T+ GN LVI++VI ER L T TN+FI SLA AD L+G VVMPFSA  E+    W FG  WCD+W + DVL STASILNLC+I+++R+WA  +P +Y  RM+ KR   +IA VW+CSS ISFPAI+WW      +             C F +   YL+ SSTISFY+PL++M+  Y RIYR A    ++L  GTK V     SGE+ L L IHRGG 
Sbjct:  122 TVFGNSLVILAVIRERYLHTATNYFITSLAVADCLVGLVVMPFSALYEVLENTWFFGTDWCDIWRSLDVLFSTASILNLCVISLDRYWAITDPFSYPMRMTVKRAAGLIAAVWICSSAISFPAIVWWRAARDGEMPAY--------KCTFTEHLGYLVFSSTISFYLPLLVMVFTYCRIYRAAVIQTRSLKIGTKQVLM--ASGELQLTLRIHRGGT 328          

HSP 2 Score: 98.2117 bits (243), Expect = 5.477e-21
Identity = 46/78 (58.97%), Postives = 58/78 (74.36%), Query Frame = 1
Query: 1303 TLGIVMGIFIICWLPFFVCNILSAVYNEAFGQSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHILCGLCPLR 1536
            TLGIVMG+FIICWLPFFV N+LS    E   + + +V  +VTWLG+INS +NP+IYA   RDFRRAF+ +LC  CP +
Sbjct:  420 TLGIVMGVFIICWLPFFVVNLLSGFCIECI-EHEEIVSAIVTWLGWINSCMNPVIYACWSRDFRRAFVRLLCMCCPRK 496          
BLAST of GCR001 vs. Ensembl Fly
Match: Octbeta1R (gene:FBgn0038980 transcript:FBtr0100322)

HSP 1 Score: 147.902 bits (372), Expect = 1.254e-38
Identity = 82/200 (41.00%), Postives = 125/200 (62.50%), Query Frame = 1
Query:  193 SNGDTNSSLIGPGMGTYFVGV-LFGILVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISFPAIL--WWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIP 783
            S G T+ +     +   FV   + G ++L  I GN+LVIVSV+  R LR ITN+F+VSLA AD+L+    M F+A S + +G W+FG   CD+W++FDV  STASI++LC I+++R++A   P+ Y   M+ +R  +M+ +VW+  +L+SF  I   W+   E+ K L          +CEF  +KAY I+SS++SF+IP
Sbjct:   91 SEGSTDDADGSSHLALVFVKCFIIGFIILAAILGNMLVIVSVMRHRKLRIITNYFVVSLAVADMLVALCAMTFNA-SVMISGKWMFGSVMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWLSPALLSFLPICSGWYTTTENYKYLKS-----NPHICEFKVNKAYAIVSSSMSFWIP 284          

HSP 2 Score: 80.4925 bits (197), Expect = 8.783e-16
Identity = 37/74 (50.00%), Postives = 56/74 (75.68%), Query Frame = 1
Query: 1282 REQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFGQSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAF 1503
            RE+KAA+TLGI+M  F+ICWLPFF+  I+S++ +     +  +++ ++ W+GY NSA+NP+IYA+  RDFR AF
Sbjct:  344 RERKAARTLGIIMSAFLICWLPFFLWYIVSSLCDSCI--TPRLLVGILFWIGYFNSALNPIIYAYFNRDFRAAF 415          
BLAST of GCR001 vs. Ensembl Fly
Match: Octbeta1R (gene:FBgn0038980 transcript:FBtr0301484)

HSP 1 Score: 147.902 bits (372), Expect = 1.750e-38
Identity = 82/200 (41.00%), Postives = 125/200 (62.50%), Query Frame = 1
Query:  193 SNGDTNSSLIGPGMGTYFVGV-LFGILVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISFPAIL--WWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIP 783
            S G T+ +     +   FV   + G ++L  I GN+LVIVSV+  R LR ITN+F+VSLA AD+L+    M F+A S + +G W+FG   CD+W++FDV  STASI++LC I+++R++A   P+ Y   M+ +R  +M+ +VW+  +L+SF  I   W+   E+ K L          +CEF  +KAY I+SS++SF+IP
Sbjct:   91 SEGSTDDADGSSHLALVFVKCFIIGFIILAAILGNMLVIVSVMRHRKLRIITNYFVVSLAVADMLVALCAMTFNA-SVMISGKWMFGSVMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWLSPALLSFLPICSGWYTTTENYKYLKS-----NPHICEFKVNKAYAIVSSSMSFWIP 284          

HSP 2 Score: 82.8037 bits (203), Expect = 1.807e-16
Identity = 40/84 (47.62%), Postives = 61/84 (72.62%), Query Frame = 1
Query: 1282 REQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFGQSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAF---IHILCGL 1524
            RE+KAA+TLGI+M  F+ICWLPFF+  I+S++ +     +  +++ ++ W+GY NSA+NP+IYA+  RDFR AF   + + CGL
Sbjct:  344 RERKAARTLGIIMSAFLICWLPFFLWYIVSSLCDSCI--TPRLLVGILFWIGYFNSALNPIIYAYFNRDFRAAFKKTLKVSCGL 425          
BLAST of GCR001 vs. Ensembl Zebrafish
Match: drd6b (dopamine receptor D6b [Source:ZFIN;Acc:ZDB-GENE-121214-145])

HSP 1 Score: 141.739 bits (356), Expect = 8.394e-37
Identity = 89/203 (43.84%), Postives = 125/203 (61.58%), Query Frame = 1
Query:  187 MNSNG-DTNSSLIGPGMGTYFVGVLFGILVLTTISGNILVIVSVIMERNLRT-ITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISF-PAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPL 786
            M S+G + NSS +G    T   G     L+L+T+ GN LV  +VI  R+LR+ +TNFF++SLA +DL +  +VMP+ A SE+ AG W+FG  +CD W AFD++ STASILNLC+I+++R+WA  +P  Y  +M+ +   +MI + W  S LISF P  L WH      NLT       +  C    ++ Y I SS ISFYIP+
Sbjct:    1 MESDGAERNSSGVGVRALT---GCALCALILSTLLGNTLVCAAVIKFRHLRSKVTNFFVISLAVSDLFVAVLVMPWKAVSEV-AGCWLFG-GFCDTWIAFDIMCSTASILNLCIISLDRYWAISSPFRYERKMTQRMAFIMIGMAWTLSVLISFIPVKLNWH-RAVDHNLTV-----PSEDCTASLNRTYAIASSLISFYIPV 192          

HSP 2 Score: 72.0182 bits (175), Expect = 4.948e-13
Identity = 41/91 (45.05%), Postives = 54/91 (59.34%), Query Frame = 1
Query: 1252 SLGKKFKKFAREQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFGQSKGV---VMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHIL 1515
            SL   FKK   E K  KTL I+MG+F+ CWLPFFV N +   + +  G S  V      +  W G+ NS++NP+IYA +  DFR+AF  IL
Sbjct:  234 SLKSTFKK---ETKVLKTLSIIMGVFVFCWLPFFVLNCI-VPFCDTLGDSPCVSSTTFNIFVWFGWANSSLNPVIYAFNA-DFRKAFSTIL 319          
BLAST of GCR001 vs. Ensembl Zebrafish
Match: adrb1 (adrenoceptor beta 1 [Source:ZFIN;Acc:ZDB-GENE-081022-145])

HSP 1 Score: 141.739 bits (356), Expect = 1.311e-36
Identity = 80/180 (44.44%), Postives = 116/180 (64.44%), Query Frame = 1
Query:  247 VGVLFGILVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISFPAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPL 786
            +G+L G++V   + GNILVIV++   + L+T+TN FIVSLACADL+MG +V+PF A  E+  G W++G  +C+ W + DVL  TASI  LC+IAI+R+ A  +P  Y S ++  R  V++  VW  S+L+SFP IL    M   ++  +    +    C+F  ++AY I SS ISFYIPL
Sbjct:   31 MGILMGLIVFVIVVGNILVIVAIARNQRLQTLTNVFIVSLACADLIMGLLVVPFGAALEVR-GAWMYGSFFCEFWISLDVLCVTASIETLCVIAIDRYIAIISPFRYQSLLTKARAKVVVCAVWAISALVSFPPIL----MHWSQDSEETSCYENPECCDFVTNRAYAISSSIISFYIPL 205          

HSP 2 Score: 84.7297 bits (208), Expect = 3.622e-17
Identity = 40/87 (45.98%), Postives = 57/87 (65.52%), Query Frame = 1
Query: 1282 REQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFGQSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHILCGLCPLRSQ 1542
            +EQKA KTLGI+MG F +CWLPFF+ N++     +   +    + + + WLGY+NSA NP+IY  S  DFR+AF  +LC  CP ++ 
Sbjct:  255 KEQKALKTLGIIMGTFTLCWLPFFIVNVVRVFCAQVVDKE---LFVFLNWLGYVNSAFNPIIYCRS-PDFRKAFKRLLC--CPRQAD 335          
BLAST of GCR001 vs. Ensembl Zebrafish
Match: adrb1 (adrenoceptor beta 1 [Source:ZFIN;Acc:ZDB-GENE-081022-145])

HSP 1 Score: 141.739 bits (356), Expect = 1.311e-36
Identity = 80/180 (44.44%), Postives = 116/180 (64.44%), Query Frame = 1
Query:  247 VGVLFGILVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISFPAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPL 786
            +G+L G++V   + GNILVIV++   + L+T+TN FIVSLACADL+MG +V+PF A  E+  G W++G  +C+ W + DVL  TASI  LC+IAI+R+ A  +P  Y S ++  R  V++  VW  S+L+SFP IL    M   ++  +    +    C+F  ++AY I SS ISFYIPL
Sbjct:   31 MGILMGLIVFVIVVGNILVIVAIARNQRLQTLTNVFIVSLACADLIMGLLVVPFGAALEVR-GAWMYGSFFCEFWISLDVLCVTASIETLCVIAIDRYIAIISPFRYQSLLTKARAKVVVCAVWAISALVSFPPIL----MHWSQDSEETSCYENPECCDFVTNRAYAISSSIISFYIPL 205          

HSP 2 Score: 84.7297 bits (208), Expect = 3.622e-17
Identity = 40/87 (45.98%), Postives = 57/87 (65.52%), Query Frame = 1
Query: 1282 REQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFGQSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHILCGLCPLRSQ 1542
            +EQKA KTLGI+MG F +CWLPFF+ N++     +   +    + + + WLGY+NSA NP+IY  S  DFR+AF  +LC  CP ++ 
Sbjct:  255 KEQKALKTLGIIMGTFTLCWLPFFIVNVVRVFCAQVVDKE---LFVFLNWLGYVNSAFNPIIYCRS-PDFRKAFKRLLC--CPRQAD 335          
BLAST of GCR001 vs. Ensembl Zebrafish
Match: AL935174.4 (pep chromosome:GRCz11:17:23255365:23262007:1 gene:ENSDARG00000115129.1 transcript:ENSDART00000180277.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL935174.4)

HSP 1 Score: 140.584 bits (353), Expect = 3.313e-36
Identity = 79/182 (43.41%), Postives = 120/182 (65.93%), Query Frame = 1
Query:  247 VGVLFGILVLTTISGNILVIVSVIMERNLRT-ITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISF-PAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPL 786
            +G +  +L+++T+ GN LV  +V+  R+LR+ +TNFF++SLA +DL +  +VMP+ A S + AG W+FG  +C +W AFD++ STASILNLC+I+++R+WA  +P  Y  +M+H+   +MI + W  S LISF P  L WH M +  N T     D +  C+   ++ Y I SS ISFYIP+
Sbjct:   34 LGFVLFLLIVSTLLGNTLVCAAVVKFRHLRSKVTNFFVISLAVSDLFVAVLVMPWEAISAV-AGTWLFG-RFCGIWIAFDIMCSTASILNLCIISVDRYWAIASPFRYERKMTHRVAFMMIGVAWTLSILISFIPVQLNWH-MGAGGNGT-----DYSDNCKANLNRTYAISSSLISFYIPV 207          

HSP 2 Score: 69.3218 bits (168), Expect = 3.735e-12
Identity = 40/89 (44.94%), Postives = 51/89 (57.30%), Query Frame = 1
Query: 1252 SLGKKFKKFAREQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFGQS-KGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHIL 1515
            SL   FKK   E K  KTL I+MG+F+ CWLPFFV N +       F Q        +  W G+ NS++NP+IYA +  DFR+AF  IL
Sbjct:  252 SLKTTFKK---ETKVLKTLSIIMGVFVFCWLPFFVLNCMV-----PFCQCVSDTTFTIFVWFGWANSSLNPVIYAFNA-DFRKAFSSIL 331          
BLAST of GCR001 vs. Ensembl Zebrafish
Match: AL935174.5 (pep chromosome:GRCz11:CHR_ALT_CTG17_2_4:23255365:23262007:1 gene:ENSDARG00000115467.1 transcript:ENSDART00000183328.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL935174.5)

HSP 1 Score: 140.584 bits (353), Expect = 3.313e-36
Identity = 79/182 (43.41%), Postives = 120/182 (65.93%), Query Frame = 1
Query:  247 VGVLFGILVLTTISGNILVIVSVIMERNLRT-ITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISF-PAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPL 786
            +G +  +L+++T+ GN LV  +V+  R+LR+ +TNFF++SLA +DL +  +VMP+ A S + AG W+FG  +C +W AFD++ STASILNLC+I+++R+WA  +P  Y  +M+H+   +MI + W  S LISF P  L WH M +  N T     D +  C+   ++ Y I SS ISFYIP+
Sbjct:   34 LGFVLFLLIVSTLLGNTLVCAAVVKFRHLRSKVTNFFVISLAVSDLFVAVLVMPWEAISAV-AGTWLFG-RFCGIWIAFDIMCSTASILNLCIISVDRYWAIASPFRYERKMTHRVAFMMIGVAWTLSILISFIPVQLNWH-MGAGGNGT-----DYSDNCKANLNRTYAISSSLISFYIPV 207          

HSP 2 Score: 69.3218 bits (168), Expect = 3.735e-12
Identity = 40/89 (44.94%), Postives = 51/89 (57.30%), Query Frame = 1
Query: 1252 SLGKKFKKFAREQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFGQS-KGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHIL 1515
            SL   FKK   E K  KTL I+MG+F+ CWLPFFV N +       F Q        +  W G+ NS++NP+IYA +  DFR+AF  IL
Sbjct:  252 SLKTTFKK---ETKVLKTLSIIMGVFVFCWLPFFVLNCMV-----PFCQCVSDTTFTIFVWFGWANSSLNPVIYAFNA-DFRKAFSSIL 331          
BLAST of GCR001 vs. Ensembl Xenopus
Match: DRD1 (dopamine receptor D1 [Source:NCBI gene;Acc:100485463])

