Purple acid phosphatase

Overview
NamePurple acid phosphatase
Smed IDSMED30021884
Length (bp)1489
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Purple acid phosphatase (SMED30021884) t-SNE clustered cells

Violin plots show distribution of expression levels for Purple acid phosphatase (SMED30021884) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Purple acid phosphatase (SMED30021884) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Purple acid phosphatase (SMED30021884) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021884

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30021884SMESG000055143.1 SMESG000013996.1 SMESG000009621.1 Contig1731GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30021884SMESG000074506.1 Contig1731GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30021884SMESG000074506.1 dd_Smed_v4_1053_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30021884SMESG000074506.1 dd_Smed_v4_1053_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Purple acid phosphatase vs. Ensembl Human
Match: ACP7 (acid phosphatase 7, tartrate resistant (putative) [Source:HGNC Symbol;Acc:HGNC:33781])

HSP 1 Score: 405.986 bits (1042), Expect = 8.091e-138
Identity = 208/436 (47.71%), Postives = 287/436 (65.83%), Query Frame = 3
Query:   54 IFVIVLEFYIYFSSGQLYNQPEQIHLAIGNDTTTFVVTWVTLSWVNESMVIYG--PNDALDHKQNGTVDKFVDGGSQKRNIFMHRVTLKNLLPSTKYNYLVGSRFGWSEIHSFTTFPLGSNWPTRYVVIGDMGNLNARSLAAIQRETERGLYDMVLHVGDFAYNMDSYNAQTGDQFMRQIQPVAAQIPYMTIPGNHEQAYNFSNYRRRFTMPGGDGEGQFYSFNVGYAHIIGFSSEFYYFTGYGFKQIENQYNWLKNDLKEANKPENRAVRPWIIAMGHRPMYCSNSDDGEHCLNPINAIRIGMPITVKRYGSMFVFGLEKLFYEYGVDLIFGAHEHSYERMWPVYNSKVCNGTNQ-PYTNPPAPVHIVTGSAGNQEGEDPFYPNKPDWTAFHSSDYGYTRMNIFNSTHMHLEQVSDDLNGKVIDEILYIRNQHGQ 1352
              +++    +  S G     PEQ+HL+   +  +  VTW T      S V +G  P+  L  +  GT   FVDGG  +R +++HRVTL+ LLP  +Y Y  GS  GWS    F     G++W  R  V GD+G  N +++  ++R+T++G+YD VLHVGDFAYN+D  NA+ GD+FMR I+PVAA +PYMT PGNHE+ YNFSNY+ RF+MP GD EG +YS+++G AHII FS+E Y+F  YG   ++ Q+ WL++DL++ANK  NRA RPWII MGHRPMYCSN+D  + C    + +R G+           ++GLE LFY+YGVDL   AHEHSYER+WP+YN +V NG+ + PYTNP  PVHI+TGSAG +E   PF      W+A    +YGYTR++I N TH+H++QVSDD +GK++D++  +R   G+
Sbjct:   12 CLLLLFSLGVQGSLGAPSAAPEQVHLSYPGEPGSMTVTWTTWV-PTRSEVQFGLQPSGPLPLRAQGTFVPFVDGGILRRKLYIHRVTLRKLLPGVQYVYRCGSAQGWSRRFRFRALKNGAHWSPRLAVFGDLGADNPKAVPRLRRDTQQGMYDAVLHVGDFAYNLDQDNARVGDRFMRLIEPVAASLPYMTCPGNHEERYNFSNYKARFSMP-GDNEGLWYSWDLGPAHIISFSTEVYFFLHYGRHLVQRQFRWLESDLQKANK--NRAARPWIITMGHRPMYCSNADLDD-CTRHESKVRKGL--------QGKLYGLEDLFYKYGVDLQLWAHEHSYERLWPIYNYQVFNGSREMPYTNPRGPVHIITGSAGCEERLTPFAVFPRPWSAVRVKEYGYTRLHILNGTHIHIQQVSDDQDGKIVDDVWVVRPLFGR 434          
BLAST of Purple acid phosphatase vs. Ensembl Human
Match: ACP7 (acid phosphatase 7, tartrate resistant (putative) [Source:HGNC Symbol;Acc:HGNC:33781])

HSP 1 Score: 250.366 bits (638), Expect = 3.580e-80
Identity = 120/215 (55.81%), Postives = 160/215 (74.42%), Query Frame = 3
Query:  444 GNLNARSLAAIQRETERGLYDMVLHVGDFAYNMDSYNAQTGDQFMRQIQPVAAQIPYMTIPGNHEQAYNFSNYRRRFTMPGGDGEGQFYSFNVGYAHIIGFSSEFYYFTGYGFKQIENQYNWLKNDLKEANKPENRAVRPWIIAMGHRPMYCSNSDDGEHCLNPINAIRIGMPITVKRYGSMFVFGLEKLFYEYGVDLIFGAHEHSYERMWPVYN 1088
            G  N +++  ++R+T++G+YD VLHVGDFAYN+D  NA+ GD+FMR I+PVAA +PYMT PGNHE+ YNFSNY+ RF+MP GD EG +YS+++G AHII FS+E Y+F  YG   ++ Q+ WL++DL++ANK  NRA RPWII MGHRPMYCSN+ D + C    + +R G+           ++GLE LFY+YGVDL   AHEHSYER+WP+YN
Sbjct:    2 GADNPKAVPRLRRDTQQGMYDAVLHVGDFAYNLDQDNARVGDRFMRLIEPVAASLPYMTCPGNHEERYNFSNYKARFSMP-GDNEGLWYSWDLGPAHIISFSTEVYFFLHYGRHLVQRQFRWLESDLQKANK--NRAARPWIITMGHRPMYCSNA-DLDDCTRHESKVRKGLQGK--------LYGLEDLFYKYGVDLQLWAHEHSYERLWPIYN 204          
BLAST of Purple acid phosphatase vs. Ensembl Human
Match: ACP7 (acid phosphatase 7, tartrate resistant (putative) [Source:HGNC Symbol;Acc:HGNC:33781])

HSP 1 Score: 101.293 bits (251), Expect = 8.136e-23
Identity = 61/180 (33.89%), Postives = 93/180 (51.67%), Query Frame = 3
Query:   54 IFVIVLEFYIYFSSGQLYNQPEQIHLAIGNDTTTFVVTWVTLSWVNESMVIYG--PNDALDHKQNGTVDKFVDGGSQKRNIFMHRVTLKNLLPSTKYNYLVGSRFGWSEIHSFTTFPLGSNWPTRYVVIGDMGNLNARSLAAIQRETERGLYDMVLHVGDFAYNMDSYNAQTGDQFMRQI 587
              +++    +  S G     PEQ+HL+   +  +  VTW T      S V +G  P+  L  +  GT   FVDGG  +R +++HRVTL+ LLP  +Y Y  GS  GWS    F     G++W  R  V GD+G  N +++  ++R+T++G+YD VLHV   A ++ +  A      MR  
Sbjct:   12 CLLLLFSLGVQGSLGAPSAAPEQVHLSYPGEPGSMTVTWTTWV-PTRSEVQFGLQPSGPLPLRAQGTFVPFVDGGILRRKLYIHRVTLRKLLPGVQYVYRCGSAQGWSRRFRFRALKNGAHWSPRLAVFGDLGADNPKAVPRLRRDTQQGMYDAVLHV---ATSLTTRLASACRGIMRAC 187          
BLAST of Purple acid phosphatase vs. Ensembl Human
Match: ACP7 (acid phosphatase 7, tartrate resistant (putative) [Source:HGNC Symbol;Acc:HGNC:33781])

HSP 1 Score: 100.908 bits (250), Expect = 8.368e-23
Identity = 61/180 (33.89%), Postives = 93/180 (51.67%), Query Frame = 3
Query:   54 IFVIVLEFYIYFSSGQLYNQPEQIHLAIGNDTTTFVVTWVTLSWVNESMVIYG--PNDALDHKQNGTVDKFVDGGSQKRNIFMHRVTLKNLLPSTKYNYLVGSRFGWSEIHSFTTFPLGSNWPTRYVVIGDMGNLNARSLAAIQRETERGLYDMVLHVGDFAYNMDSYNAQTGDQFMRQI 587
              +++    +  S G     PEQ+HL+   +  +  VTW T      S V +G  P+  L  +  GT   FVDGG  +R +++HRVTL+ LLP  +Y Y  GS  GWS    F     G++W  R  V GD+G  N +++  ++R+T++G+YD VLHV   A ++ +  A      MR  
Sbjct:   12 CLLLLFSLGVQGSLGAPSAAPEQVHLSYPGEPGSMTVTWTTWV-PTRSEVQFGLQPSGPLPLRAQGTFVPFVDGGILRRKLYIHRVTLRKLLPGVQYVYRCGSAQGWSRRFRFRALKNGAHWSPRLAVFGDLGADNPKAVPRLRRDTQQGMYDAVLHV---ATSLTTRLASACRGIMRAC 187          
BLAST of Purple acid phosphatase vs. Ensembl Celegans
Match: F21A3.11 (Purple acid phosphatase [Source:UniProtKB/TrEMBL;Acc:H2FLJ4])