HSP 1 Score: 144.436 bits (363), Expect = 5.445e-37
Identity = 82/185 (44.32%), Postives = 121/185 (65.41%), Query Frame = 1
Query:  244 FVGVLFGILVLTTISGNILVIVSVIMERNLRT-ITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISF-PAILWWHVMESQKNLT-KILLVDRT-TLCEFPDDKAYLIISSTISFYIPL 786
              G    +L+L+T+ GN LV  +VI  R+LR+ +TNFF++SLA +DLL+  +VMP+ A +E+ AG+W FG  +C++W AFD++ STASILNLC+I+++R+WA  +P  Y  +M+ K   +MI++ W  S LISF P  L WH  ++       I L  RT   C+   ++ Y I SS ISFYIP+
Sbjct:   15 LTGCFLSVLILSTLLGNTLVCAAVIRFRHLRSKVTNFFVISLAVSDLLVAVLVMPWKAVAEI-AGFWPFG-TFCNIWVAFDIMCSTASILNLCVISVDRYWAISSPFRYERKMTPKVAFIMISVAWTLSILISFIPVQLNWHKAKTTSFFDLNITLHGRTMDNCDSSLNRTYAISSSLISFYIPV 197          

HSP 2 Score: 73.559 bits (179), Expect = 2.949e-13
Identity = 40/112 (35.71%), Postives = 60/112 (53.57%), Query Frame = 1
Query: 1276 FAREQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFGQS-------KGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHIL-C-GLCPLRSQIFRLTRADVNRNVI 1584
            F RE K  KTL ++MG+F+ CWLPFF+ N +    + +   S             V  W G+ NS++NP+IYA +  DFR+AF ++L C  LCP  + +      + N  V+
Sbjct:  254 FKRETKVLKTLSVIMGVFVCCWLPFFILNCIVPFCDPSLTTSGTEPFCISSTTFDVFVWFGWANSSLNPIIYAFNA-DFRKAFSNLLGCYRLCPTSNNVIETVSINNNGAVV 364          
BLAST of GCR001 vs. Ensembl Xenopus
Match: prrc2c (proline-rich coiled-coil 2C [Source:Xenbase;Acc:XB-GENE-984671])

HSP 1 Score: 141.354 bits (355), Expect = 4.166e-36
Identity = 81/214 (37.85%), Postives = 127/214 (59.35%), Query Frame = 1
Query:  148 YQSSTASETRFLLMNSNGDTNSSLIGPGMGTYFVGVLFGILVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISF-PAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPL 786
            Y +ST  +   L+ N +  +N+S          +G++   +VL  + GN+LVI ++   + L+T+TN+FI SLACADLLMG +V+PF A S +    W+F   WC+ W + D+L  TASI  LC+IA++R++A  +P  Y S ++  +  ++I +VW+ S+L SF P  + W+ +E +  L      D  + C F  + AY I SS ISFY+PL
Sbjct:   10 YPNSTLEQ---LVSNVSNTSNASDKPGDAWMVGMGIIMSCIVLVIVLGNVLVITAIAKFQRLQTVTNYFITSLACADLLMGLIVVPFGA-SSIILDTWVFNNFWCEFWTSVDILCVTASIETLCVIAVDRYFAITSPFRYQSLLTKCKARIVILLVWVVSTLTSFLPIYMHWYRIEEESALH---CYDDPSCCFFFTNPAYAISSSIISFYLPL 216          

HSP 2 Score: 78.5666 bits (192), Expect = 7.209e-15
Identity = 42/88 (47.73%), Postives = 56/88 (63.64%), Query Frame = 1
Query: 1258 GKKFKKF-AREQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFGQSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHILC 1518
             K+  KF  +E KA KTLGI+MG F +CWLPFF+ NI+  ++ + F   K  V   + W+GY+NSA NP+IY  S  DFR  F  +LC
Sbjct:  259 NKRTSKFWLKEHKALKTLGIIMGTFTLCWLPFFIVNIVQVMHKD-FIPVK--VYNFLNWVGYVNSAFNPLIYCRS-PDFRYTFQELLC 342          
BLAST of GCR001 vs. Ensembl Xenopus
Match: llgl2 (LLGL2, scribble cell polarity complex component [Source:Xenbase;Acc:XB-GENE-868478])

HSP 1 Score: 140.969 bits (354), Expect = 5.969e-36
Identity = 77/204 (37.75%), Postives = 118/204 (57.84%), Query Frame = 1
Query:  178 FLLMNSNGDTNSSLIGPGMGTYFVGVLFGILVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISF-PAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPL 786
            F  +   G+  +  I P      VG L  ++ L T  GN +V +  ++E+ LRT+T  FI+SLA ADLL+ C+VMPFS   E++ G W+FG  +C +W +FDV+  TASI+ LC I+++R+ +   P  Y  RMS +RCI+M   +W+ SSLISF P +  W+ +            D    C F  +  + I++S+++FYIP 
Sbjct:   37 FSFLRREGNRTALEIAPQQVA--VGSLLTVIDLITFLGNAVVFICPVVEKRLRTVTYMFIMSLAMADLLVACLVMPFSIIYEVT-GMWLFGKQFCKVWISFDVMFCTASIVTLCFISLDRYCSVVTPYHYSKRMSRRRCIIMTVTIWVYSSLISFLPVMQGWNEIPGVDT-------DNGKQCIFVTNWTFAIVASSLAFYIPF 230          

HSP 2 Score: 77.0258 bits (188), Expect = 2.146e-14
Identity = 37/90 (41.11%), Postives = 54/90 (60.00%), Query Frame = 1
Query: 1258 GKKFKKFAREQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFGQSKGVVMI----VVTWLGYINSAVNPMIYAHSMRDFRRAFIHIL 1515
             K+      E KA +T+GI++ +F++CWLP+FV N+L A        S   V++     +TWLGY NS +NPM+YA   RDF+RA   +L
Sbjct:  264 SKRQNNLQLENKATRTMGIIISVFVMCWLPYFVLNVLIAAKGT---DSTSRVLVNAFKFITWLGYCNSTINPMLYAFLNRDFQRALKKLL 350          
BLAST of GCR001 vs. Ensembl Xenopus
Match: crtam (cytotoxic and regulatory T cell molecule [Source:Xenbase;Acc:XB-GENE-962112])

HSP 1 Score: 141.739 bits (356), Expect = 6.176e-36
Identity = 90/212 (42.45%), Postives = 129/212 (60.85%), Query Frame = 1
Query:  169 ETRFLLMNS----NGDTNSSLIGPGMGTYFVGVLFGILVLTTISGNILVIVSVIMERNLRT-ITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISF-PAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPL 786
            E+  +LMNS           L+    G    G L  +L+  T+ GNILV  +V+  R+LR  +TN FIVSLA +DLL+  +VMP+ A +E+ AG+W FG  +CD+W AFD++ STASILNLC+I+++R+WA  +P  Y  +M+ +  ++MI+  W  S LISF P  L WH  E+  +L   L    T  C+   ++ Y I SS ISFYIP+
Sbjct:   17 ESPEMLMNSTVSHESQQRKELVA---GQIVTGSLLLLLIFWTLFGNILVCTAVMRFRHLRNRVTNIFIVSLAVSDLLVALLVMPWKAVAEV-AGHWPFGA-FCDIWVAFDIMCSTASILNLCVISVDRYWAISSPFRYERKMTQRVALLMISAAWALSVLISFIPVQLSWHKSETDDHL---LSNQSTGNCDSSLNRTYAISSSLISFYIPV 220          

HSP 2 Score: 67.781 bits (164), Expect = 2.319e-11
Identity = 37/98 (37.76%), Postives = 53/98 (54.08%), Query Frame = 1
Query: 1252 SLGKKFKKFAREQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFGQSKG-------VVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHIL-CG 1521
            SL    KK   E K  KTL I+MG+F+ CWLPFF+ N +    + + G  +            +  W G+ NS++NP+IYA +  DFR+ F  +L CG
Sbjct:  267 SLKTSIKK---ETKVLKTLSIIMGVFVCCWLPFFILNCMVPFCDRSSGHPQAGLPCVSETTFDIFVWFGWANSSLNPIIYAFNA-DFRKVFSSLLGCG 360          
BLAST of GCR001 vs. Ensembl Xenopus
Match: snrpa1 (small nuclear ribonucleoprotein polypeptide A' [Source:Xenbase;Acc:XB-GENE-1007226])

HSP 1 Score: 142.124 bits (357), Expect = 6.662e-36
Identity = 76/167 (45.51%), Postives = 114/167 (68.26%), Query Frame = 1
Query:  292 NILVIVSVIMERNLRT-ITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISF-PAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPL 786
            N LV ++VI  R+LR+ +TNFF++SLA +DL +  +VMP+ A +E+ AGYW+FG  +CD W AFD++ STASILNLC+I+++R+WA  +P  Y  +M+ +   +MI + W  S LISF P  L WH  +SQ+   ++  ++ T  C+   ++ Y I SS ISFYIP+
Sbjct:   46 NTLVCLAVIKFRHLRSKVTNFFVISLAVSDLFVALLVMPWKAVTEV-AGYWLFG-DFCDTWVAFDIMCSTASILNLCIISLDRYWAIASPFRYERKMTQRVAFIMIGVAWTLSILISFIPVQLSWH--KSQEVDEELNAINHTENCDSSLNRTYAISSSLISFYIPV 208          

HSP 2 Score: 68.5514 bits (166), Expect = 1.291e-11
Identity = 36/88 (40.91%), Postives = 52/88 (59.09%), Query Frame = 1
Query: 1276 FAREQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAF-GQSKG-------VVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHIL 1515
            F +E K  KTL I+MG+F+ CWLPFFV N +    + +  GQ++            +  W G+ NS++NP+IYA +  DFR+AF  IL
Sbjct:  256 FRKETKVLKTLSIIMGVFVFCWLPFFVLNCMIPFCHMSLPGQNEPEPPCVSETTFNIFVWFGWANSSLNPVIYAFNA-DFRKAFTTIL 342          
BLAST of GCR001 vs. Ensembl Mouse
Match: Drd5 (dopamine receptor D5 [Source:MGI Symbol;Acc:MGI:94927])

HSP 1 Score: 142.51 bits (358), Expect = 4.487e-36
Identity = 82/200 (41.00%), Postives = 121/200 (60.50%), Query Frame = 1
Query:  229 GMGTYFVGVLFGILVLTTISGNILVIVSVIMERNLRT-ITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISF-PAILWWHVMESQKNLTKILLVD------------RTTLCEFPDDKAYLIISSTISFYIPL 786
            G        L  +L++ T+ GN+LV  +++  R+LR  +TN FIVSLA +DL +  +VMP+ A +E+ AGYW FG  +CD+W AFD++ STASILNLC+I+++R+WA   P  Y  +M+ +  +VM+A+ W  S LISF P  L WH  ++     + LL +            RT  C+   ++ Y I SS ISFYIP+
Sbjct:   35 GPAQVVTAGLLTLLIVWTLLGNVLVCAAIVRSRHLRAKMTNIFIVSLAVSDLFVALLVMPWKAVAEV-AGYWPFG-AFCDIWVAFDIMCSTASILNLCIISVDRYWAISRPFRYERKMTQRVALVMVALAWTLSILISFIPVQLNWHRDKAGSQGREGLLSNETPWEEGWELDGRTENCDSSLNRTYAISSSLISFYIPV 232          

HSP 2 Score: 64.3142 bits (155), Expect = 2.140e-10
Identity = 33/86 (38.37%), Postives = 49/86 (56.98%), Query Frame = 1
Query: 1282 REQKAAKTLGIVMGIFIICWLPFFVCNILSAV--YNEAFGQSKGVVMIVVT------WLGYINSAVNPMIYAHSMRDFRRAFIHIL 1515
            +E K  KTL ++MG+F+ CWLPFF+ N +       +A G   G   +  T      W G+ NS++NP+IYA +  DFR+ F  +L
Sbjct:  284 KETKVFKTLSVIMGVFVCCWLPFFILNCMVPFCSSGDAQGPRTGFPCVSETTFDIFVWFGWANSSLNPIIYAFNA-DFRKVFAQLL 368          
BLAST of GCR001 vs. Ensembl Mouse
Match: Adrb2 (adrenergic receptor, beta 2 [Source:MGI Symbol;Acc:MGI:87938])

HSP 1 Score: 140.584 bits (353), Expect = 7.632e-36
Identity = 75/181 (41.44%), Postives = 111/181 (61.33%), Query Frame = 1
Query:  247 VGVLFGILVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISF-PAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPL 786
            + +L  ++VL  + GN+LVI ++     L+T+TN+FI+SLACADL+MG  V+PF A S +    W FG  WC+ W + DVL  TASI  LC+IA++R+ A  +P  Y S ++  +  V+I +VW+ S L SF P  + W+    +K    I      T C+F  ++AY I SS +SFY+PL
Sbjct:   36 MAILMSVIVLAIVFGNVLVITAIAKFERLQTVTNYFIISLACADLVMGLAVVPFGA-SHILMKMWNFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYVAITSPFKYQSLLTKNKARVVILMVWIVSGLTSFLPIQMHWYRATHKK---AIDCYTEETCCDFFTNQAYAIASSIVSFYVPL 212          

HSP 2 Score: 83.9593 bits (206), Expect = 8.399e-17
Identity = 42/87 (48.28%), Postives = 57/87 (65.52%), Query Frame = 1
Query: 1261 KKFKKFA-REQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFGQSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHILC 1518
            ++  KF  +E KA KTLGI+MG F +CWLPFF+ NI+  + +    +    V I++ WLGY+NSA NP+IY  S  DFR AF  +LC
Sbjct:  259 RRSSKFCLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIRDNLIPKE---VYILLNWLGYVNSAFNPLIYCRS-PDFRIAFQELLC 341          
BLAST of GCR001 vs. Ensembl Mouse
Match: Drd1 (dopamine receptor D1 [Source:MGI Symbol;Acc:MGI:99578])

HSP 1 Score: 134.806 bits (338), Expect = 1.104e-33
Identity = 78/175 (44.57%), Postives = 114/175 (65.14%), Query Frame = 1
Query:  289 GNILVIVSVIMERNLRT-ITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISF-PAILWWHVMESQKNLTKILLVDRTTLCEFPDD-------KAYLIISSTISFYIPL 786
            GN LV  +VI  R+LR+ +TNFF++SLA +DLL+  +VMP+ A +E+ AG+W FG  +C++W AFD++ STASILNLC+I+++R+WA  +P  Y  +M+ K   ++I++ W  S LISF P  L WH    +   T  L  + T+L +  DD       + Y I SS ISFYIP+
Sbjct:   39 GNTLVCAAVIRFRHLRSKVTNFFVISLAVSDLLVAVLVMPWKAVAEI-AGFWPFG-SFCNIWVAFDIMCSTASILNLCVISVDRYWAISSPFQYERKMTPKAAFILISVAWTLSVLISFIPVQLSWH----KAKPTWPLDGNFTSLEDAEDDNCDTRLSRTYAISSSLISFYIPV 207          

HSP 2 Score: 72.0182 bits (175), Expect = 7.112e-13
Identity = 43/120 (35.83%), Postives = 62/120 (51.67%), Query Frame = 1
Query: 1276 FAREQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFGQS---KGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHIL-C-GLCPLRSQIFRLTRADVNRNVITPSSSVRVRSHH 1620
            F RE K  KTL ++MG+F+ CWLPFF+ N +         Q      +   V  W G+ NS++NP+IYA +  DF++AF  +L C  LCP  +    +    +N N      +V   SHH
Sbjct:  264 FKRETKVLKTLSVIMGVFVCCWLPFFISNCMVPFCGSEETQPFCIDSITFDVFVWFGWANSSLNPIIYAFNA-DFQKAFSTLLGCYRLCPTTNN--AIETVSINNN-----GAVMFSSHH 375          
BLAST of GCR001 vs. Ensembl Mouse
Match: Drd1 (dopamine receptor D1 [Source:MGI Symbol;Acc:MGI:99578])

HSP 1 Score: 134.806 bits (338), Expect = 1.159e-33
Identity = 78/175 (44.57%), Postives = 114/175 (65.14%), Query Frame = 1
Query:  289 GNILVIVSVIMERNLRT-ITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISF-PAILWWHVMESQKNLTKILLVDRTTLCEFPDD-------KAYLIISSTISFYIPL 786
            GN LV  +VI  R+LR+ +TNFF++SLA +DLL+  +VMP+ A +E+ AG+W FG  +C++W AFD++ STASILNLC+I+++R+WA  +P  Y  +M+ K   ++I++ W  S LISF P  L WH    +   T  L  + T+L +  DD       + Y I SS ISFYIP+
Sbjct:   32 GNTLVCAAVIRFRHLRSKVTNFFVISLAVSDLLVAVLVMPWKAVAEI-AGFWPFG-SFCNIWVAFDIMCSTASILNLCVISVDRYWAISSPFQYERKMTPKAAFILISVAWTLSVLISFIPVQLSWH----KAKPTWPLDGNFTSLEDAEDDNCDTRLSRTYAISSSLISFYIPV 200          

HSP 2 Score: 72.0182 bits (175), Expect = 7.495e-13
Identity = 43/120 (35.83%), Postives = 62/120 (51.67%), Query Frame = 1
Query: 1276 FAREQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFGQS---KGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHIL-C-GLCPLRSQIFRLTRADVNRNVITPSSSVRVRSHH 1620
            F RE K  KTL ++MG+F+ CWLPFF+ N +         Q      +   V  W G+ NS++NP+IYA +  DF++AF  +L C  LCP  +    +    +N N      +V   SHH
Sbjct:  257 FKRETKVLKTLSVIMGVFVCCWLPFFISNCMVPFCGSEETQPFCIDSITFDVFVWFGWANSSLNPIIYAFNA-DFQKAFSTLLGCYRLCPTTNN--AIETVSINNN-----GAVMFSSHH 368          
BLAST of GCR001 vs. Ensembl Mouse
Match: Adra1a (adrenergic receptor, alpha 1a [Source:MGI Symbol;Acc:MGI:104773])

HSP 1 Score: 129.413 bits (324), Expect = 5.348e-33
Identity = 71/207 (34.30%), Postives = 117/207 (56.52%), Query Frame = 1
Query:  181 LLMNSNGDTNSSLIGPGMG-----TYFVGVLFGILVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISFPAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPL 786
            +L++ N    S+   P           +GV+ G L++  + GNILVI+SV   R+L ++T+++IV+LA ADLL+   V+PFSA  E+  GYW FG  +C++W A DVL  TASI+ LC+I+I+R+     P+ Y + ++ +R +  +  VW  S +IS   +  W     +            T+C+  ++  Y++ S+  SFY+PL
Sbjct:    2 VLLSENASEGSNCTHPPAQVNISKAILLGVILGGLIIFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEI-LGYWAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGVRALLCVWALSLVISIGPLFGWRQQAPEDE----------TICQINEEPGYVLFSALGSFYVPL 197          

HSP 2 Score: 53.1434 bits (126), Expect = 3.928e-7
Identity = 21/31 (67.74%), Postives = 28/31 (90.32%), Query Frame = 1
Query: 1264 KFKKFAREQKAAKTLGIVMGIFIICWLPFFV 1356
            +  KF+RE+KAAKTLGIV+G F++CWLPFF+
Sbjct:  260 RLLKFSREKKAAKTLGIVVGCFVLCWLPFFL 290          
BLAST of GCR001 vs. UniProt/SwissProt
Match: sp|Q24563|DOPR2_DROME (Dopamine receptor 2 OS=Drosophila melanogaster OX=7227 GN=Dop1R2 PE=2 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 4.899e-47
Identity = 110/217 (50.69%), Postives = 139/217 (64.06%), Query Frame = 1
Query:  280 TISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISFPAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPLXXXXXXXXXXXXXXXXXXXXXXXXXKIVYKNSQSGEV-LRLGIHRGGV 927
            T+ GN LVI++VI ER L T TN+FI SLA AD L+G VVMPFSA  E+    W FG  WCD+W + DVL STASILNLC+I+++R+WA  +P +Y  RM+ KR   +IA VW+CSS ISFPAI+WW      +             C F +   YL+ SSTISFY+PL++M+  Y RIYR A    ++L  GTK V     SGE+ L L IHRGG 
Sbjct:  122 TVFGNSLVILAVIRERYLHTATNYFITSLAVADCLVGLVVMPFSALYEVLENTWFFGTDWCDIWRSLDVLFSTASILNLCVISLDRYWAITDPFSYPMRMTVKRAAGLIAAVWICSSAISFPAIVWWRAARDGEM--------PAYKCTFTEHLGYLVFSSTISFYLPLLVMVFTYCRIYRAAVIQTRSLKIGTKQVLM--ASGELQLTLRIHRGGT 328          

HSP 2 Score: 97.8265 bits (242), Expect = 4.386e-20
Identity = 46/76 (60.53%), Postives = 57/76 (75.00%), Query Frame = 1
Query: 1303 TLGIVMGIFIICWLPFFVCNILSAVYNEAFGQSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHILCGLCP 1530
            TLGIVMG+FIICWLPFFV N+LS    E   + + +V  +VTWLG+INS +NP+IYA   RDFRRAF+ +LC  CP
Sbjct:  420 TLGIVMGVFIICWLPFFVVNLLSGFCIECI-EHEEIVSAIVTWLGWINSCMNPVIYACWSRDFRRAFVRLLCMCCP 494          
BLAST of GCR001 vs. UniProt/SwissProt
Match: sp|Q18775|DOPR4_CAEEL (Dopamine receptor 4 OS=Caenorhabditis elegans OX=6239 GN=dop-4 PE=2 SV=2)

HSP 1 Score: 152.525 bits (384), Expect = 1.725e-38
Identity = 74/178 (41.57%), Postives = 117/178 (65.73%), Query Frame = 1
Query:  253 VLFGILVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISFPAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPL 786
             LF I +LT ++GN LV+++V  ++ LR  T + I+SLA ADL++G +VMP ++  E++   W+FG   CD++HA D+L+STASI NLC+I+++R+ A ++PI Y  ++S +R ++ I  VW+ S+++SFP I+WW             L +  + C F D K Y+  SS +SFYIPL
Sbjct:   48 ALFSICLLT-VAGNCLVVIAVCTKKYLRNPTGYLIISLAIADLIVGVIVMPMNSLFEIANHTWLFGLMMCDVFHAMDILASTASIWNLCVISLDRYMAGQDPIGYRDKVSKRRILMAILSVWVLSAILSFPGIIWWRTSSPH-------LYEDQSQCLFTDSKMYVSFSSLVSFYIPL 217          

HSP 2 Score: 88.1965 bits (217), Expect = 4.836e-17
Identity = 40/86 (46.51%), Postives = 56/86 (65.12%), Query Frame = 1
Query: 1258 GKKFKKFAREQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFGQSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHIL 1515
             ++  ++  EQ+AA+TL IV+G FI+CW PFFV   L+A     F  +K  +   VTW G++NS +NP+IY+   RDFRRAF  IL
Sbjct:  394 SRQMMRYVHEQRAARTLSIVVGAFILCWTPFFVFTPLTAFCESCFS-NKETIFTFVTWAGHLNSMLNPLIYSRFSRDFRRAFKQIL 478          
BLAST of GCR001 vs. UniProt/SwissProt
Match: sp|P42289|DRD1_XENLA (D(1A) dopamine receptor OS=Xenopus laevis OX=8355 GN=drd1 PE=2 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 2.129e-37
Identity = 83/185 (44.86%), Postives = 121/185 (65.41%), Query Frame = 1
Query:  244 FVGVLFGILVLTTISGNILVIVSVIMERNLRT-ITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISF-PAILWWHVMESQKNLT-KILLVDRT-TLCEFPDDKAYLIISSTISFYIPL 786
              G    +L+L+T+ GN LV  +VI  R+LR+ +TNFF++SLA +DLL+  +VMP+ A +E+ AG+W FG  +C++W AFD++ STASILNLC+I+++R+WA  +P  Y  +M+ K   +MI + W  S LISF P  L WH  ++       I L DRT   C+   ++ Y I SS ISFYIP+
Sbjct:   24 LTGCFLSVLILSTLLGNTLVCAAVIRFRHLRSKVTNFFVISLAVSDLLVAVLVMPWKAVAEI-AGFWPFG-TFCNIWVAFDIMCSTASILNLCVISVDRYWAISSPFRYERKMTPKVAFIMIGVAWTLSVLISFIPVQLNWHKAKTTSFFDLNITLHDRTMDNCDSSLNRTYAISSSLISFYIPV 206          

HSP 2 Score: 74.3294 bits (181), Expect = 8.560e-13
Identity = 41/112 (36.61%), Postives = 60/112 (53.57%), Query Frame = 1
Query: 1276 FAREQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFGQS-------KGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHIL-C-GLCPLRSQIFRLTRADVNRNVI 1584
            F RE K  KTL ++MG+F+ CWLPFF+ N +    + +   S             V  W G+ NS++NP+IYA +  DFR+AF ++L C  LCP  + I      + N  V+
Sbjct:  263 FKRETKVLKTLSVIMGVFVCCWLPFFILNCIVPFCDPSLTTSGTEPFCISSTTFDVFVWFGWANSSLNPIIYAFNA-DFRKAFSNLLGCYRLCPTSNNIIETVSINNNGAVV 373          
BLAST of GCR001 vs. UniProt/SwissProt
Match: sp|Q9VCZ3|OCTB1_DROME (Octopamine receptor beta-1R OS=Drosophila melanogaster OX=7227 GN=Octbeta1R PE=2 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 5.616e-37
Identity = 82/200 (41.00%), Postives = 125/200 (62.50%), Query Frame = 1
Query:  193 SNGDTNSSLIGPGMGTYFVGV-LFGILVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISFPAIL--WWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIP 783
            S G T+ +     +   FV   + G ++L  I GN+LVIVSV+  R LR ITN+F+VSLA AD+L+    M F+A S + +G W+FG   CD+W++FDV  STASI++LC I+++R++A   P+ Y   M+ +R  +M+ +VW+  +L+SF  I   W+   E+ K L          +CEF  +KAY I+SS++SF+IP
Sbjct:   91 SEGSTDDADGSSHLALVFVKCFIIGFIILAAILGNMLVIVSVMRHRKLRIITNYFVVSLAVADMLVALCAMTFNA-SVMISGKWMFGSVMCDMWNSFDVYFSTASIMHLCCISVDRYYAIVQPLDYPLIMTQRRVFIMLLMVWLSPALLSFLPICSGWYTTTENYKYLK-----SNPHICEFKVNKAYAIVSSSMSFWIP 284          

HSP 2 Score: 82.8037 bits (203), Expect = 2.651e-15
Identity = 40/83 (48.19%), Postives = 59/83 (71.08%), Query Frame = 1
Query: 1282 REQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFGQSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHILCGLCP 1530
            RE+KAA+TLGI+M  F+ICWLPFF+  I+S++ +     +  +++ ++ W+GY NSA+NP+IYA+  RDFR AF   L  L P
Sbjct:  344 RERKAARTLGIIMSAFLICWLPFFLWYIVSSLCDSCI--TPRLLVGILFWIGYFNSALNPIIYAYFNRDFRAAFKKTLKSLFP 424          
BLAST of GCR001 vs. UniProt/SwissProt
Match: sp|Q25322|OAR2_LOCMI (Putative tyramine receptor 2 OS=Locusta migratoria OX=7004 GN=GCR2 PE=2 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 6.208e-37
Identity = 87/220 (39.55%), Postives = 126/220 (57.27%), Query Frame = 1
Query:  154 SSTASETRFLLMNSN---GDTNSSLIG-----PGMGTYFVGVLFGILVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFS-AYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISFPAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPL 786
            SS A E +  L+  +   G    S++G     P        V   +++L TI GN+LV++SV   + LR + NFFIVSLA ADL +  +VMPF+ AYS +    W+FG   C +W   DVL  TASILNLC IA++R+WA  +PI Y  + + +R + MIA VW+ S +IS P ++ W+    + N         TT C+  +++ Y+I SS  SF+IPL
Sbjct:   15 SSAAEEPQDALVGGDACGGRRPPSVLGVRLAVPEWEVAVTAVSLSLIILITIVGNVLVVLSVFTYKPLRIVQNFFIVSLAVADLTVAVLVMPFNVAYSLIQ--RWVFGIVVCKMWLTCDVLCCTASILNLCAIALDRYWAITDPINYAQKRTLRRVLAMIAGVWLLSGVISSPPLIGWNDWPMEFN--------DTTPCQLTEEQGYVIYSSLGSFFIPL 224          

HSP 2 Score: 85.5001 bits (210), Expect = 2.747e-16
Identity = 40/85 (47.06%), Postives = 59/85 (69.41%), Query Frame = 1
Query: 1261 KKFKKFAREQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFGQSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHIL 1515
            K+    ++E++AA+TLGI+MG+F++CWLPFF+  ++    N +   S  +V   +TWLGYINSA+NP+IY     DFRRAF  +L
Sbjct:  397 KQRISLSKERRAARTLGIIMGVFVVCWLPFFLMYVIVPFCNPSCKPSPKLVNF-ITWLGYINSALNPIIYTIFNLDFRRAFKKLL 480          
BLAST of GCR001 vs. TrEMBL
Match: A0A193KUD5 (GCR001 OS=Schmidtea mediterranea OX=79327 GN=gcr001 PE=2 SV=1)