HSP 1 Score: 400.593 bits (1028), Expect = 2.180e-135
Identity = 208/416 (50.00%), Postives = 272/416 (65.38%), Query Frame = 3
Query:   96 GQLYNQPEQIHLAIGNDTTTFVVTWVTLSWVNESMVIYGPNDA-LDHKQNGTVDKFVDGGSQKRNIFMHRVTLKNLLPSTKYNYLVGSRFGWSEIHSFTTFPLGSNWPTRYVVIGDMGNLNARSLAAIQRETERGLYDMVLHVGDFAYNMDSYNAQTGDQFMRQIQPVAAQIPYMTIPGNHEQAYNFSNYRRRFTMPGGDGEGQFYSFNVGYAHIIGFSSEFYYFTGYGFKQIENQYNWLKNDLKEANKPENRAVRPWIIAMGHRPMYCSNSDDGEHCLNPINAIRIGMPITVKRYGSMFVFGLEKLFYEYGVDLIFGAHEHSYERMWPVYNSKVCNGTNQPYTNPPAPVHIVTGSAGNQEGEDPFYPNKPDWTAFHSSDYGYTRMNIFNSTHMHLEQVSDDLNGKVIDEILYIRN 1340
            G  + QPEQIHLA G D T++ +TW+T     +S+V YG + + L+H   G    F+DG       ++HRV L  L+P T+Y Y VGS  GWS I  FT      +    Y V GD+G  N RSL  IQ+  ++G  DMVLHVGDFAYNMD  N +TGD+F RQI+PVA  IPYM   GNHE   NF++Y  RFTMP  +    FYS++VG  H + FS+EFY++T +G+ Q+ENQYNWL NDLK+AN   NR   PWII MGHRPMYCS+  DG+ C    + IR G+P+T   +G    + LEKLFYEYGVD+   AHEHSYER+WPVYN  V NGT  PY +PPAPVHI+TGSAG +E  D F  + P W+A  S+DYG+  M ++NSTH++ +Q++    GK+ D+   +++
Sbjct:   41 GPSFGQPEQIHLAYGGDPTSYSITWMTYDDTLKSIVEYGTDISDLEHSVEGRCAVFLDGQKHSVWRYIHRVNLTGLVPGTRYFYHVGSDHGWSPIFFFTALKEREDGGFIYAVYGDLGVENGRSLGHIQKMAQKGQLDMVLHVGDFAYNMDESNGETGDEFFRQIEPVAGYIPYMATVGNHEYYNNFTHYVNRFTMPNSE-HNLFYSYDVGPVHFVVFSTEFYFYTQWGYHQMENQYNWLINDLKKANS--NRHNIPWIITMGHRPMYCSDF-DGDDCTKYESVIRTGLPLT---HG----YALEKLFYEYGVDVELWAHEHSYERLWPVYNRTVYNGTRHPYVDPPAPVHIITGSAGCRENTDVFVEHPPPWSAVRSTDYGFGVMRVYNSTHLNFKQINVAQEGKIDDDFWVVKS 445          
BLAST of Purple acid phosphatase vs. Ensembl Celegans
Match: C08B6.14 (Purple acid phosphatase [Source:UniProtKB/TrEMBL;Acc:G5EGR0])

HSP 1 Score: 276.559 bits (706), Expect = 6.803e-88
Identity = 168/423 (39.72%), Postives = 233/423 (55.08%), Query Frame = 3
Query:   66 VLEFYIYFSSGQLYNQPEQIHLAIGNDTTTFVVTWVTLSWVNESMVIYGPNDALDHKQNGTVDKFVDGGSQKRNIFMHRVTLKNLLPSTKYNYLVGSRFGWSEIHSFTTFPLGSNWPTRYVVIGDMGNLNARSLAAIQRETERGLYDMVLHVGDFAYNMDSYNAQTGDQFMRQIQPVAAQIPYMTIPGNHEQA-YNFSNYRRRFTMP-GGDGEGQFYSFNVGYAHIIGFSSEFYYFT-GYGFKQIENQYNWLKNDLKEANKPENRAVRPWIIAMGHRPMYCSNSDDGEHCLNPINAIRIGMPITVKRYGSMFVFGLEKLFYEYGVDLIFGAHEHSYERMWPVYNSKVCNGTNQPYTNPPAPVHIVTGSAGNQEGEDPFYPNKPDWTAFHSSDYGYTRMNIFNSTHMHLEQVSDDLNGKVIDEI 1325
            V+ F ++F+   L   PEQ+HLA         V+W+T      S+  YG +        GT + ++ GG  + +   H V LKNL PST+Y Y + SR       +F T P       +  V GD+G  N RS  +I      G +  ++H+GD AY++ S N + GDQ+M  ++PV ++IPYM I GNHE    NF+N++ RF MP  G  + QFYS ++G  H +G S+E+Y F   YG   I  Q++WL  +L EANK  NR   PWI+   HRP YCS  +DG+ C    N         V R+G+  + GLE+ + +  VD+ F  H H+YERMWPV + K   G+ + Y NP APV+ +TGSAG       F P    W+A  S DYGYT M + N+TH+H EQ+S D NG VID I
Sbjct:    4 VILFVLFFTRHVL-TLPEQVHLAFYTSPWDISVSWITFENAEPSLT-YGTSSKSMLNVTGTTNTWIFGGITRHS---HVVILKNLNPSTQYYYQIDSR-----KFNFRTLPTDLT-SYKVCVFGDLGVYNGRSTQSIIHNGIAGKFGFIVHIGDLAYDLHSNNGKLGDQYMNLLEPVISKIPYMVIAGNHENDNANFTNFKNRFVMPPTGSDDNQFYSIDIGPVHSVGLSTEYYGFEEQYGNASIFTQFDWLTKNLNEANK--NRESVPWIVMYQHRPFYCS-VEDGDDCTLYENV--------VLRHGAFGIPGLEQEYIKNSVDIGFAGHMHAYERMWPVADMKYYKGS-EAYHNPVAPVYFLTGSAGCHSSGMKFSPIPMPWSAHRSDDYGYTVMTVANTTHIHFEQISIDKNGDVIDSI 403          
BLAST of Purple acid phosphatase vs. Ensembl Celegans
Match: papl-1 (Purple acid phosphatase [Source:UniProtKB/TrEMBL;Acc:Q19553])

HSP 1 Score: 242.662 bits (618), Expect = 1.354e-74
Identity = 155/438 (35.39%), Postives = 235/438 (53.65%), Query Frame = 3
Query:   48 LCIFVIVLEFYIYFSSGQLYNQPEQIHLAIGNDTTTFVVTWVTLSWVNESMVIYGPNDALDHKQNGTVDKFVDGGSQKRNIFMHRVTLKNLLPSTKYNYLVGSRFGWSEIHSFTTFPLGSNWPTRY--VVIGDMGNLNARSLAAIQRETERGLYDMVLHVGDFAYNMDSYNAQTGDQFMRQIQPVAAQIPYMTIPGNHEQAY-NFSNYRRRFTMP-GGDGEGQFYSFNVGYAHIIGFS-SEFYYFTGYGFKQIENQYNWLKNDLKEANKPENRAVRPWIIAMGHRPMYCSNSDDGEHCLNPINAIRIGMPITVKRYGSMFVFGLEKLFYEYGVDLIFGAHEHSYERMWPVYNSKVCNGTNQPYTNPPAPVHIVTGSAGNQEGEDPFYPNKP-DWTAFHSSDYGYTRMNIFNSTHMHLEQVSDDLNGKVIDEILYIRNQ 1343
            + + VI L      S G     P+Q+H++   D T   V W T S V++ +              G+ + +V GG  +   + H+  +  L  ST+Y+Y + SR       SF T    SN P  Y   V GD+G  +  S  +I +    G +D ++H+GD AY++ + N Q GD ++   +P+ +++PYM I GNHE  Y NF+NY++RF++P  G  + QFYSF++G  H +G S   + Y+  YG   +  QY+WLK DL  AN   NRA  PWI    HRP YCSN +  E C +  N +         R G + + GLE LF +  VD  F  HEHSYER +PV +    N  N  Y NP APV++++GSAG     D  + +KP  W+A  ++DYG++ + + N TH+ +EQ+S D N + +D+   I+++
Sbjct:    5 ITLTVISLLVTKCISEG---TTPDQVHISFTGDMTEMAVVWNTFSEVSQDVTYGKTGSGATSTAKGSSEAWVFGGITR---YRHKAIMTGLEYSTEYDYTIASR-----KFSFKTL---SNDPQSYKVCVFGDLGYWHGNSTESIIKHGLAGDFDFIVHLGDIAYDLHTNNGQVGDSYLNVFEPLISKVPYMVIAGNHEDDYQNFTNYQKRFSVPDNGHNDNQFYSFDLGPVHWVGVSTETYGYYYEYGMDPVMTQYDWLKRDLTTANS--NRAAHPWIFTFQHRPFYCSNVNSAE-CQSFENRL--------VRTGWLDMPGLEPLFLQTSVDFGFWGHEHSYERFYPVADRAYWNDPNA-YINPKAPVYLISGSAGCHT-PDALFTDKPWPWSAARNNDYGWSIVTVANRTHIRVEQISIDKNEQTVDDFWVIKDE 415          
BLAST of Purple acid phosphatase vs. Ensembl Celegans
Match: papl-1 (Purple acid phosphatase [Source:UniProtKB/TrEMBL;Acc:Q19553])

HSP 1 Score: 242.662 bits (618), Expect = 1.354e-74
Identity = 155/438 (35.39%), Postives = 235/438 (53.65%), Query Frame = 3
Query:   48 LCIFVIVLEFYIYFSSGQLYNQPEQIHLAIGNDTTTFVVTWVTLSWVNESMVIYGPNDALDHKQNGTVDKFVDGGSQKRNIFMHRVTLKNLLPSTKYNYLVGSRFGWSEIHSFTTFPLGSNWPTRY--VVIGDMGNLNARSLAAIQRETERGLYDMVLHVGDFAYNMDSYNAQTGDQFMRQIQPVAAQIPYMTIPGNHEQAY-NFSNYRRRFTMP-GGDGEGQFYSFNVGYAHIIGFS-SEFYYFTGYGFKQIENQYNWLKNDLKEANKPENRAVRPWIIAMGHRPMYCSNSDDGEHCLNPINAIRIGMPITVKRYGSMFVFGLEKLFYEYGVDLIFGAHEHSYERMWPVYNSKVCNGTNQPYTNPPAPVHIVTGSAGNQEGEDPFYPNKP-DWTAFHSSDYGYTRMNIFNSTHMHLEQVSDDLNGKVIDEILYIRNQ 1343
            + + VI L      S G     P+Q+H++   D T   V W T S V++ +              G+ + +V GG  +   + H+  +  L  ST+Y+Y + SR       SF T    SN P  Y   V GD+G  +  S  +I +    G +D ++H+GD AY++ + N Q GD ++   +P+ +++PYM I GNHE  Y NF+NY++RF++P  G  + QFYSF++G  H +G S   + Y+  YG   +  QY+WLK DL  AN   NRA  PWI    HRP YCSN +  E C +  N +         R G + + GLE LF +  VD  F  HEHSYER +PV +    N  N  Y NP APV++++GSAG     D  + +KP  W+A  ++DYG++ + + N TH+ +EQ+S D N + +D+   I+++
Sbjct:    5 ITLTVISLLVTKCISEG---TTPDQVHISFTGDMTEMAVVWNTFSEVSQDVTYGKTGSGATSTAKGSSEAWVFGGITR---YRHKAIMTGLEYSTEYDYTIASR-----KFSFKTL---SNDPQSYKVCVFGDLGYWHGNSTESIIKHGLAGDFDFIVHLGDIAYDLHTNNGQVGDSYLNVFEPLISKVPYMVIAGNHEDDYQNFTNYQKRFSVPDNGHNDNQFYSFDLGPVHWVGVSTETYGYYYEYGMDPVMTQYDWLKRDLTTANS--NRAAHPWIFTFQHRPFYCSNVNSAE-CQSFENRL--------VRTGWLDMPGLEPLFLQTSVDFGFWGHEHSYERFYPVADRAYWNDPNA-YINPKAPVYLISGSAGCHT-PDALFTDKPWPWSAARNNDYGWSIVTVANRTHIRVEQISIDKNEQTVDDFWVIKDE 415          
BLAST of Purple acid phosphatase vs. Ensembl Celegans
Match: papl-1 (Purple acid phosphatase [Source:UniProtKB/TrEMBL;Acc:Q19553])

HSP 1 Score: 230.72 bits (587), Expect = 2.070e-70
Identity = 146/404 (36.14%), Postives = 220/404 (54.46%), Query Frame = 3
Query:  150 TTFVVTWVTLSWVNESMVIYGPNDALDHKQNGTVDKFVDGGSQKRNIFMHRVTLKNLLPSTKYNYLVGSRFGWSEIHSFTTFPLGSNWPTRY--VVIGDMGNLNARSLAAIQRETERGLYDMVLHVGDFAYNMDSYNAQTGDQFMRQIQPVAAQIPYMTIPGNHEQAY-NFSNYRRRFTMP-GGDGEGQFYSFNVGYAHIIGFS-SEFYYFTGYGFKQIENQYNWLKNDLKEANKPENRAVRPWIIAMGHRPMYCSNSDDGEHCLNPINAIRIGMPITVKRYGSMFVFGLEKLFYEYGVDLIFGAHEHSYERMWPVYNSKVCNGTNQPYTNPPAPVHIVTGSAGNQEGEDPFYPNKP-DWTAFHSSDYGYTRMNIFNSTHMHLEQVSDDLNGKVIDEILYIRNQ 1343
            T   V W T S V++ +              G+ + +V GG  +   + H+  +  L  ST+Y+Y + SR       SF T    SN P  Y   V GD+G  +  S  +I +    G +D ++H+GD AY++ + N Q GD ++   +P+ +++PYM I GNHE  Y NF+NY++RF++P  G  + QFYSF++G  H +G S   + Y+  YG   +  QY+WLK DL  AN   NRA  PWI    HRP YCSN +  E C +  N +         R G + + GLE LF +  VD  F  HEHSYER +PV +    N  N  Y NP APV++++GSAG     D  + +KP  W+A  ++DYG++ + + N TH+ +EQ+S D N + +D+   I+++
Sbjct:    2 TEMAVVWNTFSEVSQDVTYGKTGSGATSTAKGSSEAWVFGGITR---YRHKAIMTGLEYSTEYDYTIASR-----KFSFKTL---SNDPQSYKVCVFGDLGYWHGNSTESIIKHGLAGDFDFIVHLGDIAYDLHTNNGQVGDSYLNVFEPLISKVPYMVIAGNHEDDYQNFTNYQKRFSVPDNGHNDNQFYSFDLGPVHWVGVSTETYGYYYEYGMDPVMTQYDWLKRDLTTANS--NRAAHPWIFTFQHRPFYCSNVNSAE-CQSFENRL--------VRTGWLDMPGLEPLFLQTSVDFGFWGHEHSYERFYPVADRAYWNDPNA-YINPKAPVYLISGSAGCHT-PDALFTDKPWPWSAARNNDYGWSIVTVANRTHIRVEQISIDKNEQTVDDFWVIKDE 381          
BLAST of Purple acid phosphatase vs. Ensembl Fly
Match: CG1637 (gene:FBgn0030245 transcript:FBtr0073406)

HSP 1 Score: 448.743 bits (1153), Expect = 1.286e-154
Identity = 224/431 (51.97%), Postives = 290/431 (67.29%), Query Frame = 3
Query:  111 QPEQIHLAIGNDT-TTFVVTWVTLSWVNE------SMVIYGP----NDALDHKQNGTVDKFVDGGSQKRNIFMHRVTLKNLLPSTKYNYLVGSRFGWSEIHSFTTFPLGS-NWPTRYVVIGDMGNLNARSLAAIQRETERGLYDMVLHVGDFAYNMDSYNAQTGDQFMRQIQPVAAQIPYMTIPGNHEQAYNFSNYRRRFTMPGGDGEGQFYSFNVGYAHIIGFSSEFYYFTGYGFKQIENQYNWLKNDLKEANKPENRAVRPWIIAMGHRPMYCSNSDDGEHCLNPINAIRIGMPITVKRYGSMFVFGLEKLFYEYGVDLIFGAHEHSYERMWPVYNSKVCNGT--NQPYTNPPAPVHIVTGSAGNQEGEDPFYPNKPDWTAFHSSDYGYTRMNIFNSTHMHLEQVSDDLNGKVIDEILYIRNQHGQVFN 1361
            QPEQ+HL+ G  T +  VVTW T S   +      S+V YG        L  +  G   KFVDGG ++   F+HRVTL++L P+  Y+Y  GS FGWS I  F T P  S +W     + GDMGN NA+SLA +Q+ET+RG+YD ++HVGDFAY+M++ NA+ GD+FMRQI+ VAA +PYM +PGNHE+ +NFSNYR RF+MPGG  E  FYSF++G  H +G S+E YYF  YG K +  Q+ WL+ DL +AN PENR  RPWII  GHRPMYCSN +D + C +     R+G P        + +FGLE L YE+GVD+   AHEHSYER+WP+Y+ KV NGT  + PY +P APVHIVTGSAG +EG +PF    P+W+AFHS DYGYTR+   N TH+H EQVSDD NG +ID+   ++++HG   N
Sbjct:   37 QPEQVHLSFGERTDSEIVVTWSTRSLPPDQEVGAVSVVEYGQLVDGQVRLTQQARGKATKFVDGGHKQATQFIHRVTLRDLEPNATYSYHCGSDFGWSAIFQFRTVPSASVDWSPSLAIYGDMGNENAQSLARLQQETQRGMYDAIIHVGDFAYDMNTKNARVGDEFMRQIETVAAYLPYMVVPGNHEEKFNFSNYRARFSMPGGT-ENMFYSFDLGPVHFVGISTEVYYFLNYGLKPLVFQFEWLREDLAKANLPENRNKRPWIILYGHRPMYCSNENDND-CTHSETLTRVGWPF-------VHMFGLEPLLYEFGVDVAIWAHEHSYERLWPIYDYKVRNGTLKDSPYNDPSAPVHIVTGSAGCKEGREPFKGKIPEWSAFHSQDYGYTRLKAHNRTHIHFEQVSDDKNGAIIDDFWLVKSKHGSYRN 458          
BLAST of Purple acid phosphatase vs. Ensembl Fly
Match: CG1637 (gene:FBgn0030245 transcript:FBtr0339836)

HSP 1 Score: 448.358 bits (1152), Expect = 2.011e-154
Identity = 224/432 (51.85%), Postives = 290/432 (67.13%), Query Frame = 3
Query:  111 QPEQIHLAIGNDTT--TFVVTWVTLSWVNE------SMVIYGP----NDALDHKQNGTVDKFVDGGSQKRNIFMHRVTLKNLLPSTKYNYLVGSRFGWSEIHSFTTFPLGS-NWPTRYVVIGDMGNLNARSLAAIQRETERGLYDMVLHVGDFAYNMDSYNAQTGDQFMRQIQPVAAQIPYMTIPGNHEQAYNFSNYRRRFTMPGGDGEGQFYSFNVGYAHIIGFSSEFYYFTGYGFKQIENQYNWLKNDLKEANKPENRAVRPWIIAMGHRPMYCSNSDDGEHCLNPINAIRIGMPITVKRYGSMFVFGLEKLFYEYGVDLIFGAHEHSYERMWPVYNSKVCNGT--NQPYTNPPAPVHIVTGSAGNQEGEDPFYPNKPDWTAFHSSDYGYTRMNIFNSTHMHLEQVSDDLNGKVIDEILYIRNQHGQVFN 1361
            QPEQ+HL+ G + T    VVTW T S   +      S+V YG        L  +  G   KFVDGG ++   F+HRVTL++L P+  Y+Y  GS FGWS I  F T P  S +W     + GDMGN NA+SLA +Q+ET+RG+YD ++HVGDFAY+M++ NA+ GD+FMRQI+ VAA +PYM +PGNHE+ +NFSNYR RF+MPGG  E  FYSF++G  H +G S+E YYF  YG K +  Q+ WL+ DL +AN PENR  RPWII  GHRPMYCSN +D + C +     R+G P        + +FGLE L YE+GVD+   AHEHSYER+WP+Y+ KV NGT  + PY +P APVHIVTGSAG +EG +PF    P+W+AFHS DYGYTR+   N TH+H EQVSDD NG +ID+   ++++HG   N
Sbjct:   37 QPEQVHLSFGAERTDSEIVVTWSTRSLPPDQEVGAVSVVEYGQLVDGQVRLTQQARGKATKFVDGGHKQATQFIHRVTLRDLEPNATYSYHCGSDFGWSAIFQFRTVPSASVDWSPSLAIYGDMGNENAQSLARLQQETQRGMYDAIIHVGDFAYDMNTKNARVGDEFMRQIETVAAYLPYMVVPGNHEEKFNFSNYRARFSMPGGT-ENMFYSFDLGPVHFVGISTEVYYFLNYGLKPLVFQFEWLREDLAKANLPENRNKRPWIILYGHRPMYCSNENDND-CTHSETLTRVGWPF-------VHMFGLEPLLYEFGVDVAIWAHEHSYERLWPIYDYKVRNGTLKDSPYNDPSAPVHIVTGSAGCKEGREPFKGKIPEWSAFHSQDYGYTRLKAHNRTHIHFEQVSDDKNGAIIDDFWLVKSKHGSYRN 459          
BLAST of Purple acid phosphatase vs. Ensembl Fly
Match: CG1637 (gene:FBgn0030245 transcript:FBtr0073407)