HSP 1 Score: 838.951 bits (2166), Expect = 0.000e+0
Identity = 483/483 (100.00%), Postives = 483/483 (100.00%), Query Frame = 1
Query:  187 MNSNGDTNSSLIGPGMGTYFVGVLFGILVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISFPAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPLXXXXXXXXXXXXXXXXXXXXXXXXXKIVYKNSQSGEVLRLGIHRGGVYXXXXXXXXXXXXXVYHQKSKVNGNIKSEKSFLCFKYSVKLRPKDVSLTGLKVSFERKYSPIHLVXXXXXXXXXXXXXXXXXXXXXXXXXXXLKHTLKKKRYKRSVSISLGKKFKKFAREQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFGQSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHILCGLCPLRSQIFRLTRADVNRNVITPSSSVRVRSHHLGNMK 1635
            MNSNGDTNSSLIGPGMGTYFVGVLFGILVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISFPAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPLIIMIVVYIRIYRTATTVMKTLTTGTKIVYKNSQSGEVLRLGIHRGGVYNSNNKSNNSSDNNVYHQKSKVNGNIKSEKSFLCFKYSVKLRPKDVSLTGLKVSFERKYSPIHLVSSSYPSSFSSPTFQSCASESSASNSNSLKHTLKKKRYKRSVSISLGKKFKKFAREQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFGQSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHILCGLCPLRSQIFRLTRADVNRNVITPSSSVRVRSHHLGNMK
Sbjct:    1 MNSNGDTNSSLIGPGMGTYFVGVLFGILVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISFPAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPLIIMIVVYIRIYRTATTVMKTLTTGTKIVYKNSQSGEVLRLGIHRGGVYNSNNKSNNSSDNNVYHQKSKVNGNIKSEKSFLCFKYSVKLRPKDVSLTGLKVSFERKYSPIHLVSSSYPSSFSSPTFQSCASESSASNSNSLKHTLKKKRYKRSVSISLGKKFKKFAREQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFGQSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHILCGLCPLRSQIFRLTRADVNRNVITPSSSVRVRSHHLGNMK 483          
BLAST of GCR001 vs. TrEMBL
Match: A0A193KUK0 (GCR008 OS=Schmidtea mediterranea OX=79327 GN=gcr008 PE=2 SV=1)

HSP 1 Score: 287.345 bits (734), Expect = 1.740e-87
Identity = 187/425 (44.00%), Postives = 249/425 (58.59%), Query Frame = 1
Query:  268 LVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISFPAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPLXXXXXXXXXXXXXXXXXXXXXXXXXKIVYKNSQS--GEVLRLGIHRGGVYXXXXXXXXXXXXXVYHQKSKVNGNIKSEKSFLCFKYSVKLRPKDVSLTGLKVSFERKYSPIHLVXXXXXXXXXXXXXXXXXXXXXXXXXXXLKHTLKKKRYKRSVSISLGKKFKKFAREQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEA----FGQSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHILCGL 1524
            L   TI GN LVI++V    NLRT TN+FIVSLACADLLMG VVMPF+  +EL    WIFG  WCD+WHAFDVLS+TASILNLCMIAIER+  T +P+  G  +++K CI+MI +VW CS+ ISFPAI+WW     Q + T     D    C+FP D  Y+ ISS +SFY PL++M+V+Y +IYRTA  ++  L  G +++    ++     +RL IH+GG                  QK  +  N K++  +    +S K +P  +S   L    +    P+                      SSAS +  L+H             +LGKK  KF  EQKAA+TLG VMG FI+CWLPFF+CNIL+++ N+      G     ++ +VTWLGY+NS +NP+IYAHSMR FR AFI +LC +
Sbjct:   24 LSFGTIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWR----QSSDT----YDSVCSCKFPTDPFYISISSIVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRAL--------------QKPNLYQNSKNKSKW----FSWKTKPMGIS-EPLSCVADLCSGPV---------------------TSSASIAFKLRH------------FTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLLCPI 388          
BLAST of GCR001 vs. TrEMBL
Match: A0A4Y2D394 (Dopamine receptor 2 OS=Araneus ventricosus OX=182803 GN=Dop1R2_0 PE=3 SV=1)

HSP 1 Score: 286.574 bits (732), Expect = 2.311e-86
Identity = 179/485 (36.91%), Postives = 257/485 (52.99%), Query Frame = 1
Query:  160 TASETRFLLMNSNGDTNSSLIGPGMGTYFVGVLFGILVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISFPAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPLXXXXXXXXXXXXXXXXXXXXXXXXXKIVYKNSQSGEVLRLGIHRGGVYXXXXXXXXXXXXXVYHQKSKVNGNIKSEKSFLCFKYSVKLRPKDVSLTGLKVSFERKYSPIHLVXXXXXXXXXXXXXXXXXXXXXXXXXXXLKHTLKKKRYKRSV-SISLGKKFKKFAREQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFGQSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHILCGLCPLRSQIFRLT---RADVNRNVITPSSSV 1602
            T   T F+++N++ D       P      + V+  +  + T+ GN+LV+V+++ ++ L T+TN+FI SLA AD L+G +VMPFS   E+   YW+FG  WCDLW + DVL+STASILNLC I+I+R+WA  +P+TY S+M+  R   ++A VWMCS+LISFPAI WW  +  Q              C F +D  YL+ SS ISFY PL +M+  Y +IYR A T  K+L  G K +    +    + L IHRGGV              V  + S  NG                 R + + ++    S E + S                             + S ++T+  +   R V + SL KK  K  +E+KAAKTL IVMG+FI+CWLPFF+ N+L  +   +      +V  + TWLG++NS +NP+IYA   RDFRRAF  ILC  C +R Q +R     R+++N    +P+  V
Sbjct:   49 TFHPTDFIVLNTSKDVFDRY--PTANQTALAVILVLFCIITVFGNVLVMVAIVKQQYLHTVTNYFIASLATADCLVGAIVMPFSVIHEVMDKYWMFGREWCDLWRSLDVLASTASILNLCAISIDRYWAITDPMTYPSKMTPPRAKAIVAAVWMCSALISFPAIAWWRAVSVQPY--------PENQCLFTNDVGYLLFSSVISFYGPLAVMVFTYYKIYRAAVTQTKSLKLGMKHIRATKEPCRSMTLRIHRGGV-----------QEQVKQEDSPSNGK----------------RKRHLVISATPTSTEGESS----------------------------LAKSPENTIPMRFASRHVKAFSLSKKLGKLTKERKAAKTLAIVMGVFILCWLPFFIINVLLGICGTSCIAEHEIVSSIFTWLGWLNSGMNPVIYACWSRDFRRAFRQILCSCCKIRKQQYRFQTTMRSNINTRAKSPNEEV 468          
BLAST of GCR001 vs. TrEMBL
Match: A0A210PJ23 (Dopamine receptor 2 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT17446 PE=3 SV=1)

HSP 1 Score: 288.115 bits (736), Expect = 3.810e-86
Identity = 190/455 (41.76%), Postives = 258/455 (56.70%), Query Frame = 1
Query:  247 VGVLFGILVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISFPAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPLXXXXXXXXXXXXXXXXXXXXXXXXXKIVYKNSQSG--EVLRLGIHRGGVYXXXXXXXXXXXXXVYHQKSKVNGNIKSEKSFLCFKYSVKL-RPKDVSLTGLKVSFERKYSPIHLVXXXXXXXXXXXXXXXXXXXXXXXXXXXLKHTLKKKRYKRSVSISLGKKFKKFAREQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFGQSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHILCGLCPLRSQIFRLTRADVNRNVITPSSSV 1602
            +G++  +  + TI GNILVIV+V  E  LRT+TN+FIVSLA ADL++G +VMPFS   E++   W +G  WCDLWH+FDVL+STASILNLC+I+++R+WA  +PI Y ++MS  +  ++IA VW+CS+ ISFPAI WW  + +  NL        + +C F +D AYLI SS +SFY P  IM+ VY+RIY  A   +++L  G+K++  N   G  E++ L +HRGG                    S  NG+    +  +   YS    R  D   T L  S + K S  H                      + +++ +  H   K   KR    +L KK  K AREQKAAKTLGIV+G+FIICWLPFFV N+L  +   +      ++  + TWLGYINS +NP+IYA SMRDFRRAF  +L   CP   Q F   RA       T S +V
Sbjct:  134 IGIVLSLFSVVTIVGNILVIVAVFKEMYLRTVTNYFIVSLALADLMVGGIVMPFSISLEITNQMWPYGEEWCDLWHSFDVLASTASILNLCVISLDRYWAITDPIAYTAKMSQCKVGLLIAFVWLCSAGISFPAIAWWKAV-TPSNLP-------SQVCMFTEDSAYLIFSSIVSFYCPTFIMMFVYLRIYLAAAEQIRSLKVGSKVLTSNGSHGNREIMTLRMHRGGT------------------NSPRNGHEDHYRRAVHEDYSQSCERCMDSDSTAL-TSQDAKLSLPH----------------------THASNGAHHHRPAKFITKRLRQFALSKKLTKLAREQKAAKTLGIVVGVFIICWLPFFVFNVLQGICGMSCLVYPELLFPMFTWLGYINSGMNPVIYALSMRDFRRAFGKVLFCCCP--KQRFSYQRAHQKYTASTSSFTV 537          
BLAST of GCR001 vs. TrEMBL
Match: A0A1S3K9Y2 (dopamine receptor 2 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106180005 PE=3 SV=1)

HSP 1 Score: 286.189 bits (731), Expect = 5.644e-85
Identity = 182/428 (42.52%), Postives = 254/428 (59.35%), Query Frame = 1
Query:  247 VGVLFGILVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISFPAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPLXXXXXXXXXXXXXXXXXXXXXXXXXKIVYKNSQSGEVLRLGIHRGGVYXXXXXXXXXXXXXVYHQKSKVNGNIKSEKSFLCFKYSVKLRPKDVSLTGLKVSFERKYSPIHLVXXXXXXXXXXXXXXXXXXXXXXXXXXXLKHTLKKKRYKRSVSISLGKKFKKFAREQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFGQSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHILCGLCP 1530
            +G +     L T+ GN+LVI +++ ER LR  TN+F+VSLA ADL++G +VMPFS   E+ +G W++G  WCDLWH+FDVL STASILNLC+I+++R+WA  +PI Y  RMS +R  ++IA+VW+CS  ISFPAI+WW  ++        +L D  T+C F +D AYL+ISS ISFY PL+IM+ VY +IYR A   +++L  G+K V  +  +G+ L L IHRGG       + +    NV    S     I     F        ++P+ +       S +R  +  +L      +S +S   ++       +   S  H+  K   KR     +  K  K ARE+KAAKTLGIV+G+FIICWLPFF  N+L  +          ++  V TWLGYINS +NP+IYA S++DFRRAF  ILC  CP
Sbjct:  136 LGFVLAFFALLTVVGNLLVITAIVKERYLRANTNYFLVSLAVADLVVGSIVMPFSIALEIRSGRWVYGKLWCDLWHSFDVLGSTASILNLCVISMDRYWAITDPIKYPHRMSSRRVCILIALVWICSGSISFPAIMWWRAVDP-------VLPD--TVCLFTEDTAYLLISSAISFYTPLVIMLYVYWKIYRAAAEQLRSLRHGSKSVV-SGINGQKLTLRIHRGGA---RPGATSLLMMNVRKNLSIYTPAIAETNDF------SPIKPRYLRNGCHNQSNKRNTTNNNLSIEDDTASVNSAFIENQNENEDDNAPVSDIHSPAKFIRKRLKQFVIKTKLSKVARERKAAKTLGIVIGVFIICWLPFFAANLLYGICGTCVLHPD-IIFPVFTWLGYINSGMNPIIYALSLKDFRRAFSRILCVCCP 543          
BLAST of GCR001 vs. Ensembl Cavefish
Match: ENSAMXT00000046102.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:10714095:10717552:-1 gene:ENSAMXG00000040245.1 transcript:ENSAMXT00000046102.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 148.288 bits (373), Expect = 1.886e-38
Identity = 82/195 (42.05%), Postives = 122/195 (62.56%), Query Frame = 1
Query:  208 NSSLIGPGMGTYFVGVLFGILVLTTISGNILVIVSVIMERNLRT-ITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISF-PAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPL 786
            ++ L G G     +G +  +L+++T+ GN LV  +V+  R+LR+ +TNFF+VSLA +DL +  +VMP+ A S + AG W+FG  +C +W AFD++ STASILNLCMI+++R+WA  +P  Y  RM+H+    MI + W  S LISF P  L WH    ++  +        T C+   ++ Y I SS ISFYIP+
Sbjct:   22 DAELEGGGSARAILGFVLFLLIVSTLLGNTLVCAAVVKFRHLRSKVTNFFVVSLAVSDLFVAVLVMPWEAMSAV-AGTWLFG-RFCAVWIAFDIMCSTASILNLCMISVDRYWAIASPFRYERRMTHRVAFAMIGVAWTLSVLISFIPVQLNWHEQGGEERASSA-----HTDCKANLNRTYAISSSLISFYIPV 209          

HSP 2 Score: 66.6254 bits (161), Expect = 3.323e-11
Identity = 35/84 (41.67%), Postives = 48/84 (57.14%), Query Frame = 1
Query: 1276 FAREQKAAKTLGIVMGIFIICWLPFFVCN----ILSAVYNEAFGQSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHIL 1515
            F +E K  KTL ++MG+F+ CWLPFFV N        V +  F         +  W G+ NS++NP+IYA +  DFRRAF  +L
Sbjct:  261 FKKETKVLKTLSVIMGVFVCCWLPFFVLNCAVPFCRCVSDTTFA--------IFVWFGWANSSLNPVIYAFNA-DFRRAFSSLL 335          
BLAST of GCR001 vs. Ensembl Cavefish
Match: ADRA1D (adrenoceptor alpha 1D [Source:NCBI gene;Acc:103027862])

HSP 1 Score: 142.51 bits (358), Expect = 4.371e-36
Identity = 74/180 (41.11%), Postives = 113/180 (62.78%), Query Frame = 1
Query:  247 VGVLFGILVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISFPAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPL 786
            VGV   I +   I GNILVI+SV+  R+LRT+TNFFIV+LA ADLL+G VV+PFSA  E+  G W+FG  +C++W A DVL  TASIL+LC+I+++R+   +  + Y + M+ ++  V++ ++W+ S++IS   +L W                  ++C   ++  Y + SS  SFY+PL
Sbjct:   58 VGVFLAIFITVAIVGNILVILSVLCNRHLRTVTNFFIVNLAIADLLLGVVVLPFSASLEV-LGCWVFGRVFCNIWAAVDVLCCTASILSLCIISVDRYVGVKYCLRYPTIMTERKAGVILVVIWVASAVISIGPLLGWKEPPPADE----------SVCSITEEPGYALFSSLFSFYLPL 226          

HSP 2 Score: 87.4261 bits (215), Expect = 8.630e-18
Identity = 46/108 (42.59%), Postives = 68/108 (62.96%), Query Frame = 1
Query: 1204 LKHTLKKKRYKRSVSISLGKKFKKFAREQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFGQSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHILCGLC 1527
            L+H+  + R +   S SL  +  KF+RE+KAAKTL IV+G+F++CWLPFF    L + +     +   +V  V+ WLGY NS +NP+IY  S ++F+RAF  +L   C
Sbjct:  275 LEHSRSRGRGQPFRS-SLSVRLMKFSREKKAAKTLAIVVGMFVLCWLPFFFVLPLGSFFPAL--KPSDMVFKVIFWLGYFNSCINPIIYPCSSKEFQRAFTRLLRCQC 379          
BLAST of GCR001 vs. Ensembl Cavefish
Match: adra2c (alpha-2C adrenergic receptor-like [Source:NCBI gene;Acc:103033245])

HSP 1 Score: 136.732 bits (343), Expect = 1.811e-34
Identity = 75/203 (36.95%), Postives = 121/203 (59.61%), Query Frame = 1
Query:  181 LLMNSNGDTNSSLIGPGMGTYFVGV--LFGILVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISFPAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIP 783
            L +NS+G++ S    P +    +G+  L   L+L TI GN+LV+++V+  R L+   N F+VSLA AD+L+  ++MPFS  +EL  GYW FG  WCD++ A DVL  T+SI++LC I+++R+W+    + Y  + + +R   MI +VW+ S++ISFP ++     + + N+           CE  D   Y++ SS  SF+ P
Sbjct:   16 LHLNSSGNSTSKYSLPTI----IGLAGLVSFLILFTIVGNVLVVIAVLTSRALKPPQNLFLVSLATADILVATLIMPFSLANEL-MGYWFFGKVWCDIYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKGMIVVVWLISAVISFPPLISMDRKDQEINV--------KPQCEINDHTWYILYSSIGSFFAP 205          

HSP 2 Score: 70.0922 bits (170), Expect = 2.049e-12
Identity = 35/95 (36.84%), Postives = 53/95 (55.79%), Query Frame = 1
Query: 1234 KRSVSISLGKKFKKFAREQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFGQSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHILC 1518
            +R    ++ +K    ARE++    L +VMG+F++CW PFF    L  +  E     + +      W+GY NS++NP+IY    +DFRRAF  ILC
Sbjct:  332 RRKRRNTMSRKKISQAREKRFTFVLAVVMGVFVVCWFPFFFSYSLYGICREPCEIPEPLFKFFF-WIGYCNSSLNPVIYTIFNQDFRRAFQKILC 425          
BLAST of GCR001 vs. Ensembl Cavefish
Match: adra1ba (adrenoceptor alpha 1B [Source:NCBI gene;Acc:103033427])

HSP 1 Score: 137.887 bits (346), Expect = 2.006e-34
Identity = 74/180 (41.11%), Postives = 111/180 (61.67%), Query Frame = 1
Query:  247 VGVLFGILVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISFPAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPL 786
            + V+ G  ++  I GNILVI+SV+  R+LR  TN+FI++LA ADLL+G  V+P SA  E+   YW+FG  +CD+W A DVL  TASI++LC+I+I+R+     P+ Y S ++ KR ++ +  VW+ +++IS   +L W    S          D  T+C   ++  Y + SS  SFYIPL
Sbjct:   48 LAVVLGAFIVFAIVGNILVILSVVCNRHLRIPTNYFIINLAMADLLLGTTVLPVSATLEI-LNYWVFGRIFCDIWAAVDVLCCTASIMSLCVISIDRYIGVRYPLQYPSIVTEKRALLAMLGVWVLATVISIGPLLGWKEPPS----------DDDTICPITEEPFYALFSSLGSFYIPL 216          

HSP 2 Score: 87.0409 bits (214), Expect = 1.191e-17
Identity = 46/103 (44.66%), Postives = 66/103 (64.08%), Query Frame = 1
Query: 1234 KRSVSISLGKKFKKFAREQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFGQSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHILCGLCPLRSQ 1542
            K ++  SL  K  KF+RE+KAAKTLG+V+G+FI+CWLPFF+   + + +N    +       V+ WLGY NS +NP+IY    R+F++AFI IL   C  R +
Sbjct:  271 KGTIRSSLTVKLLKFSREKKAAKTLGVVVGMFILCWLPFFLALPIGS-FNANL-RPPETFFKVIFWLGYFNSCLNPIIYPCYSREFKQAFIRILRCQCQQRKR 371          
BLAST of GCR001 vs. Ensembl Cavefish
Match: adrb3b (beta-3 adrenergic receptor [Source:NCBI gene;Acc:103028061])

HSP 1 Score: 135.191 bits (339), Expect = 3.393e-34
Identity = 71/182 (39.01%), Postives = 108/182 (59.34%), Query Frame = 1
Query:  244 FVGVLFGILVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISFPAILWWHVMESQKNLTKIL-LVDRTTLCEFPDDKAYLIISSTISFYIPL 786
            F+G+   +++  T++GN+LVI++V+    L+ IT+ FI+SLACADL++GCVV P  + + L  G W+ G   CDLW + DVL  TAS   LC+IA++R+ A   P+ Y + ++  R   ++  VW  S  +SF  I+  H         K    +D    C+F   ++Y I+SS ISFYIPL
Sbjct:   31 FLGLPIALIIFMTVAGNLLVILAVMRTPQLQNITSVFIMSLACADLIVGCVVQPLGS-TMLLTGNWLLGKRACDLWTSVDVLCVTASTQTLCVIAVDRYVAVTRPLRYKALLNKWRARFIVCTVWTISVFVSFVPIMGGHFRAPDDLSDKTQNCLDDPRCCDFMPSESYAIVSSIISFYIPL 211          

HSP 2 Score: 80.1073 bits (196), Expect = 1.210e-15
Identity = 49/120 (40.83%), Postives = 69/120 (57.50%), Query Frame = 1
Query: 1270 KKFAREQKAAKTLGIVMGIFIICWLPFFVCNIL----SAVYNEAFGQSKGVV--MIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHILCGLCPLRSQIFRL-TRADVNRNVITPSSSVRV 1608
            +    + +A KTLG +MG F++CWLPFFV NI+    SA   EA      +   M+ + WLGYINS +NP+IY HS  D+R AF  +L  L P R+ +  L  R  +    ++ S +VRV
Sbjct:  263 RNIVHQHRALKTLGFIMGAFMLCWLPFFVANIVVTFRSASRTEAKEDDGDLQRNMMTLNWLGYINSGLNPIIYCHS-SDYRAAFHSLLYLLKPKRTGLAGLYKRLRLRCPCLSKSGTVRV 381          
BLAST of GCR001 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000271.1 (pep scaffold:Pmarinus_7.0:GL476504:17018:19617:1 gene:ENSPMAG00000000243.1 transcript:ENSPMAT00000000271.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 133.65 bits (335), Expect = 4.843e-35
Identity = 74/185 (40.00%), Postives = 113/185 (61.08%), Query Frame = 1
Query:  235 GTYFVGVLFGILVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISF-PAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPL 786
            G   V  L  ++ + T+ GN  V++  ++ER LRT+T  FI+SLA ADLL+ C+VMPFS   E++ G WIFG  +C +W +FDV+  TASI+ LC I+++R+ +   P  Y +RMS KRCI M   +W+ S LISF P    W+ +   +        D    C F  + A+++++ST++FY+P 
Sbjct:   22 GALSVCALLSLIDIVTLFGNAAVLLCPLVERRLRTVTYMFIMSLATADLLVACLVMPFSIIYEVT-GVWIFGELFCKVWISFDVMFCTASIVTLCFISLDRYCSVTTPNHYPTRMSGKRCIAMTVSIWVYSLLISFLPVTQGWNEIPGVR-------FDARRECLFITNWAFVLVASTLAFYLPF 198          

HSP 2 Score: 71.2478 bits (173), Expect = 8.195e-14
Identity = 30/72 (41.67%), Postives = 46/72 (63.89%), Query Frame = 1
Query: 1285 EQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFGQSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRA 1500
            E KA +T+ I++  F++CWLP+FV N+    Y     +    +  ++TWLGY NSA+NP++YA   RDF+ A
Sbjct:  241 ENKATRTMSIIISAFVMCWLPYFVFNVAMNAYGSKHDRVVVTMFKIMTWLGYCNSAINPVLYAFLNRDFQHA 312          
BLAST of GCR001 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006872.1 (pep scaffold:Pmarinus_7.0:GL476537:253210:263579:1 gene:ENSPMAG00000006208.1 transcript:ENSPMAT00000006872.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 130.183 bits (326), Expect = 8.166e-34
Identity = 74/197 (37.56%), Postives = 118/197 (59.90%), Query Frame = 1
Query:  202 DTNSSLIGPGMGTYFVGVLFGILVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYG-SRMSHKRCIVMIAIVWMCSSLISF-PAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPL 786
            +T+S+      G   VG L  ++ L T+ GN++V V  ++E+ LRT+T  FI+SLA ADLL+ C+VMPFS   E++ G W+FG  +C +W +FDV+  TASI+ LC I+++R+ +   P  Y   +   K C+ M A +W+ SSLISF P +  W+ +         L  D +  C F  ++ + +++S ++FYIP 
Sbjct:    6 NTSSATWRSKAGDITVGSLLSVIDLVTLLGNLVVFVCPVLEKRLRTVTYMFIMSLATADLLVACLVMPFSIIYEVT-GRWMFGRIFCKVWISFDVMFCTASIVTLCFISLDRYCSVSAPHRYTLPKEPKKICVAMTAAIWVYSSLISFLPVMRGWNEIPG-------LDFDSSRECVFVTNRTFAVVASALAFYIPF 194          

HSP 2 Score: 73.559 bits (179), Expect = 1.384e-14
Identity = 33/74 (44.59%), Postives = 46/74 (62.16%), Query Frame = 1
Query: 1285 EQKAAKTLGIVMGIFIICWLPFFVCNILSAVY--NEAFGQSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRA 1500
            E KA +T+ I++  F++CWLP+F  N+    Y  NE       +   V+TWLGY NSA+NPM+YA   RDF+ A
Sbjct:  237 EHKATRTMSIIISAFVLCWLPYFFFNVFIGFYSNNEDSAHVVQMAFKVITWLGYCNSAINPMLYAFLNRDFQHA 310          
BLAST of GCR001 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009127.1 (pep scaffold:Pmarinus_7.0:GL478629:43196:44446:-1 gene:ENSPMAG00000008256.1 transcript:ENSPMAT00000009127.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 124.02 bits (310), Expect = 4.164e-31
Identity = 69/198 (34.85%), Postives = 106/198 (53.54%), Query Frame = 1
Query:  193 SNGDTNSSLIGPGMGTYFVGVLFGILVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISFPAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPL 786
            S    NSS       T    +    L+L  I GN  VI ++ +ER L+ + N+ I SLA  DLL+  +V+P +A  ++    W  G   CD++ A DVL  T+SIL+LC+IA++R+WA  NPI Y ++ + +R ++MI++ W+    IS P +L W   E + +            C+   D  Y I S+  +FYIPL
Sbjct:   21 SAAQGNSSEPSSVAYTVISSLCLTALILCAIFGNSCVIAAIALERTLQNVANYLIGSLAVTDLLVSILVLPMAALYQV-LDRWTLGQVVCDIFIALDVLCCTSSILHLCVIALDRYWAITNPIDYVNKRTPRRAVIMISLTWLVGFSISIPPMLGWRTPEDRAD---------PNACKISQDHGYTIYSTFGAFYIPL 208          
BLAST of GCR001 vs. Ensembl Sea Lamprey
Match: si:dkey-247m21.3 (si:dkey-247m21.3 [Source:ZFIN;Acc:ZDB-GENE-091204-249])

HSP 1 Score: 122.094 bits (305), Expect = 1.046e-30
Identity = 75/188 (39.89%), Postives = 116/188 (61.70%), Query Frame = 1
Query:  241 YFVGVLFGILVLTTISGNILVIVSVIMERNLRTI-TNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWA-TENPITYGSRMSHKRCIVMIAIVWMCSSLISF-PAILWWHVMESQKNLTKILLVDR---TTLCEFPDDKAYLIISSTISFYIPL 786
            Y +  +F I++  TI GN+LV+V+V  +R+LR I TN+FIVSLA ADLL+  +VMPF A   +    W +G  +C +  +FDV+ +TASI++LC IA++RF+A    P+ Y ++M+  R  +M+   W+  SLISF P    W+++  ++ L   L   +    T C F  +K Y +  S ++FYIPL
Sbjct:   20 YILAGIFSIIIAVTILGNLLVVVAVCKDRHLRKIKTNYFIVSLAVADLLVAILVMPFGAVERVQND-WPYGDKFCIIRTSFDVMFTTASIMHLCCIALDRFYAICCKPLVYQNKMTPLRVGLMLGACWVVPSLISFIPIANGWNIIGIEQQLELRLGQAKEANQTHCIFMVNKVYAVACSLVAFYIPL 206          

HSP 2 Score: 82.4185 bits (202), Expect = 2.440e-17
Identity = 40/82 (48.78%), Postives = 51/82 (62.20%), Query Frame = 1
Query: 1273 KFAREQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFGQSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHILC 1518
            +F  E KAAKTL I+MG F +CW PFF+ N++    N    Q      +   WLGY NSA+NP++YA   R FRRAF+ ILC
Sbjct:  252 RFRHETKAAKTLAIIMGCFCLCWAPFFINNVIDPFVNYDTPQQLWDAWL---WLGYANSALNPLLYAFLNRSFRRAFLAILC 330          
BLAST of GCR001 vs. Ensembl Sea Lamprey
Match: adra2c (adrenoceptor alpha 2C [Source:NCBI gene;Acc:266752])