HSP 1 Score: 442.58 bits (1137), Expect = 2.031e-152
Identity = 218/418 (52.15%), Postives = 283/418 (67.70%), Query Frame = 3
Query:  111 QPEQIHLAIGNDTTTFVVTWVTLSWVNESMVIYGPNDALDHK--QNGTVDKFVDGGSQKRNIFMHRVTLKNLLPSTKYNYLVGSRFGWSEIHSFTTFPLGSNWPTRYVVIGDMGNLNARSLAAIQRETERGLYDMVLHVGDFAYNMDSYNAQTGDQFMRQIQPVAAQIPYMTIPGNHEQAYNFSNYRRRFTMPGGDGEGQFYSFNVGYAHIIGFSSEFYYFTGYGFKQIENQYNWLKNDLKEANKPENRAVRPWIIAMGHRPMYCSNSDDGEH-CLNPINA-IRIGMPITVKRYGSMFVFGLEKLFYEYGVDLIFGAHEHSYERMWPVYNSKVCNGTNQ-PYTNPPAPVHIVTGSAGNQEGEDPFYPNKPDWTAFHSSDYGYTRMNIFNSTHMHLEQVSDDLNGKVIDEILYIRNQHG 1349
            QPEQ+HL+ G++    VVTW T S  N S+V +  N   D     NGT  +FVDGG + R  ++H V LK+L P T+Y Y  GS  GWS + +F T P G  W     + GDMGN NA+S+  +Q++TERG+YD ++HVGDFAY+MD+ NA  GD FMRQI+ VAA +PYM  PGNHE+ YNFSNYR RF MP G+ +  +YSFN+G  H + FS+E YYF  YGFK +  Q+ WL+ DL EAN PENRA RPWII  GHRPMYC  SDD E+ C + +   IR G+P+       +  FGLE LFY++GVD+   AHEH Y R+WP+Y+ KV NG+ + PYTNP AP+ I+TGSAG +E  +PF  + P W A+HS+DYGYTR+   N TH+H EQVSDD NG ++D    I+++HG
Sbjct:   37 QPEQVHLSFGDNLRDIVVTWSTRSSPNASVVKFSRNYLKDEPIMVNGTWQRFVDGGKKARTQYIHNVELKDLEPDTRYEYSCGSPLGWSAVFNFKTPPAGEKWSPSLAIFGDMGNENAQSMGRLQQDTERGMYDAIIHVGDFAYDMDTSNAAVGDAFMRQIESVAAYVPYMVCPGNHEEKYNFSNYRARFNMP-GETDSLWYSFNLGPVHFVSFSTEVYYFLSYGFKLLTKQFEWLERDLAEANLPENRAKRPWIITYGHRPMYC--SDDKEYDCNSQLETYIRQGLPM-------LKWFGLEDLFYKHGVDVEIFAHEHFYTRLWPIYDYKVYNGSAEAPYTNPKAPIQIITGSAGCKEEREPFSNDLPIWNAYHSNDYGYTRLKAHNGTHLHFEQVSDDQNGAIVDSFWVIKDKHG 444          
BLAST of Purple acid phosphatase vs. Ensembl Fly
Match: CG1637 (gene:FBgn0030245 transcript:FBtr0346382)

HSP 1 Score: 441.81 bits (1135), Expect = 4.711e-152
Identity = 217/416 (52.16%), Postives = 281/416 (67.55%), Query Frame = 3
Query:  111 QPEQIHLAIGNDTTTFVVTWVTLSWVNESMVIYGPNDALDHKQNGTV--DKFVDGGSQKRNIFMHRVTLKNLLPSTKYNYLVGSRFGWSEIHSFTTFPLGSNWPTRYVVIGDMGNLNARSLAAIQRETERGLYDMVLHVGDFAYNMDSYNAQTGDQFMRQIQPVAAQIPYMTIPGNHEQAYNFSNYRRRFTMPGGDGEGQFYSFNVGYAHIIGFSSEFYYFTGYGFKQIENQYNWLKNDLKEANKPENRAVRPWIIAMGHRPMYCSNSDDGEHCLNPINAIRIGMPITVKRYGSMFVFGLEKLFYEYGVDLIFGAHEHSYERMWPVYNSKVCNGT-NQPYTNPPAPVHIVTGSAGNQEGEDPFYPNKPDWTAFHSSDYGYTRMNIFNSTHMHLEQVSDDLNGKVIDEILYIRNQHG 1349
            QPEQ+HL+ G      VVTW T    NES+  +G  D L  +   T    KFVDGG++K   ++HRVTL +L P++ Y Y  GS  GWS  + F T    ++W     + GDMG +NA SL A+QRET+ G YD ++HVGDFAY+MD  N + GD+FMRQ++ +AA +PYM   GNHE+ YNFS+Y  RF+MPGG  +  FYSF++G  H IGFS+E YYFT +G KQI  QY+WL+ DL EANKPENR  RPWII  GHRPMYCSN D+G+ C N    +R G+P+       +  FGLE LFY+YGVD+   AHEH YERMWP+YN  V NG+  +PY NP AP+HI++G+AGN EG +PF+   P W+AFHS D+GY R+   N TH+H EQVSDD  G+VID    ++++HG
Sbjct:   37 QPEQVHLSFGETVLDIVVTWNTRDNTNESICEFGI-DGLHQRVKATQMPTKFVDGGAKKATQYIHRVTLSHLKPNSTYLYHCGSELGWSATYWFRTRFDHADWSPSLAIYGDMGVVNAASLPALQRETQSGQYDAIIHVGDFAYDMDWENGEVGDEFMRQVETIAAYLPYMVCVGNHEEKYNFSHYINRFSMPGG-SDNMFYSFDLGPVHFIGFSTEVYYFTKFGIKQIVMQYDWLERDLIEANKPENRKKRPWIITYGHRPMYCSN-DNGDDCANHETIVRKGLPM-------LDFFGLEPLFYQYGVDIELWAHEHCYERMWPMYNYTVFNGSLAEPYVNPGAPIHIISGAAGNHEGREPFFKRMPPWSAFHSQDFGYLRLKAHNGTHLHFEQVSDDKKGEVIDSFWVVKDKHG 442          
BLAST of Purple acid phosphatase vs. Ensembl Fly
Match: CG1637 (gene:FBgn0030245 transcript:FBtr0073408)

HSP 1 Score: 441.81 bits (1135), Expect = 4.711e-152
Identity = 217/416 (52.16%), Postives = 281/416 (67.55%), Query Frame = 3
Query:  111 QPEQIHLAIGNDTTTFVVTWVTLSWVNESMVIYGPNDALDHKQNGTV--DKFVDGGSQKRNIFMHRVTLKNLLPSTKYNYLVGSRFGWSEIHSFTTFPLGSNWPTRYVVIGDMGNLNARSLAAIQRETERGLYDMVLHVGDFAYNMDSYNAQTGDQFMRQIQPVAAQIPYMTIPGNHEQAYNFSNYRRRFTMPGGDGEGQFYSFNVGYAHIIGFSSEFYYFTGYGFKQIENQYNWLKNDLKEANKPENRAVRPWIIAMGHRPMYCSNSDDGEHCLNPINAIRIGMPITVKRYGSMFVFGLEKLFYEYGVDLIFGAHEHSYERMWPVYNSKVCNGT-NQPYTNPPAPVHIVTGSAGNQEGEDPFYPNKPDWTAFHSSDYGYTRMNIFNSTHMHLEQVSDDLNGKVIDEILYIRNQHG 1349
            QPEQ+HL+ G      VVTW T    NES+  +G  D L  +   T    KFVDGG++K   ++HRVTL +L P++ Y Y  GS  GWS  + F T    ++W     + GDMG +NA SL A+QRET+ G YD ++HVGDFAY+MD  N + GD+FMRQ++ +AA +PYM   GNHE+ YNFS+Y  RF+MPGG  +  FYSF++G  H IGFS+E YYFT +G KQI  QY+WL+ DL EANKPENR  RPWII  GHRPMYCSN D+G+ C N    +R G+P+       +  FGLE LFY+YGVD+   AHEH YERMWP+YN  V NG+  +PY NP AP+HI++G+AGN EG +PF+   P W+AFHS D+GY R+   N TH+H EQVSDD  G+VID    ++++HG
Sbjct:   37 QPEQVHLSFGETVLDIVVTWNTRDNTNESICEFGI-DGLHQRVKATQMPTKFVDGGAKKATQYIHRVTLSHLKPNSTYLYHCGSELGWSATYWFRTRFDHADWSPSLAIYGDMGVVNAASLPALQRETQSGQYDAIIHVGDFAYDMDWENGEVGDEFMRQVETIAAYLPYMVCVGNHEEKYNFSHYINRFSMPGG-SDNMFYSFDLGPVHFIGFSTEVYYFTKFGIKQIVMQYDWLERDLIEANKPENRKKRPWIITYGHRPMYCSN-DNGDDCANHETIVRKGLPM-------LDFFGLEPLFYQYGVDIELWAHEHCYERMWPMYNYTVFNGSLAEPYVNPGAPIHIISGAAGNHEGREPFFKRMPPWSAFHSQDFGYLRLKAHNGTHLHFEQVSDDKKGEVIDSFWVVKDKHG 442          
BLAST of Purple acid phosphatase vs. Ensembl Zebrafish
Match: acp7 (acid phosphatase 7, tartrate resistant (putative) [Source:NCBI gene;Acc:571830])

HSP 1 Score: 401.364 bits (1030), Expect = 2.115e-136
Identity = 203/408 (49.75%), Postives = 275/408 (67.40%), Query Frame = 3
Query:   87 FSSGQLYNQPEQIHLAIGNDTTTFVVTWVTLSWVNESMVIYG--PNDALDHKQNGTVDKFVDGGSQKRNIFMHRVTLKNLLPSTKYNYLVGSRFGWSEIHSFTTFPLGSNWPTRYVVIGDMGNLNARSLAAIQRETERGLYDMVLHVGDFAYNMDSYNAQTGDQFMRQIQPVAAQIPYMTIPGNHEQAYNFSNYRRRFTMPGGDGEGQFYSFNVGYAHIIGFSSEFY-YFTGYGFKQIENQYNWLKNDLKEANKPENRAVRPWIIAMGHRPMYCSNSDDGEHCLNPINAIRIGMPITVKRYGSMFVFGLEKLFYEYGVDLIFGAHEHSYERMWPVYNSKVCNGTN-QPYTNPPAPVHIVTGSAGNQEGEDPFYPNKPDWTAFHSSDYGYTRMNIFNSTHMHLEQVSDD 1298
            F+   +   PEQ+H++      + +VTW + +   +S+V YG        H   G    F++ G++ R +++HRV L +L P+  Y Y  GS  GWSE+  FT       +  R+ + GD+GN N +SL+ +Q+ET+ G YD++LH+GDFAY++   N + GD+FM+QIQ +AA +PYMT PGNHE A+NFS YR RF+MP GD EG +YS+NVG AHII FS+E Y Y+  YG   +  QY WL+ DL+EAN+PENRA RPWII MGHRPMYCSN DD + C +  + +R+G   T          GLE+LFY+YGVDL   AHEH+YER+WPVY+ KV NG++ +PY NP APVHI+TGSAG +E  D F P   DW+AF S+DYGYTR+ + N+TH++LEQVSDD
Sbjct:   22 FADVPIGTHPEQVHISYPGVQNSMLVTWSSAN-KTDSVVEYGLWGGKLFSHSATGNSSIFINEGAEYRVMYIHRVLLTDLRPAASYVYHCGSGAGWSELFFFTALNESVFFSPRFALFGDLGNENPQSLSRLQKETQIGTYDVILHIGDFAYDLYEDNGRIGDEFMKQIQSIAAYVPYMTCPGNHEWAFNFSQYRARFSMP-GDTEGLWYSWNVGPAHIISFSTEVYFYYLEYGLDLLFRQYEWLRADLQEANRPENRAERPWIITMGHRPMYCSNDDDDD-CTHFQSYVRLGRNDTKPP-----APGLEELFYQYGVDLELWAHEHTYERLWPVYDYKVFNGSSEEPYVNPKAPVHIITGSAGCREKHDGFIPKPRDWSAFRSTDYGYTRLQLINNTHLYLEQVSDD 421          
BLAST of Purple acid phosphatase vs. Ensembl Xenopus
Match: abca2 (ATP binding cassette subfamily A member 2 [Source:Xenbase;Acc:XB-GENE-969968])

HSP 1 Score: 444.891 bits (1143), Expect = 2.629e-153
Identity = 225/415 (54.22%), Postives = 285/415 (68.67%), Query Frame = 3
Query:  111 QPEQIHLAIGNDTTTFVVTWVTLSWVNESMVIYG--PNDAL-DHKQNGTVDKFVDGGSQKRNIFMHRVTLKNLLPSTKYNYLVGSRFGWSEIHSFTTFPLGSNWPTRYVVIGDMGNLNARSLAAIQRETERGLYDMVLHVGDFAYNMDSYNAQTGDQFMRQIQPVAAQIPYMTIPGNHEQAYNFSNYRRRFTMPGGDGEGQFYSFNVGYAHIIGFSSEFYYFTGYGFKQIENQYNWLKNDLKEANKPENRAVRPWIIAMGHRPMYCSNSDDGEHCLNPINAIRIGMPITVKRYGSMFVFGLEKLFYEYGVDLIFGAHEHSYERMWPVYNSKVCNGTNQ-PYTNPPAPVHIVTGSAGNQEGEDPFYPNKPDWTAFHSSDYGYTRMNIFNSTHMHLEQVSDDLNGKVIDEILYIRNQ 1343
            QPEQ+HL+   D  +  VTW T +    S+V Y   P   L +    G   +FVDGG  KR +F+HRVTLKNL P+ +Y Y  GS FGWS   SF     GS+W  R  V GDMGN NA+SL  +Q+ET+  +YD++LHVGDFAY++D  NAQ GD+FMRQ++ VAA +PYMT PGNHE+AYNFSNYR RF+MP G  EG +YS+N+G AHII  S+E Y+F  YG + +  QY WL+ DL+EANKP NR  RPWII MGHRPMYCSN D  + CL     +R G+      +G    +GLE LFY+YGVDL   AHEHSYER+WPVYN  V  G+ + PYTNP APVHI+TGSAG  E  DPF+P   +W+A    DYGYTR++I N TH+HL+QVSDD NG+++D+   I+++
Sbjct:   26 QPEQVHLSYTGDPLSMTVTWTTFA-PTPSVVKYSTVPGPLLFNISAYGNATQFVDGGFMKRKMFIHRVTLKNLTPTQRYVYHCGSDFGWSPQFSFRAMQTGSSWGPRLAVFGDMGNENAQSLPRLQKETQMDMYDVILHVGDFAYDLDKDNAQIGDKFMRQVESVAAYLPYMTCPGNHEEAYNFSNYRNRFSMP-GTTEGLWYSWNLGPAHIISLSTEVYFFINYGKELLAEQYRWLQKDLEEANKPSNRLERPWIITMGHRPMYCSNFDKDD-CLQHDTVVRTGI------FGGQ--YGLEDLFYKYGVDLEIWAHEHSYERLWPVYNYTVYKGSPESPYTNPLAPVHIITGSAGCNERLDPFFPLHREWSALRIEDYGYTRIHIANKTHIHLQQVSDDQNGEIVDDFWLIKDK 429          
BLAST of Purple acid phosphatase vs. Ensembl Mouse
Match: Acp7 (acid phosphatase 7, tartrate resistant [Source:MGI Symbol;Acc:MGI:2142121])

HSP 1 Score: 427.943 bits (1099), Expect = 1.105e-146
Identity = 221/439 (50.34%), Postives = 290/439 (66.06%), Query Frame = 3
Query:   57 FVIVLEFYIYFSSGQLYNQ--PEQIHLAIGNDTTTFVVTWVTLSWVNESMVIYGP--NDALDHKQNGTVDKFVDGGSQKRNIFMHRVTLKNLLPSTKYNYLVGSRFGWSEIHSFTTFPLGSNWPTRYVVIGDMGNLNARSLAAIQRETERGLYDMVLHVGDFAYNMDSYNAQTGDQFMRQIQPVAAQIPYMTIPGNHEQAYNFSNYRRRFTMPGGDGEGQFYSFNVGYAHIIGFSSEFYYFTGYGFKQIENQYNWLKNDLKEANKPENRAVRPWIIAMGHRPMYCSNSDDGEHCLNPINAIRIGMPITVKRYGSMFVFGLEKLFYEYGVDLIFGAHEHSYERMWPVYNSKVCNGT-NQPYTNPPAPVHIVTGSAGNQEGEDPFYPNKPDWTAFHSSDYGYTRMNIFNSTHMHLEQVSDDLNGKVIDEILYIRNQHGQVF 1358
            F ++L F       Q Y    PEQIHL+   +  T  VTW T +    S V +G   +  L  + +GT   FVDGG  +R +++HRVTL+ L P  +Y Y  GS  GWS    FT    G +W  R  V GDMG  N ++L  ++R+T++G++D VLHVGDFAYNMD  NA+ GD+FMR I+PVAA +PYMT PGNHEQ YNFSNY+ RF+MP GD EG +YS+++G AHII FS+E Y+F  YG   IE Q+ WL+NDL++ANK  NR  RPWII MGHRPMYCSN+D  + C    + +R G+      +G +  FGLE LF++YGVDL F AHEHSYER+WP+YN +V NG+   PYTNP  PVHI+TGSAG +E   PF      W+A    +YGYTRM+I N THMH++QVSDD +GK++D++  +R   G++ 
Sbjct:   11 FCMLLPFSPGVQGAQEYPHVTPEQIHLSYLGEPGTMTVTWTTWA-PARSEVQFGSQLSGPLPFRAHGTARAFVDGGVLRRKLYIHRVTLRKLQPGAQYVYRCGSSQGWSRRFRFTALKNGVHWSPRLAVFGDMGADNPKALPRLRRDTQQGMFDAVLHVGDFAYNMDQDNARVGDRFMRLIEPVAASLPYMTCPGNHEQRYNFSNYKARFSMP-GDNEGLWYSWDLGPAHIISFSTEVYFFLHYGRHLIEKQFRWLENDLQKANK--NRVARPWIITMGHRPMYCSNADLDD-CTRHESRVRKGL------HGKL--FGLEDLFHKYGVDLEFWAHEHSYERLWPIYNYQVFNGSLESPYTNPRGPVHIITGSAGCEELLTPFVRKPRPWSAVRVKEYGYTRMHILNGTHMHIQQVSDDQDGKIVDDVWVVRPLLGRMM 436          
BLAST of Purple acid phosphatase vs. Ensembl Mouse
Match: Acp7 (acid phosphatase 7, tartrate resistant [Source:MGI Symbol;Acc:MGI:2142121])