HSP 1 Score: 123.25 bits (308), Expect = 1.882e-30
Identity = 77/211 (36.49%), Postives = 117/211 (55.45%), Query Frame = 1
Query:  190 NSNGDTNSS-------------LIGPGMGTYFVGVLFGILVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISFPAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIP 783
            N NG TNSS             L G G+ +     L  ILV  T+ GN LVI++V+   +L+   N F+VSLA AD+L+  +V+PFS ++EL  GYW FG  WC+++ A DVL  T+SI++LC I+++R+W+    + Y  + + +R   +I IVW  +  IS P +    +  +QKN  +   V R   CE   +  Y++ S   SF+ P
Sbjct:   27 NVNGATNSSNGTDEKLGWEYSVLAGLGLSS-----LVLILVFATVFGNCLVIIAVLTRPSLKAPQNLFLVSLATADILVATLVIPFSLFNEL-MGYWYFGRVWCEIYLALDVLFCTSSIVHLCAISLDRYWSVSQAVEYNIKRTPRRIKRIIVIVWFIAIAISLPPL----ISMNQKNRQQQEEVGRPN-CELNTNTWYILGSCIGSFFAP 226          

HSP 2 Score: 70.4774 bits (171), Expect = 3.486e-13
Identity = 34/80 (42.50%), Postives = 46/80 (57.50%), Query Frame = 1
Query: 1279 AREQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFGQSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHILC 1518
            ARE++    L +++G+F+ICW PFF    LSA+ +         +     W GY NS +NP+IY    RDFRRAF  ILC
Sbjct:  376 ARERRFTFVLSVMIGVFVICWFPFFFTYSLSALCSPESCAIPETLFKFFFWFGYCNSCLNPVIYTVFNRDFRRAFKKILC 455          
BLAST of GCR001 vs. Ensembl Nematostella
Match: EDO35450 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLG6])

HSP 1 Score: 100.908 bits (250), Expect = 1.523e-23
Identity = 63/173 (36.42%), Postives = 98/173 (56.65%), Query Frame = 1
Query:  268 LVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISFPAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPL 786
            +++  + GN+LV  +++  R LRT+TN+FI+SLA +DLL+  + MPF  +  L +  W  G   C+ W   D++ S+ASI NL MI+++RF A   P+TY S M+ +R ++ IA+VW  S LIS    L + +  S   L +         C    DK Y     T+ F++PL
Sbjct:   19 ILILDVCGNLLVCGAILSYRRLRTVTNYFIISLAVSDLLVAGLSMPFRIHHTLHSMCWDLGISVCEFWIFVDLVCSSASICNLSMISVDRFLALSYPLTYPSIMTKRRGLLAIAMVWGYSLLIS---ALSFTLPWSPDGLMQ-----DIPACSL-KDKYYYTFVITVGFFLPL 182          

HSP 2 Score: 65.0846 bits (157), Expect = 1.484e-11
Identity = 38/86 (44.19%), Postives = 48/86 (55.81%), Query Frame = 1
Query: 1282 REQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFGQSKGVVM--------IVVTWLGYINSAVNPMIYAHSMRDFRRAFIHIL 1515
            RE KA KTL IV+G FI+CWLPFFV         E F   + + +        + V  L  +NSAVNP+IY+    +FRRAF  IL
Sbjct:  217 RELKATKTLAIVVGSFIVCWLPFFVIMFTVQFCPECFQDHRSLPVKAQLAIGTVFVYVLPLLNSAVNPIIYSSFNANFRRAFKDIL 302          
BLAST of GCR001 vs. Ensembl Nematostella
Match: EDO42463 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1I2])

HSP 1 Score: 94.7449 bits (234), Expect = 1.750e-21
Identity = 58/176 (32.95%), Postives = 96/176 (54.55%), Query Frame = 1
Query:  256 LFGILVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISFPAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIP 783
            LF +L++  + GN +V + V   ++L+  TN+FIVSLA AD L   + +PF  Y  L+   W  G H C  W   D+L  +ASI NL  I+++R+    +P+TY SRM+ KR ++++ ++W  S +++   ++ W      +    I+      +C   + K YL I S I F+ P
Sbjct:    6 LFAVLIVAVV-GNGIVSLCVFTNKHLQVPTNYFIVSLAAADFLFAVLALPFRLYDVLAGYKWHLGLHTCRYWVWLDLLFCSASIANLAAISVDRYLKISSPLTYNSRMTPKRVVLVLVLLWGYSMILASLTLVQWSPDPKDQGRGTIV---ENGICRM-EAKIYLTIISVIGFFAP 176          
BLAST of GCR001 vs. Ensembl Nematostella
Match: EDO47359 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMJ9])

HSP 1 Score: 95.5153 bits (236), Expect = 3.656e-21
Identity = 56/180 (31.11%), Postives = 95/180 (52.78%), Query Frame = 1
Query:  265 ILVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWI--FGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISFPAILWWHVMESQKNLTKILLVDRTTLCEFPD----DKAYLIISSTISFYIPL 786
            I++L TI GN+LV  SV   R LR+ TN+ +VSLA +DLL+G + +PF     L+   W    G   C  W   D+L S AS++NL  I+ +R  A + P+ Y  +M+ KR +++I +VW+ ++  +F + + W                 +T+  +P      + Y+ + +  +F+ PL
Sbjct:   32 IVMLLTIMGNLLVCYSVFYYRRLRSPTNYLVVSLAVSDLLVGTLSLPFRLAQLLNEENWPSHLGREGCQFWIWVDMLCSGASMVNLAGISFDRLLAIKQPLRYREKMTSKRALILILVVWIYAASCAFLSFVEWE--------------GESTIAAYPQCGIRARVYITLMALAAFFCPL 197          

HSP 2 Score: 59.3066 bits (142), Expect = 1.759e-9
Identity = 34/86 (39.53%), Postives = 51/86 (59.30%), Query Frame = 1
Query: 1282 REQKAAKTLGIVMGIFIICWLPFFVCNI-LSAVYNEAFGQS------KGVVMIVVTW-LGYINSAVNPMIYAHSMRDFRRAFIHIL 1515
            ++ KA KTL +V+G+FI+CW PFFV  +       E FG+       K V++I+  + L   NSA NP+IY+   ++FR AF+ I 
Sbjct:  287 KQIKATKTLAVVVGVFILCWFPFFVIFVTFQYCDTECFGEERIPPAVKRVLLIIFVYVLPVSNSAANPIIYSCFNQEFRVAFLKIF 372          
BLAST of GCR001 vs. Ensembl Nematostella
Match: EDO47699 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLJ1])

HSP 1 Score: 93.2041 bits (230), Expect = 5.038e-21
Identity = 60/204 (29.41%), Postives = 100/204 (49.02%), Query Frame = 1
Query:  196 NGDTNSSLIGPGMGTYFVGV-------LFGILVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISFPAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPL 786
            N   NS+ +G G     +G           +L++ T+ GN +V  S    R+LRTI N+FI+SL+ +D+L+  + MPF    ++S   W +     D W   D+L  TASI+NL  ++ +R  A   P TY   ++ +R +V+I+ VW  ++ IS                  +  +       FP+   YL +++T SF++PL
Sbjct:   10 NASANST-VGAGEEEIIIGASNIIAATFVALLIVLTLGGNFIVCASFYTFRDLRTICNYFIISLSVSDILVALIAMPFWFTIQISDNKWRYSRKLKDYWDCMDILCGTASIMNLMAVSFDRQLAITTPFTYPKILTKRRALVIISFVWAYAATIS-----------------GLRQLKAPPYWPFPN---YLHLNATFSFFLPL 192          

HSP 2 Score: 66.2402 bits (160), Expect = 5.257e-12
Identity = 34/78 (43.59%), Postives = 47/78 (60.26%), Query Frame = 1
Query: 1270 KKFAREQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFGQSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAF 1503
            K +A + KAAKT+ +V+G+F  CWLPFFV  ++ A      G S  +  +   WL Y NS +NP+IY    R +RRAF
Sbjct:  215 KNYATDIKAAKTIAVVVGVFAACWLPFFVIVLIYAWQGYDAGVSPQLFNL-AKWLAYFNSCLNPIIYTCLNRTYRRAF 291          
BLAST of GCR001 vs. Ensembl Nematostella
Match: EDO49367 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG65])

HSP 1 Score: 92.8189 bits (229), Expect = 6.165e-21
Identity = 53/155 (34.19%), Postives = 94/155 (60.65%), Query Frame = 1
Query:  253 VLFGILVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISFPAILWW------HVME-SQKNLTKI 696
            V + +L+++T++GN LV +++ ++  LR  TN+FI SLA ADLL G + +PF      ++G  +F  + C LW   D++ + ASI NL +I+++R+     P  Y  RM+HKR ++ +  VW+ S++++  +I+ W      H+ E S  NL ++
Sbjct:    1 VYYTLLLVSTVAGNSLVCLAICLDHRLRNSTNWFIASLAVADLLYGLIGLPFRIVQ--TSGTRVFTLNECFLWIWADMVCAAASIANLAVISVDRYLKITKPFQYHIRMTHKRALLAVVAVWIYSAILASLSIMPWPGAKGVHLFEQSCTNLNQV 153          

HSP 2 Score: 60.077 bits (144), Expect = 5.985e-10
Identity = 38/104 (36.54%), Postives = 55/104 (52.88%), Query Frame = 1
Query: 1219 KKKRYKRSVSISLGKKFKKFAREQKAAKTLGIVMGIFIICWLPFFVCNILS-----AVYNEAFGQSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHIL 1515
            ++KR +RSV            R+ KA KTL +V+G F ICW PFF+   ++      +++   G  + V  +    L  +NSA NP IYA+   +FRRAF  IL
Sbjct:  199 EEKRKQRSV-----------IRDFKATKTLAVVLGTFTICWCPFFILFTVTQYRPLVLFSLPPGWREFVFYMTYCVLPNLNSACNPFIYAYFNSEFRRAFRKIL 291          
BLAST of GCR001 vs. Ensembl Medaka
Match: ENSORLT00000037555.1 (D(1)-like dopamine receptor [Source:NCBI gene;Acc:101168519])

HSP 1 Score: 144.821 bits (364), Expect = 1.232e-37
Identity = 86/201 (42.79%), Postives = 125/201 (62.19%), Query Frame = 1
Query:  244 FVGVLFGILVLTTISGNILVIVSVIMERNLRT-ITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISF-PAILWWH------VME--------SQKNLTKILLVDRTTL----CEFPDDKAYLIISSTISFYIPL 786
             VG +  +L+++T+ GN LV  +VI  R+LR+ +TNFF++SLA +DL +  +VMP+ A +E++   W+FG  +CD+W  FD++ STASILNLC+I+++R+WA  +P  Y  +M+H+   VMI + W  S LISF P  L WH      VME        S+KNLT     + T +    C    +K Y I SS ISFYIP+
Sbjct:   12 LVGCILFLLIVSTLLGNTLVCAAVIKFRHLRSKVTNFFVISLAVSDLFVAVLVMPWEAITEVT-NTWLFG-RFCDVWITFDIMCSTASILNLCIISVDRYWAIASPFKYERKMTHRVAFVMIGVAWTLSILISFIPVQLNWHRAGEEDVMEDVGALKVTSEKNLTNTSNFNATPIIGMSCVANLNKTYAISSSLISFYIPV 210          

HSP 2 Score: 70.4774 bits (171), Expect = 1.325e-12
Identity = 39/98 (39.80%), Postives = 55/98 (56.12%), Query Frame = 1
Query: 1222 KKRYKRSVSISLGKKFKKFAREQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFGQSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHIL 1515
            +++++ +    L   FKK   E K  KTL I+MG+F+ CWLPFFV N      +          + V  W G+ NS++NP+IYA +  DFRRAF  IL
Sbjct:  253 QQQHRPNDEACLKSSFKK---ETKVLKTLSIIMGVFVFCWLPFFVLNCTVPFCDPPCVSDTTFTVFV--WFGWANSSLNPVIYAFNA-DFRRAFATIL 344          
BLAST of GCR001 vs. Ensembl Medaka
Match: ENSORLT00000023621.2 (D(1)-like dopamine receptor [Source:NCBI gene;Acc:101168519])

HSP 1 Score: 144.821 bits (364), Expect = 3.160e-37
Identity = 82/187 (43.85%), Postives = 121/187 (64.71%), Query Frame = 1
Query:  244 FVGVLFGILVLTTISGNILVIVSVIMERNLRT-ITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISF-PAILWWHVMESQKNLTKILLVDRTTL----CEFPDDKAYLIISSTISFYIPL 786
             VG +  +L+++T+ GN LV  +VI  R+LR+ +TNFF++SLA +DL +  +VMP+ A +E++   W+FG  +CD+W  FD++ STASILNLC+I+++R+WA  +P  Y  +M+H+   VMI + W  S LISF P  L WH    +KNLT     + T +    C    +K Y I SS ISFYIP+
Sbjct:    8 LVGCILFLLIVSTLLGNTLVCAAVIKFRHLRSKVTNFFVISLAVSDLFVAVLVMPWEAITEVT-NTWLFG-RFCDVWITFDIMCSTASILNLCIISVDRYWAIASPFKYERKMTHRVAFVMIGVAWTLSILISFIPVQLNWH----RKNLTNTSNFNATPIIGMSCVANLNKTYAISSSLISFYIPV 188          

HSP 2 Score: 70.8626 bits (172), Expect = 1.225e-12
Identity = 39/98 (39.80%), Postives = 54/98 (55.10%), Query Frame = 1
Query: 1222 KKRYKRSVSISLGKKFKKFAREQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFGQSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHIL 1515
            +++++ +    L   FKK   E K  KTL I+MG+F+ CWLPFFV N      +            V  W G+ NS++NP+IYA +  DFRRAF  IL
Sbjct:  231 QQQHRPNDEACLKSSFKK---ETKVLKTLSIIMGVFVFCWLPFFVLNCTVPFCDPPC--VSDTTFTVFVWFGWANSSLNPVIYAFNA-DFRRAFATIL 322          
BLAST of GCR001 vs. Ensembl Medaka
Match: ENSORLT00000039904.1 (D(1)-like dopamine receptor [Source:NCBI gene;Acc:101168519])

HSP 1 Score: 144.821 bits (364), Expect = 3.926e-37
Identity = 82/187 (43.85%), Postives = 121/187 (64.71%), Query Frame = 1
Query:  244 FVGVLFGILVLTTISGNILVIVSVIMERNLRT-ITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISF-PAILWWHVMESQKNLTKILLVDRTTL----CEFPDDKAYLIISSTISFYIPL 786
             VG +  +L+++T+ GN LV  +VI  R+LR+ +TNFF++SLA +DL +  +VMP+ A +E++   W+FG  +CD+W  FD++ STASILNLC+I+++R+WA  +P  Y  +M+H+   VMI + W  S LISF P  L WH    +KNLT     + T +    C    +K Y I SS ISFYIP+
Sbjct:   39 LVGCILFLLIVSTLLGNTLVCAAVIKFRHLRSKVTNFFVISLAVSDLFVAVLVMPWEAITEVT-NTWLFG-RFCDVWITFDIMCSTASILNLCIISVDRYWAIASPFKYERKMTHRVAFVMIGVAWTLSILISFIPVQLNWH----RKNLTNTSNFNATPIIGMSCVANLNKTYAISSSLISFYIPV 219          