HSP 1 Score: 429.098 bits (1102), Expect = 2.851e-146
Identity = 221/439 (50.34%), Postives = 290/439 (66.06%), Query Frame = 3
Query:   57 FVIVLEFYIYFSSGQLYNQ--PEQIHLAIGNDTTTFVVTWVTLSWVNESMVIYGP--NDALDHKQNGTVDKFVDGGSQKRNIFMHRVTLKNLLPSTKYNYLVGSRFGWSEIHSFTTFPLGSNWPTRYVVIGDMGNLNARSLAAIQRETERGLYDMVLHVGDFAYNMDSYNAQTGDQFMRQIQPVAAQIPYMTIPGNHEQAYNFSNYRRRFTMPGGDGEGQFYSFNVGYAHIIGFSSEFYYFTGYGFKQIENQYNWLKNDLKEANKPENRAVRPWIIAMGHRPMYCSNSDDGEHCLNPINAIRIGMPITVKRYGSMFVFGLEKLFYEYGVDLIFGAHEHSYERMWPVYNSKVCNGT-NQPYTNPPAPVHIVTGSAGNQEGEDPFYPNKPDWTAFHSSDYGYTRMNIFNSTHMHLEQVSDDLNGKVIDEILYIRNQHGQVF 1358
            F ++L F       Q Y    PEQIHL+   +  T  VTW T +    S V +G   +  L  + +GT   FVDGG  +R +++HRVTL+ L P  +Y Y  GS  GWS    FT    G +W  R  V GDMG  N ++L  ++R+T++G++D VLHVGDFAYNMD  NA+ GD+FMR I+PVAA +PYMT PGNHEQ YNFSNY+ RF+MP GD EG +YS+++G AHII FS+E Y+F  YG   IE Q+ WL+NDL++ANK  NR  RPWII MGHRPMYCSN+D  + C    + +R G+      +G +  FGLE LF++YGVDL F AHEHSYER+WP+YN +V NG+   PYTNP  PVHI+TGSAG +E   PF      W+A    +YGYTRM+I N THMH++QVSDD +GK++D++  +R   G++ 
Sbjct:   69 FCMLLPFSPGVQGAQEYPHVTPEQIHLSYLGEPGTMTVTWTTWA-PARSEVQFGSQLSGPLPFRAHGTARAFVDGGVLRRKLYIHRVTLRKLQPGAQYVYRCGSSQGWSRRFRFTALKNGVHWSPRLAVFGDMGADNPKALPRLRRDTQQGMFDAVLHVGDFAYNMDQDNARVGDRFMRLIEPVAASLPYMTCPGNHEQRYNFSNYKARFSMP-GDNEGLWYSWDLGPAHIISFSTEVYFFLHYGRHLIEKQFRWLENDLQKANK--NRVARPWIITMGHRPMYCSNADLDD-CTRHESRVRKGL------HGKL--FGLEDLFHKYGVDLEFWAHEHSYERLWPIYNYQVFNGSLESPYTNPRGPVHIITGSAGCEELLTPFVRKPRPWSAVRVKEYGYTRMHILNGTHMHIQQVSDDQDGKIVDDVWVVRPLLGRMM 494          
BLAST of Purple acid phosphatase vs. Ensembl Mouse
Match: Acp7 (acid phosphatase 7, tartrate resistant [Source:MGI Symbol;Acc:MGI:2142121])

HSP 1 Score: 81.6481 bits (200), Expect = 5.143e-18
Identity = 49/131 (37.40%), Postives = 65/131 (49.62%), Query Frame = 3
Query:   57 FVIVLEFYIYFSSGQLYNQ--PEQIHLAIGNDTTTFVVTWVTLSWVNESMVIYGP--NDALDHKQNGTVDKFVDGGSQKRNIFMHRVTLKNLLPSTKYNYLVGSRFGWSEIHSFTTFPLGSNWPTRYVVIG 437
            F ++L F       Q Y    PEQIHL+   +  T  VTW T +    S V +G   +  L  + +GT   FVDGG  +R +++HRVTL+ L P  +Y Y  GS  GWS    FT    G +W  R  V G
Sbjct:   11 FCMLLPFSPGVQGAQEYPHVTPEQIHLSYLGEPGTMTVTWTTWA-PARSEVQFGSQLSGPLPFRAHGTARAFVDGGVLRRKLYIHRVTLRKLQPGAQYVYRCGSSQGWSRRFRFTALKNGVHWSPRLAVFG 140          
BLAST of Purple acid phosphatase vs. UniProt/SwissProt
Match: sp|Q8BX37|ACP7_MOUSE (Acid phosphatase type 7 OS=Mus musculus OX=10090 GN=Acp7 PE=2 SV=2)

HSP 1 Score: 427.943 bits (1099), Expect = 7.729e-146
Identity = 221/439 (50.34%), Postives = 290/439 (66.06%), Query Frame = 3
Query:   57 FVIVLEFYIYFSSGQLYNQ--PEQIHLAIGNDTTTFVVTWVTLSWVNESMVIYGP--NDALDHKQNGTVDKFVDGGSQKRNIFMHRVTLKNLLPSTKYNYLVGSRFGWSEIHSFTTFPLGSNWPTRYVVIGDMGNLNARSLAAIQRETERGLYDMVLHVGDFAYNMDSYNAQTGDQFMRQIQPVAAQIPYMTIPGNHEQAYNFSNYRRRFTMPGGDGEGQFYSFNVGYAHIIGFSSEFYYFTGYGFKQIENQYNWLKNDLKEANKPENRAVRPWIIAMGHRPMYCSNSDDGEHCLNPINAIRIGMPITVKRYGSMFVFGLEKLFYEYGVDLIFGAHEHSYERMWPVYNSKVCNGT-NQPYTNPPAPVHIVTGSAGNQEGEDPFYPNKPDWTAFHSSDYGYTRMNIFNSTHMHLEQVSDDLNGKVIDEILYIRNQHGQVF 1358
            F ++L F       Q Y    PEQIHL+   +  T  VTW T +    S V +G   +  L  + +GT   FVDGG  +R +++HRVTL+ L P  +Y Y  GS  GWS    FT    G +W  R  V GDMG  N ++L  ++R+T++G++D VLHVGDFAYNMD  NA+ GD+FMR I+PVAA +PYMT PGNHEQ YNFSNY+ RF+MP GD EG +YS+++G AHII FS+E Y+F  YG   IE Q+ WL+NDL++ANK  NR  RPWII MGHRPMYCSN+D  + C    + +R G+      +G +  FGLE LF++YGVDL F AHEHSYER+WP+YN +V NG+   PYTNP  PVHI+TGSAG +E   PF      W+A    +YGYTRM+I N THMH++QVSDD +GK++D++  +R   G++ 
Sbjct:   11 FCMLLPFSPGVQGAQEYPHVTPEQIHLSYLGEPGTMTVTWTTWA-PARSEVQFGSQLSGPLPFRAHGTARAFVDGGVLRRKLYIHRVTLRKLQPGAQYVYRCGSSQGWSRRFRFTALKNGVHWSPRLAVFGDMGADNPKALPRLRRDTQQGMFDAVLHVGDFAYNMDQDNARVGDRFMRLIEPVAASLPYMTCPGNHEQRYNFSNYKARFSMP-GDNEGLWYSWDLGPAHIISFSTEVYFFLHYGRHLIEKQFRWLENDLQKANK--NRVARPWIITMGHRPMYCSNADLDD-CTRHESRVRKGL------HGKL--FGLEDLFHKYGVDLEFWAHEHSYERLWPIYNYQVFNGSLESPYTNPRGPVHIITGSAGCEELLTPFVRKPRPWSAVRVKEYGYTRMHILNGTHMHIQQVSDDQDGKIVDDVWVVRPLLGRMM 436          
BLAST of Purple acid phosphatase vs. UniProt/SwissProt
Match: sp|A5D6U8|ACP7_DANRE (Acid phosphatase type 7 OS=Danio rerio OX=7955 GN=acp7 PE=2 SV=1)

HSP 1 Score: 416.001 bits (1068), Expect = 5.147e-141
Identity = 210/425 (49.41%), Postives = 287/425 (67.53%), Query Frame = 3
Query:   87 FSSGQLYNQPEQIHLAIGNDTTTFVVTWVTLSWVNESMVIYG--PNDALDHKQNGTVDKFVDGGSQKRNIFMHRVTLKNLLPSTKYNYLVGSRFGWSEIHSFTTFPLGSNWPTRYVVIGDMGNLNARSLAAIQRETERGLYDMVLHVGDFAYNMDSYNAQTGDQFMRQIQPVAAQIPYMTIPGNHEQAYNFSNYRRRFTMPGGDGEGQFYSFNVGYAHIIGFSSEFY-YFTGYGFKQIENQYNWLKNDLKEANKPENRAVRPWIIAMGHRPMYCSNSDDGEHCLNPINAIRIGMPITVKRYGSMFVFGLEKLFYEYGVDLIFGAHEHSYERMWPVYNSKVCNGTN-QPYTNPPAPVHIVTGSAGNQEGEDPFYPNKPDWTAFHSSDYGYTRMNIFNSTHMHLEQVSDDLNGKVIDEILYIRNQHG 1349
            F+   +  QPEQ+H++      + +VTW + +   +S+V YG        H   G    F++ G++ R +++HRV L +L P+  Y Y  GS  GWSE+  FT       +   + + GD+GN N +SL+ +Q+ET+ G YD++LH+GDFAY++   N + GD+FM+QIQ +AA +PYMT PGNHE A+NFS YR RF+MP GD EG +YS+NVG AHII FS+E Y Y+  YG   +  QY WL+ DL+EAN+PENRA RPWII MGHRPMYCSN DD + C +  + +R+G   T          GLE+LFY+YGVDL   AHEH+YER+WPVY+ KV NG++ +PY NP APVHI+TGSAG +E  D F P   DW+AF S+DYGYTR+ + N+TH++LEQVSDD  GKVID++  ++ +HG
Sbjct:   22 FADVPIGTQPEQVHISYPGVQNSMLVTWSSAN-KTDSVVEYGLWGGKLFSHSATGNSSIFINEGAEYRVMYIHRVLLTDLRPAASYVYHCGSGAGWSELFFFTALNESVFFSPGFALFGDLGNENPQSLSRLQKETQIGTYDVILHIGDFAYDLYEDNGRIGDEFMKQIQSIAAYVPYMTCPGNHEWAFNFSQYRARFSMP-GDTEGLWYSWNVGPAHIISFSTEVYFYYLEYGLDLLFRQYEWLRADLQEANRPENRAERPWIITMGHRPMYCSNDDDDD-CTHFQSYVRLGRNDTKPP-----APGLEELFYQYGVDLELWAHEHTYERLWPVYDYKVFNGSSEEPYVNPKAPVHIITGSAGCREKHDGFIPKPRDWSAFRSTDYGYTRLQLINNTHLYLEQVSDDQYGKVIDQMTLVKEKHG 438          
BLAST of Purple acid phosphatase vs. UniProt/SwissProt
Match: sp|Q6ZNF0|ACP7_HUMAN (Acid phosphatase type 7 OS=Homo sapiens OX=9606 GN=ACP7 PE=2 SV=2)

HSP 1 Score: 405.986 bits (1042), Expect = 3.886e-137
Identity = 208/436 (47.71%), Postives = 287/436 (65.83%), Query Frame = 3
Query:   54 IFVIVLEFYIYFSSGQLYNQPEQIHLAIGNDTTTFVVTWVTLSWVNESMVIYG--PNDALDHKQNGTVDKFVDGGSQKRNIFMHRVTLKNLLPSTKYNYLVGSRFGWSEIHSFTTFPLGSNWPTRYVVIGDMGNLNARSLAAIQRETERGLYDMVLHVGDFAYNMDSYNAQTGDQFMRQIQPVAAQIPYMTIPGNHEQAYNFSNYRRRFTMPGGDGEGQFYSFNVGYAHIIGFSSEFYYFTGYGFKQIENQYNWLKNDLKEANKPENRAVRPWIIAMGHRPMYCSNSDDGEHCLNPINAIRIGMPITVKRYGSMFVFGLEKLFYEYGVDLIFGAHEHSYERMWPVYNSKVCNGTNQ-PYTNPPAPVHIVTGSAGNQEGEDPFYPNKPDWTAFHSSDYGYTRMNIFNSTHMHLEQVSDDLNGKVIDEILYIRNQHGQ 1352
              +++    +  S G     PEQ+HL+   +  +  VTW T      S V +G  P+  L  +  GT   FVDGG  +R +++HRVTL+ LLP  +Y Y  GS  GWS    F     G++W  R  V GD+G  N +++  ++R+T++G+YD VLHVGDFAYN+D  NA+ GD+FMR I+PVAA +PYMT PGNHE+ YNFSNY+ RF+MP GD EG +YS+++G AHII FS+E Y+F  YG   ++ Q+ WL++DL++ANK  NRA RPWII MGHRPMYCSN+D  + C    + +R G+           ++GLE LFY+YGVDL   AHEHSYER+WP+YN +V NG+ + PYTNP  PVHI+TGSAG +E   PF      W+A    +YGYTR++I N TH+H++QVSDD +GK++D++  +R   G+
Sbjct:   12 CLLLLFSLGVQGSLGAPSAAPEQVHLSYPGEPGSMTVTWTTWV-PTRSEVQFGLQPSGPLPLRAQGTFVPFVDGGILRRKLYIHRVTLRKLLPGVQYVYRCGSAQGWSRRFRFRALKNGAHWSPRLAVFGDLGADNPKAVPRLRRDTQQGMYDAVLHVGDFAYNLDQDNARVGDRFMRLIEPVAASLPYMTCPGNHEERYNFSNYKARFSMP-GDNEGLWYSWDLGPAHIISFSTEVYFFLHYGRHLVQRQFRWLESDLQKANK--NRAARPWIITMGHRPMYCSNADLDD-CTRHESKVRKGL--------QGKLYGLEDLFYKYGVDLQLWAHEHSYERLWPIYNYQVFNGSREMPYTNPRGPVHIITGSAGCEERLTPFAVFPRPWSAVRVKEYGYTRLHILNGTHIHIQQVSDDQDGKIVDDVWVVRPLFGR 434          
BLAST of Purple acid phosphatase vs. UniProt/SwissProt
Match: sp|Q9C510|PPA6_ARATH (Purple acid phosphatase 6 OS=Arabidopsis thaliana OX=3702 GN=PAP6 PE=2 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 3.413e-34
Identity = 134/453 (29.58%), Postives = 202/453 (44.59%), Query Frame = 3
Query:   87 FSSGQLYNQPEQIHLAIGN-DTTTFVVTWVT-LSWVNESMVIY---------GPNDALDHKQNGTVDKFVDGGSQKRNIFMHRVTLKNLLPSTKYNYLVGSRFGWSEIHSFTTFP-LGSNWPTRYVVIGDMGNLNARSLAAIQRETERGLYDMVLHVGDFAYNMD--SYNAQTGDQFMRQIQPVAAQIPYMTIPGNHE--------QAYNFSNYRRRFTMPGGDGEGQ-----FYSFNVGYAHIIGFSSEFYYFTGYGFKQIENQYNWLKNDLKEANKPENRAVRPWIIAMGHRPMYCSNS---DDGEHCLNPINAIRIGMPITVKRYGSMFVFGLEKLFYEYGVDLIFGAHEHSYERMWPVYNSK--VCNGTNQPYTNPPAPVHIVTGSAGNQEG-EDPFYPNKPDWTAFHSSDYGYTRMNIFNSTHMHLEQVSDDLNGKVIDEILYIRNQH 1346
            F S   YN PEQ+HL  G+ D    +V+WVT L+    ++V Y          P     H    +  +F D  S     F+H  T+K L   TKY Y VG+     +  SFTT P +G + P  + +IGD+G   A S   +           VL  GD +Y  D  +++ +  D + R ++P AA  P++   GNHE        + + F  Y  R+  P      Q     +YS     AHII  SS    ++ YG  +   QY WL+ +LK  N+ E     PW+I + H P Y SN+    +GE       ++R+           MF    E       VDL+   H H+YER   + N K  + NG + P  +P AP++I  G  GN EG  + F   +P ++A+  + +G+  + I N TH       +  N  V  + + + N+H
Sbjct:   41 FPSPGGYNTPEQVHLTQGDHDGRGMIVSWVTPLNLAGSNVVTYWIATNGSDVKPAKKRAHASTKSY-RFYDYSSG----FLHHATIKGLEYDTKYIYEVGTDKSVRQF-SFTTPPKIGPDVPYTFGIIGDLGQTYA-SNETLYHYMSNPKGQAVLFAGDLSYADDHPNHDQRKWDTWGRFMEPCAAYQPFIFAAGNHEIDFVPNIGEPHAFKPYTHRY--PNAYKASQSTSPLWYSVRRASAHIIVLSS----YSAYG--KYTPQYIWLEQELKNVNREET----PWLIVIVHSPWYNSNNYHYMEGE-------SMRV-----------MF----ESWLVNSKVDLVLSGHVHAYERSERISNIKYNITNGLSSPVKDPNAPIYITIGDGGNIEGIANSFVDPQPSYSAYREASFGHAVLEIMNRTHAQYTWHRNQDNEPVAADSIMLHNRH 452          
BLAST of Purple acid phosphatase vs. UniProt/SwissProt
Match: sp|Q93WP4|PEPP_ALLCE (Phosphoenolpyruvate phosphatase OS=Allium cepa OX=4679 GN=ACPEPP PE=1 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 3.347e-33
Identity = 122/439 (27.79%), Postives = 192/439 (43.74%), Query Frame = 3
Query:  114 PEQIHLAIGN-DTTTFVVTWVTLSWVNESMVIYGPN-DALDHKQNGTVDKFVDGGSQKRNIFMHRVTLKNLLPSTKYNYLVG----SRFGW----SEIHSFTTFPLGSNWPTRYVVIGDMGNLNARSLAAIQRETERGLYDMVLHVGDFAYNMDSYNAQTG---DQFMRQIQPVAAQIPYMTIPGNHE--------QAYNFSNYRRRFTMP---GGDGEGQFYSFNVGYAHIIGFSSEFYYFTGYGFKQIENQYNWLKNDLKEANKPENRAVRPWIIAMGHRPMYCSNSDDGEHCLNPINAIRIGMPITVKRYGSMFVFGLEKLFYEYGVDLIFGAHEHSYERMWPVYNS--KVCNGTNQPYTNPPAPVHIVTGSAGNQEG-EDPFYPNKPDWTAFHSSDYGYTRMNIFNSTHMHLE-QVSDDLNGKVIDEILYIRNQH 1346
            P+Q+H+  G+ D    +V+WVT     +S V+YG + ++ DH   G             + ++H   L  L   TKY Y +G    +R  W     +IH   ++  G        +IGD+G     SL+ ++    +     VL VGD +Y  D Y+   G   D + R ++   A  P++   GNHE        + + F  Y  R+  P          +YS     AHII  SS         F +   Q+ WL  +L   ++ +     PW+I + H P+Y SN     H +                 G       E  F +Y VDL+F  H H+YER + + N    + +G   P  +  APV+I  G  GNQEG  + F  ++PD++AF  S YG++ + + N TH   +   +DD     +D I++ RNQ+
Sbjct:   60 PQQVHITQGDYDGKAVIVSWVTFIDPGKSEVVYGTSPNSYDHSAQGKTTN--YTYYDYTSGYIHHCLLDKLEYDTKYYYKIGKGDAAREFWFHTPPQIHPDASYTFG--------IIGDLGQ-TYNSLSTLEHYM-KSKGQTVLFVGDLSY-ADRYSCNNGTRWDSWGRFVERSVAYQPWIWTVGNHEIEYRPDLGEVFPFRAYLNRYPTPHLASASSSPLWYSIRRASAHIIVLSSY------SPFVKYTPQWLWLSEELTRVDREKT----PWLIVLMHAPLYNSNE---AHYME----------------GESMRVAFESWFVQYKVDLVFAGHVHAYERSYRISNIVYNITSGNRYPIPDKSAPVYITVGDGGNQEGLAERFSESQPDYSAFRESSYGHSTLELRNRTHAFYQWNRNDDGKHIPVDRIIF-RNQY 455          
BLAST of Purple acid phosphatase vs. TrEMBL
Match: A0A1I8GHM8 (Purple acid phosphatase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013810g3 PE=3 SV=1)