HSP 2 Score: 71.2478 bits (173), Expect = 1.200e-12
Identity = 39/98 (39.80%), Postives = 54/98 (55.10%), Query Frame = 1
Query: 1222 KKRYKRSVSISLGKKFKKFAREQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFGQSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHIL 1515
            +++++ +    L   FKK   E K  KTL I+MG+F+ CWLPFFV N      +            V  W G+ NS++NP+IYA +  DFRRAF  IL
Sbjct:  262 QQQHRPNDEACLKSSFKK---ETKVLKTLSIIMGVFVFCWLPFFVLNCTVPFCDPPC--VSDTTFTVFVWFGWANSSLNPVIYAFNA-DFRRAFATIL 353          
BLAST of GCR001 vs. Ensembl Medaka
Match: adrb1 (adrenoceptor beta 1 [Source:ZFIN;Acc:ZDB-GENE-081022-145])

HSP 1 Score: 139.043 bits (349), Expect = 1.562e-35
Identity = 83/212 (39.15%), Postives = 124/212 (58.49%), Query Frame = 1
Query:  184 LMNSNGDTN--SSLIGPGMGTYFVG---------VLFGILVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISFPAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPL 786
            +M S  + N  SSL   G GT             ++  ++VL+ + GNILVI+++   + L+T+TN FIVSLA ADL+MG +V+PF A  E+  G W++G  +C++W + DVL  TASI  LC+IAI+R+ A  +P  Y S ++  R   ++ +VW  S+L+SF  IL    M   ++       +    C+F  ++AY I SS ISFYIPL
Sbjct:   13 VMRSGPEINPASSLASNGQGTVPAASEQWTAGMSLVMALIVLSIVFGNILVILAIARTQRLQTLTNVFIVSLASADLIMGLLVVPFGAVLEVR-GLWLYGSFFCEIWTSVDVLCVTASIETLCVIAIDRYVAITSPFRYQSLLTKSRAKAVVCVVWAISALVSFLPIL----MHWSRDSMDTDCYENPQCCDFVTNRAYAISSSVISFYIPL 219          

HSP 2 Score: 89.3521 bits (220), Expect = 1.257e-18
Identity = 45/99 (45.45%), Postives = 64/99 (64.65%), Query Frame = 1
Query: 1282 REQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFGQSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHILCGLCPLRS-QIFRLTRADVNR 1575
            REQKA KTLGI+MG F +CWLPFF+ N++     E   ++   V + + WLGY+NSA NP+IY  S  DFR+AF  +LC  CP ++ +   ++  D+ R
Sbjct:  269 REQKALKTLGIIMGTFTLCWLPFFIVNVVRVFCAELVDKN---VFVFLNWLGYVNSAFNPIIYCRS-PDFRKAFKRLLC--CPRQADRRLHISSCDLTR 361          
BLAST of GCR001 vs. Ensembl Medaka
Match: drd1b (dopamine receptor D1b [Source:ZFIN;Acc:ZDB-GENE-070524-2])

HSP 1 Score: 139.813 bits (351), Expect = 2.066e-35
Identity = 80/190 (42.11%), Postives = 118/190 (62.11%), Query Frame = 1
Query:  244 FVGVLFGILVLTTISGNILVIVSVIMERNLRT-ITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISF-PAILWWHVMESQKNLTKILLVDRTTLCEFPDD-------KAYLIISSTISFYIPL 786
              G    +L+ TT+ GN LV  +V   R+LRT +TN+F++SLA +DLL+  +VMP+ A +E+  G+W FG  +C++W AFD++ STASILNLC+I+++R+WA  +P  Y  +M+ K   +MI+  W  S LISF P  L WH  ++    T    ++ T L + P D       + Y I SS ISFYIP+
Sbjct:   28 LTGCFLSLLIFTTLLGNTLVCAAVTKFRHLRTKVTNYFVISLAISDLLVAILVMPWKAATEI-MGFWPFG-AFCNVWVAFDIMCSTASILNLCVISVDRYWAISSPFRYERKMTPKVACLMISAAWTLSVLISFIPVQLNWHKAQT----TTYAELNGTYLLDLPPDNCDSSLNRTYAISSSLISFYIPV 211          

HSP 2 Score: 69.3218 bits (168), Expect = 5.061e-12
Identity = 41/100 (41.00%), Postives = 55/100 (55.00%), Query Frame = 1
Query: 1276 FAREQKAAKTLGIVMGIFIICWLPFFVCNILSAV--YNEAFGQSK-----GVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHILCG---LCPLRSQI 1545
            F RE K  KTL ++MG+F+ CWLPFF+ N +      N   G +           V  W G+ NS++NP+IYA +  DFR+AF  IL G   LCP  + I
Sbjct:  265 FKRETKVLKTLSVIMGVFVCCWLPFFILNCMVPFCETNMPDGSTDFPCISSTTFDVFVWFGWANSSLNPIIYAFNA-DFRKAF-SILLGCHRLCPGSNSI 362          
BLAST of GCR001 vs. Planmine SMEST
Match: SMESG000032972.1 (SMESG000032972.1)

HSP 1 Score: 838.951 bits (2166), Expect = 0.000e+0
Identity = 483/483 (100.00%), Postives = 483/483 (100.00%), Query Frame = 1
Query:  187 MNSNGDTNSSLIGPGMGTYFVGVLFGILVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISFPAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPLXXXXXXXXXXXXXXXXXXXXXXXXXKIVYKNSQSGEVLRLGIHRGGVYXXXXXXXXXXXXXVYHQKSKVNGNIKSEKSFLCFKYSVKLRPKDVSLTGLKVSFERKYSPIHLVXXXXXXXXXXXXXXXXXXXXXXXXXXXLKHTLKKKRYKRSVSISLGKKFKKFAREQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFGQSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHILCGLCPLRSQIFRLTRADVNRNVITPSSSVRVRSHHLGNMK 1635
            MNSNGDTNSSLIGPGMGTYFVGVLFGILVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISFPAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPLIIMIVVYIRIYRTATTVMKTLTTGTKIVYKNSQSGEVLRLGIHRGGVYNSNNKSNNSSDNNVYHQKSKVNGNIKSEKSFLCFKYSVKLRPKDVSLTGLKVSFERKYSPIHLVSSSYPSSFSSPTFQSCASESSASNSNSLKHTLKKKRYKRSVSISLGKKFKKFAREQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFGQSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHILCGLCPLRSQIFRLTRADVNRNVITPSSSVRVRSHHLGNMK
Sbjct:    1 MNSNGDTNSSLIGPGMGTYFVGVLFGILVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISFPAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPLIIMIVVYIRIYRTATTVMKTLTTGTKIVYKNSQSGEVLRLGIHRGGVYNSNNKSNNSSDNNVYHQKSKVNGNIKSEKSFLCFKYSVKLRPKDVSLTGLKVSFERKYSPIHLVSSSYPSSFSSPTFQSCASESSASNSNSLKHTLKKKRYKRSVSISLGKKFKKFAREQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFGQSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHILCGLCPLRSQIFRLTRADVNRNVITPSSSVRVRSHHLGNMK 483          
BLAST of GCR001 vs. Planmine SMEST
Match: SMESG000018302.1 (SMESG000018302.1)

HSP 1 Score: 287.345 bits (734), Expect = 4.212e-91
Identity = 187/425 (44.00%), Postives = 249/425 (58.59%), Query Frame = 1
Query:  268 LVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISFPAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPLXXXXXXXXXXXXXXXXXXXXXXXXXKIVYKNSQS--GEVLRLGIHRGGVYXXXXXXXXXXXXXVYHQKSKVNGNIKSEKSFLCFKYSVKLRPKDVSLTGLKVSFERKYSPIHLVXXXXXXXXXXXXXXXXXXXXXXXXXXXLKHTLKKKRYKRSVSISLGKKFKKFAREQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNE----AFGQSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHILCGL 1524
            L   TI GN LVI++V    NLRT TN+FIVSLACADLLMG VVMPF+  +EL    WIFG  WCD+WHAFDVLS+TASILNLCMIAIER+  T +P+  G  +++K CI+MI +VW CS+ ISFPAI+WW     Q + T     D    C+FP D  Y+ ISS +SFY PL++M+V+Y +IYRTA  ++  L  G +++    ++     +RL IH+GG                  QK  +  N K++  +    +S K +P  +S   L    +    P+                      SSAS +  L+H             +LGKK  KF  EQKAA+TLG VMG FI+CWLPFF+CNIL+++ N+      G     ++ +VTWLGY+NS +NP+IYAHSMR FR AFI +LC +
Sbjct:   24 LSFGTIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWR----QSSDT----YDSVCSCKFPTDPFYISISSIVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGERVIEDGDKALNNPPVRLRIHKGGFRAL--------------QKPNLYQNSKNKSKW----FSWKTKPMGIS-EPLSCVADLCSGPV---------------------TSSASIAFKLRH------------FTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLLCPI 388          
BLAST of GCR001 vs. Planmine SMEST
Match: SMESG000005913.1 (SMESG000005913.1)

HSP 1 Score: 184.882 bits (468), Expect = 3.251e-51
Identity = 114/236 (48.31%), Postives = 161/236 (68.22%), Query Frame = 1
Query:  220 IGPGMGTYFVGVLFGILVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISFPAILWWHV-MESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPLXXXXXXXXXXXXXXXXXXXXXXXXXKIVYKNSQSGEV-LRLGIHRG 921
            I PGM   FV +L     L TI GN LVI++V+ ER LR++TN+FIVSLA ADL+MG +VMPF+   E+  G WI+G  WCD WHA DV SST SILNLC IA+ER++AT NPI + +R+S +R    IA +W+ S++ISFPAILWW   M+  +N  +         C F +D +YL++SS +SFY+PL+IM+ VY +IY+ AT  +++L +G +++   S+ G+  + L +HRG
Sbjct:   22 ISPGMT--FVAILLSCCSLLTILGNSLVIIAVLKERCLRSVTNYFIVSLAAADLVMGLIVMPFAVSEEILQGVWIYGSVWCDFWHATDVWSSTCSILNLCAIAVERYYATHNPILHAARISRQRSGFTIAGIWLFSAIISFPAILWWQARMDYPRNKNE---------CPFTNDSSYLLLSSILSFYMPLVIMVFVYYKIYKIATDTLRSLKSGFRVIKDKSEHGDTKIILNVHRG 246          

HSP 2 Score: 127.872 bits (320), Expect = 3.896e-31
Identity = 62/111 (55.86%), Postives = 83/111 (74.77%), Query Frame = 1
Query: 1258 GKKFKKFAREQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFG---QSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHILCGLCPLRSQIFRLTRADVNRNV 1581
            GK+ K F R+Q+AAKTLGIVMGIF++CWLPFFVCNIL A+  E      ++  +V+ VVTWLGY+NS++NP+IYAHSMRDFR AF+ IL  L  L+S + R +  + +R +
Sbjct:  369 GKRAKNFLRDQRAAKTLGIVMGIFVLCWLPFFVCNILVAIDGEILKPNTKTSKIVITVVTWLGYVNSSINPIIYAHSMRDFRMAFVKILTCL-DLKSWLCRTSEFENSRKL 478          
BLAST of GCR001 vs. Planmine SMEST
Match: SMESG000022087.1 (SMESG000022087.1)

HSP 1 Score: 182.185 bits (461), Expect = 2.728e-50
Identity = 111/236 (47.03%), Postives = 158/236 (66.95%), Query Frame = 1
Query:  220 IGPGMGTYFVGVLFGILVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISFPAILWWHV-MESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPLXXXXXXXXXXXXXXXXXXXXXXXXXKIVYKNSQSGEV-LRLGIHRG 921
            + PGM    V +L     L TI GN LVI++V+ ER LR++TN+FIVSLA ADL+MG +VMPF+   E+  G W++G  WCD WHA DV SST SILNLC IA+ER++AT NPI + +R+S +R    IA +W+ S++ISFPAILWW   M+  +N            C F +D +YL++SS +SFY+PL+IMI VY +IY+ AT  +++  +G +++   S+ G+  + L +HRG
Sbjct:   22 VSPGM--IIVAILLSCCSLLTILGNSLVIIAVLKERYLRSVTNYFIVSLAAADLVMGLIVMPFAVSEEILQGVWVYGSIWCDFWHATDVWSSTCSILNLCAIAVERYYATHNPILHAARISRQRSGFTIAGIWLFSAIISFPAILWWQARMDHPRN---------ENACPFTNDSSYLLLSSILSFYMPLVIMIFVYYKIYKIATATLQSFKSGFRVIKSKSEKGDTKIILNVHRG 246          

HSP 2 Score: 125.561 bits (314), Expect = 2.092e-30
Identity = 58/92 (63.04%), Postives = 72/92 (78.26%), Query Frame = 1
Query: 1258 GKKFKKFAREQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEAFG---QSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHILCGL 1524
            GK+ K   R+Q+AAKTLGIVMGIF++CWLPFFVCNIL A+  E      ++  +VM VVTWLGY+NS++NP+IYAHSMRDFR AF+ IL  L
Sbjct:  369 GKRAKSLLRDQRAAKTLGIVMGIFVLCWLPFFVCNILVAIDGEILPPNTKTSKIVMSVVTWLGYVNSSINPIIYAHSMRDFRTAFVKILTCL 460          
BLAST of GCR001 vs. Planmine SMEST
Match: SMESG000019254.1 (SMESG000019254.1)

HSP 1 Score: 130.954 bits (328), Expect = 2.915e-32
Identity = 72/182 (39.56%), Postives = 112/182 (61.54%), Query Frame = 1
Query:  241 YFVGVLFGILVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISFPAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPL 786
            Y   +  G ++L TI GN+ V+ ++++ER L+ ++N+ I+SLA ADL++  +VMP SA  E+S+ +W+ G   CDLW  FDVLS TASIL+L +IAI+R+WA  + I Y  R +  R I+MI  VW+ S +IS P+    H     +N  + L V     C   +  +Y + S+  +FY+P+
Sbjct:   28 YITALFLGAIILWTIIGNVFVVAAIVLERTLKNVSNYLILSLAVADLMVAILVMPISAIKEVSSTWWL-GIELCDLWTCFDVLSCTASILHLVVIAIDRYWAVTD-INYLHRRTSSRIILMIIGVWLISVIISVPSRFHTH-----RNNAEWLRVIVNGSCIINESVSYTVFSNLGAFYLPM 202          

HSP 2 Score: 76.6406 bits (187), Expect = 1.696e-14
Identity = 44/104 (42.31%), Postives = 60/104 (57.69%), Query Frame = 1
Query: 1213 TLKKKRYKRSVSISLGKKFKKFAREQKAAKTLGIVMGIFIICWLPFFVCNILSAVYN-EAFGQSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHILCG 1521
            + K  ++    S S+  K ++  RE+KAA+TL I+ G FIICWLPF + N+  A  N E  G    +   +  WLGY+NS +NP+IY     DFR AF  IL G
Sbjct:  403 SFKDNKFNAMNSASIRNKVEQ-KRERKAARTLAIITGCFIICWLPFGINNVAHAFCNTEPCGS--ALFDSLCLWLGYVNSGLNPVIYTVFSPDFRTAFRKILLG 503          
The following BLAST results are available for this feature:
BLAST of GCR001 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ADRB22.723e-3640.88adrenoceptor beta 2 [Source:HGNC Symbol;Acc:HGNC:2... [more]
DRD11.753e-3444.12dopamine receptor D1 [Source:HGNC Symbol;Acc:HGNC:... [more]
ADRB11.484e-3340.00adrenoceptor beta 1 [Source:HGNC Symbol;Acc:HGNC:2... [more]
ADRA1D3.925e-3333.48adrenoceptor alpha 1D [Source:HGNC Symbol;Acc:HGNC... [more]
ADRA1A1.083e-3237.57adrenoceptor alpha 1A [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of GCR001 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dop-41.356e-3941.57Dopamine receptor 4 [Source:UniProtKB/Swiss-Prot;... [more]
tyra-34.162e-2837.23TYRAmine receptor [Source:UniProtKB/TrEMBL;Acc:Q2... [more]
tyra-37.432e-2837.23TYRAmine receptor [Source:UniProtKB/TrEMBL;Acc:Q2... [more]
ser-21.127e-2736.52Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-P... [more]
ser-21.201e-2736.52Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of GCR001 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dop1R23.719e-4850.93gene:FBgn0266137 transcript:FBtr0085467[more]
Dop1R24.887e-4850.69gene:FBgn0266137 transcript:FBtr0085468[more]
Dop1R24.705e-4750.69gene:FBgn0266137 transcript:FBtr0330293[more]
Octbeta1R1.254e-3841.00gene:FBgn0038980 transcript:FBtr0100322[more]
Octbeta1R1.750e-3841.00gene:FBgn0038980 transcript:FBtr0301484[more]
back to top
BLAST of GCR001 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
drd6b8.394e-3743.84dopamine receptor D6b [Source:ZFIN;Acc:ZDB-GENE-12... [more]
adrb11.311e-3644.44adrenoceptor beta 1 [Source:ZFIN;Acc:ZDB-GENE-0810... [more]
adrb11.311e-3644.44adrenoceptor beta 1 [Source:ZFIN;Acc:ZDB-GENE-0810... [more]
AL935174.43.313e-3643.41pep chromosome:GRCz11:17:23255365:23262007:1 gene:... [more]
AL935174.53.313e-3643.41pep chromosome:GRCz11:CHR_ALT_CTG17_2_4:23255365:2... [more]
back to top
BLAST of GCR001 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DRD15.445e-3744.32dopamine receptor D1 [Source:NCBI gene;Acc:1004854... [more]
prrc2c4.166e-3637.85proline-rich coiled-coil 2C [Source:Xenbase;Acc:XB... [more]
llgl25.969e-3637.75LLGL2, scribble cell polarity complex component [S... [more]
crtam6.176e-3642.45cytotoxic and regulatory T cell molecule [Source:X... [more]
snrpa16.662e-3645.51small nuclear ribonucleoprotein polypeptide A' [So... [more]
back to top
BLAST of GCR001 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Drd54.487e-3641.00dopamine receptor D5 [Source:MGI Symbol;Acc:MGI:94... [more]
Adrb27.632e-3641.44adrenergic receptor, beta 2 [Source:MGI Symbol;Acc... [more]
Drd11.104e-3344.57dopamine receptor D1 [Source:MGI Symbol;Acc:MGI:99... [more]
Drd11.159e-3344.57dopamine receptor D1 [Source:MGI Symbol;Acc:MGI:99... [more]
Adra1a5.348e-3334.30adrenergic receptor, alpha 1a [Source:MGI Symbol;A... [more]
back to top
BLAST of GCR001 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q24563|DOPR2_DROME4.899e-4750.69Dopamine receptor 2 OS=Drosophila melanogaster OX=... [more]
sp|Q18775|DOPR4_CAEEL1.725e-3841.57Dopamine receptor 4 OS=Caenorhabditis elegans OX=6... [more]
sp|P42289|DRD1_XENLA2.129e-3744.86D(1A) dopamine receptor OS=Xenopus laevis OX=8355 ... [more]
sp|Q9VCZ3|OCTB1_DROME5.616e-3741.00Octopamine receptor beta-1R OS=Drosophila melanoga... [more]
sp|Q25322|OAR2_LOCMI6.208e-3739.55Putative tyramine receptor 2 OS=Locusta migratoria... [more]
back to top
BLAST of GCR001 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KUD50.000e+0100.00GCR001 OS=Schmidtea mediterranea OX=79327 GN=gcr00... [more]
A0A193KUK01.740e-8744.00GCR008 OS=Schmidtea mediterranea OX=79327 GN=gcr00... [more]
A0A4Y2D3942.311e-8636.91Dopamine receptor 2 OS=Araneus ventricosus OX=1828... [more]
A0A210PJ233.810e-8641.76Dopamine receptor 2 OS=Mizuhopecten yessoensis OX=... [more]
A0A1S3K9Y25.644e-8542.52dopamine receptor 2 isoform X1 OS=Lingula unguis O... [more]
back to top
BLAST of GCR001 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000046102.11.886e-3842.05pep primary_assembly:Astyanax_mexicanus-2.0:9:1071... [more]
ADRA1D4.371e-3641.11adrenoceptor alpha 1D [Source:NCBI gene;Acc:103027... [more]
adra2c1.811e-3436.95alpha-2C adrenergic receptor-like [Source:NCBI gen... [more]
adra1ba2.006e-3441.11adrenoceptor alpha 1B [Source:NCBI gene;Acc:103033... [more]
adrb3b3.393e-3439.01beta-3 adrenergic receptor [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of GCR001 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000271.14.843e-3540.00pep scaffold:Pmarinus_7.0:GL476504:17018:19617:1 g... [more]
ENSPMAT00000006872.18.166e-3437.56pep scaffold:Pmarinus_7.0:GL476537:253210:263579:1... [more]
ENSPMAT00000009127.14.164e-3134.85pep scaffold:Pmarinus_7.0:GL478629:43196:44446:-1 ... [more]
si:dkey-247m21.31.046e-3039.89si:dkey-247m21.3 [Source:ZFIN;Acc:ZDB-GENE-091204-... [more]
adra2c1.882e-3036.49adrenoceptor alpha 2C [Source:NCBI gene;Acc:266752... [more]
back to top
BLAST of GCR001 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR001 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO354501.523e-2336.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424631.750e-2132.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO473593.656e-2131.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476995.038e-2129.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493676.165e-2134.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of GCR001 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000037555.11.232e-3742.79D(1)-like dopamine receptor [Source:NCBI gene;Acc:... [more]
ENSORLT00000023621.23.160e-3743.85D(1)-like dopamine receptor [Source:NCBI gene;Acc:... [more]
ENSORLT00000039904.13.926e-3743.85D(1)-like dopamine receptor [Source:NCBI gene;Acc:... [more]
adrb11.562e-3539.15adrenoceptor beta 1 [Source:ZFIN;Acc:ZDB-GENE-0810... [more]
drd1b2.066e-3542.11dopamine receptor D1b [Source:ZFIN;Acc:ZDB-GENE-07... [more]
back to top
BLAST of GCR001 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000032972.10.000e+0100.00SMESG000032972.1[more]
SMESG000018302.14.212e-9144.00SMESG000018302.1[more]
SMESG000005913.13.251e-5148.31SMESG000005913.1[more]
SMESG000022087.12.728e-5047.03SMESG000022087.1[more]
SMESG000019254.12.915e-3239.56SMESG000019254.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021907 ID=SMED30021907|Name=GCR001|organism=Schmidtea mediterranea sexual|type=transcript|length=1810bp
TAGAAATTCTATCAAATTTTGTTGACCACTGAGAAAAAAAAATTTTTCAA
ATATTTCTTTACTAAATGCGATGCAATTTGCTGAAATTTCATTGGATAAT
TTGATGGAATTTGCATTTGAATTGAAATTTTCATTGCGGAGAATAATTAT
CAGAGCTCTACGGCGAGTGAAACACGTTTTCTACTGATGAATTCCAATGG
TGACACCAATTCGTCTCTCATAGGCCCAGGCATGGGCACCTACTTCGTTG
GGGTTCTGTTTGGGATTCTCGTTTTGACAACAATATCTGGAAACATTCTC
GTCATTGTGTCGGTGATAATGGAACGCAATCTAAGGACAATTACTAATTT
CTTTATTGTCTCGCTGGCTTGTGCCGATTTGTTGATGGGATGCGTGGTGA
TGCCGTTTTCTGCGTATTCCGAACTCAGTGCCGGCTATTGGATATTCGGG
TATCATTGGTGTGATCTTTGGCATGCGTTTGATGTTTTGAGTTCGACCGC
AAGTATTCTCAATTTATGCATGATTGCAATCGAGAGATTTTGGGCGACGG
AAAACCCCATAACTTACGGATCAAGGATGAGTCACAAAAGATGTATTGTC
ATGATTGCCATAGTTTGGATGTGTTCGTCTTTGATTTCTTTTCCAGCTAT
TCTATGGTGGCATGTAATGGAGTCACAGAAAAATCTTACGAAAATCCTAT
TAGTTGACCGAACAACCTTGTGTGAGTTTCCCGATGATAAGGCTTATTTA
ATAATATCTTCAACTATATCCTTTTACATTCCTCTAATTATTATGATAGT
TGTTTACATTAGAATATACCGAACGGCGACAACAGTCATGAAAACTCTTA
CGACTGGAACGAAAATTGTTTACAAAAACAGTCAAAGCGGAGAGGTATTA
CGTCTTGGTATTCACCGTGGAGGAGTTTACAATAGCAATAATAAAAGCAA
CAATTCATCAGATAATAATGTTTACCATCAAAAGAGTAAAGTCAACGGAA
ACATTAAATCTGAAAAGTCATTTTTATGTTTCAAATATTCTGTCAAACTC
AGACCTAAAGATGTTTCTTTGACTGGTCTCAAAGTGTCTTTCGAAAGAAA
ATATAGTCCAATTCATTTGGTTTCGAGCTCATATCCATCCTCGTTTTCGT
CGCCAACATTTCAAAGTTGTGCAAGCGAAAGTTCTGCCAGTAATTCTAAC
TCACTGAAGCATACTTTGAAAAAGAAACGCTACAAAAGATCTGTGTCGAT
TTCTTTGGGTAAGAAATTTAAAAAGTTTGCTAGAGAACAGAAAGCCGCCA
AAACTCTTGGCATTGTCATGGGGATTTTTATTATTTGCTGGTTGCCATTT
TTTGTTTGTAACATTCTTTCTGCTGTTTACAATGAAGCGTTTGGTCAGAG
CAAAGGTGTAGTTATGATTGTAGTTACGTGGTTGGGTTATATCAATTCAG
CCGTCAATCCGATGATATATGCTCATTCTATGAGGGATTTTAGACGGGCT
TTCATACACATTCTTTGTGGTTTATGTCCCCTTCGTTCTCAAATTTTCCG
ATTAACTCGGGCGGATGTAAATCGAAACGTAATAACACCTTCATCCTCGG
TTCGGGTTCGCAGCCATCATCTAGGAAATATGAAATAGTTGAACAATTCG
TAAGTAATTGTGATAAGTAGCATAATTAGCGGTAAAAAGCTTCTTGTATC
AAAAAGACTTAATATGAATATTTTGTCTATAGAACAGAACTGCAAAGAAT
TATTTCTATAGAATTTCAGATTAATATTAATTTATTGAATTTTTTATGTA
CATGATGCAC
back to top

protein sequence of SMED30021907-orf-1

>SMED30021907-orf-1 ID=SMED30021907-orf-1|Name=SMED30021907-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=484bp
MNSNGDTNSSLIGPGMGTYFVGVLFGILVLTTISGNILVIVSVIMERNLR
TITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDV
LSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLI
SFPAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPL
IIMIVVYIRIYRTATTVMKTLTTGTKIVYKNSQSGEVLRLGIHRGGVYNS
NNKSNNSSDNNVYHQKSKVNGNIKSEKSFLCFKYSVKLRPKDVSLTGLKV
SFERKYSPIHLVSSSYPSSFSSPTFQSCASESSASNSNSLKHTLKKKRYK
RSVSISLGKKFKKFAREQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNE
AFGQSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHILCGLCPLR
SQIFRLTRADVNRNVITPSSSVRVRSHHLGNMK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 135..156
score: 26.92
coord: 410..436
score: 34.87
coord: 99..121
score: 31.88
coord: 20..44
score: 27.33
coord: 53..74
score: 39.58
coord: 188..211
score: 29.44
coord: 370..394
score: 35.72
IPR000276G protein-coupled receptor, rhodopsin-likeSMARTSM013817TM_GPCR_Srsx_2coord: 28..443
e-value: 5.8E-4
score: -51.1
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 35..428
e-value: 3.2E-76
score: 256.1
NoneNo IPR availableGENE3DG3DSA:1.10.530.40coord: 218..361
e-value: 6.2E-134
score: 449.0
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 26..442
e-value: 6.2E-134
score: 449.0
NoneNo IPR availablePANTHERPTHR242475-HYDROXYTRYPTAMINE RECEPTORcoord: 24..459
NoneNo IPR availablePANTHERPTHR24247:SF134OCTOPAMINE RECEPTOR OAMBcoord: 24..459
NoneNo IPR availableCDDcd150677tmA_Dop1R2-likecoord: 21..439
e-value: 3.6393E-113
score: 332.784
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 8..459
NoneNo IPR availableTMHMMTMhelixcoord: 407..429
NoneNo IPR availableTMHMMTMhelixcoord: 375..397
NoneNo IPR availableTMHMMTMhelixcoord: 186..208
NoneNo IPR availableTMHMMTMhelixcoord: 20..42
NoneNo IPR availableTMHMMTMhelixcoord: 55..77
NoneNo IPR availableTMHMMTMhelixcoord: 136..158
NoneNo IPR availableTMHMMTMhelixcoord: 97..119
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 35..428
score: 43.923