HSP 1 Score: 553.132 bits (1424), Expect = 0.000e+0
Identity = 263/437 (60.18%), Postives = 320/437 (73.23%), Query Frame = 3
Query:   81 IYFSSGQLYNQPEQIHLAIGNDTTTFVVTWVTLSWVNESMVIYGPNDALDHKQNGTVDKFVDGGSQKRNIFMHRVTLKNLLPSTKYNYLVGSRFGWSEIHSFTTFPLGSNWPTRYVVIGDMGNLNARSLAAIQRETERGLYDMVLHVGDFAYNMDSYNAQTGDQFMRQIQPVAAQIPYMTIPGNHEQAYNFSNYRRRFTMPGGDGEGQFYSFNVGYAHIIGFSSEFYYFTGYGFKQIENQYNWLKNDLKEANKPENRAVRPWIIAMGHRPMYCSNSDDGEHCLNPINAIRIGMPITVKR----YGSMFVFGLEKLFYEYGVDLIFGAHEHSYERMWPVYNSKVCNGT---NQPYTNPPAPVHIVTGSAGNQEGEDPFYPNKPDWTAFHSSDYGYTRMNIFNSTHMHLEQVSDDLNGKVIDEILYIRNQHG-QVFNCL 1367
            I  +SGQL  QPEQ+HL++ ND T  VVTWVT S  N + V YG N   D   +G  +KFVDGGS KR I++HR  +  L P  +Y Y VGS  GWS++  FT    GS+WP R+ V GDMGN N +S+  +Q+E + G +DMVLHVGDFAYNMD+ NA  GD+FMRQ++P+AA +PYMT PGNHE AYNFSNYRRRF+MPGGDGEG F+SF+ G  H+I FSSEFYY+  YG+KQ   Q+ WL+ DL+ AN  +NRA RPWIIAM HRPMYCSNSDD +HC N  N IR G P+  K+    +GS ++ G+E+LFY YGVDLIFGAHEHSYERMWPVYN KVCN T   + PY NPPAPVH++TGSAG  EGEDPF P    W+AF S DYGYTRM + N+TH+ LEQVS D  G+VID I+Y+RN+HG   FNC+
Sbjct:   18 ISLTSGQLSPQPEQVHLSVTNDPTQMVVTWVTQSPTNGTSVDYGTN-RFDRSASGIQEKFVDGGSAKRVIYIHRAVMSGLRPGQRYVYRVGSELGWSDVFLFTATKSGSDWPARFAVYGDMGNTNGKSIPFLQKEAQSGDFDMVLHVGDFAYNMDTNNALVGDEFMRQVEPIAAYVPYMTCPGNHESAYNFSNYRRRFSMPGGDGEGSFFSFDYGPVHVISFSSEFYYYLDYGWKQAVYQFQWLEEDLQRAN--QNRANRPWIIAMAHRPMYCSNSDDPQHCTNADNLIRTGFPVGSKQRSRIFGSDYILGVEQLFYRYGVDLIFGAHEHSYERMWPVYNQKVCNSTTSSDNPYDNPPAPVHVITGSAGCVEGEDPFIPAGLPWSAFRSDDYGYTRMTVANATHLMLEQVSVDKGGQVIDSIVYVRNKHGSSAFNCV 451          
BLAST of Purple acid phosphatase vs. TrEMBL
Match: A0A1I8GHZ9 (Purple acid phosphatase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013810g1 PE=3 SV=1)

HSP 1 Score: 553.132 bits (1424), Expect = 0.000e+0
Identity = 262/437 (59.95%), Postives = 320/437 (73.23%), Query Frame = 3
Query:   81 IYFSSGQLYNQPEQIHLAIGNDTTTFVVTWVTLSWVNESMVIYGPNDALDHKQNGTVDKFVDGGSQKRNIFMHRVTLKNLLPSTKYNYLVGSRFGWSEIHSFTTFPLGSNWPTRYVVIGDMGNLNARSLAAIQRETERGLYDMVLHVGDFAYNMDSYNAQTGDQFMRQIQPVAAQIPYMTIPGNHEQAYNFSNYRRRFTMPGGDGEGQFYSFNVGYAHIIGFSSEFYYFTGYGFKQIENQYNWLKNDLKEANKPENRAVRPWIIAMGHRPMYCSNSDDGEHCLNPINAIRIGMPITVKR----YGSMFVFGLEKLFYEYGVDLIFGAHEHSYERMWPVYNSKVCNGT---NQPYTNPPAPVHIVTGSAGNQEGEDPFYPNKPDWTAFHSSDYGYTRMNIFNSTHMHLEQVSDDLNGKVIDEILYIRNQHG-QVFNCL 1367
            I  ++GQL  QPEQ+HL++ ND T  VVTWVT S  N + V YG N   D   +G  +KFVDGGS KR I++HR  +  L P  +Y Y VGS  GWS++  FT    GS+WP R+ V GDMGN N +S+  +Q+E + G +DMVLHVGDFAYNMD+ NA  GD+FMRQ++P+AA +PYMT PGNHE AYNFSNYRRRF+MPGGDGEG F+SF+ G  H+I FSSEFYY+  YG+KQ   Q+ WL+ DL+ AN  +NRA RPWIIAM HRPMYCSNSDD +HC N  N IR G P+  K+    +GS ++ G+E+LFY YGVDLIFGAHEHSYERMWPVYN KVCN T   + PY NPPAPVH++TGSAG  EGEDPF P    W+AF S DYGYTRM + N+TH+ LEQVS D  G+VID I+Y+RN+HG   FNC+
Sbjct:   18 ISLTTGQLSPQPEQVHLSVTNDPTQMVVTWVTQSPTNSTSVDYGTN-RFDRSASGVQEKFVDGGSAKRVIYIHRAVMSGLRPGQRYVYRVGSELGWSDVFLFTATKSGSDWPARFAVYGDMGNTNGKSIPFLQKEAQSGDFDMVLHVGDFAYNMDTNNALVGDEFMRQVEPIAAYVPYMTCPGNHESAYNFSNYRRRFSMPGGDGEGSFFSFDYGPVHVISFSSEFYYYLDYGWKQAVYQFQWLEEDLQRAN--QNRANRPWIIAMAHRPMYCSNSDDPQHCTNADNLIRTGFPVGSKQRSRIFGSDYILGVEQLFYRYGVDLIFGAHEHSYERMWPVYNQKVCNSTTSSDNPYDNPPAPVHVITGSAGCVEGEDPFIPAGLPWSAFRSDDYGYTRMTVANATHLMLEQVSVDKGGQVIDSIVYVRNKHGSSAFNCV 451          
BLAST of Purple acid phosphatase vs. TrEMBL
Match: A0A1S3IPU2 (Purple acid phosphatase OS=Lingula unguis OX=7574 GN=LOC106166278 PE=3 SV=1)

HSP 1 Score: 522.702 bits (1345), Expect = 1.514e-180
Identity = 259/441 (58.73%), Postives = 315/441 (71.43%), Query Frame = 3
Query:   48 LCIFVIVLEFYIYFSSGQLYNQPEQIHLAIGNDTTTFVVTWVTLSWVNESMVIYGPNDALDHKQNGTVDKFVDGGSQKRNIFMHRVTLKNLLPSTKYNYLVGSRFGWSEIHSFTTFPLGSNWPTRYVVIGDMGNLNARSLAAIQRETERGLYDMVLHVGDFAYNMDSYNAQTGDQFMRQIQPVAAQIPYMTIPGNHEQAYNFSNYRRRFTMPGGDGEGQFYSFNVGYAHIIGFSSEFYYFTGYGFKQIENQYNWLKNDLKEANKPENRAVRPWIIAMGHRPMYCSNSDDGEHCLNPINAIRIGMPITVKRYGSMFVFGLEKLFYEYGVDLIFGAHEHSYERMWPVYNSKVCNGTN-QPYTNPPAPVHIVTGSAGNQEGEDPFYPNKPDWTAFHSSDYGYTRMNIFNSTHMHLEQVSDDLNGKVIDEILYIRNQHGQ-VFNC 1364
             C+F +V  FY  FS  Q Y QPEQ+HL+ G      +VTWVT+S  N S+V YG N  LD    GT  KFVD G +KR IF+HRVTL +L+P   Y Y  G +FGWS I++FT     + W  R +V GD GN+N++S+A IQ+ET+RG +D VLHVGD AYN+D+ N + GD FMRQI+ VAA +PYMT PGNHE AYNFS+Y+ RF MPG + +  +YSFN+G AHII FS+E+YY   YG+ QI  QY WL+ DL+EANKPENRA RPWII  GHRPMYCSN+DD   C N  N +R+G+P        +  F LE LFY+YGVDL F  HEHSYERMWPVYN KVCNG+N +PY NPPAPVH+VTGSAG  EGEDPF  N   W+AF S DYGYTRMNI NSTH++LEQVSDD +G VID++L I+ +HG   FNC
Sbjct:    8 CCLFCLV--FYPVFS--QYYGQPEQVHLSYGVTPQQMIVTWVTMSESNSSIVEYGQN-GLDQVAYGTETKFVDSGEEKRVIFIHRVTLNDLIPEKMYKYHCGGKFGWSGIYTFTAMKDSTEWSPRLLVYGDFGNVNSQSMARIQQETQRGHFDAVLHVGDIAYNLDTSNGRIGDAFMRQIETVAAYVPYMTCPGNHEAAYNFSHYKYRFNMPGDEQKNMYYSFNMGPAHIISFSTEYYYEVSYGWSQIFTQYFWLEKDLQEANKPENRAKRPWIIVFGHRPMYCSNADDPTMCSNIDNYVRVGIP-------HVHAFSLEDLFYKYGVDLHFYGHEHSYERMWPVYNRKVCNGSNDEPYHNPPAPVHVVTGSAGCDEGEDPFISNGLPWSAFRSDDYGYTRMNIINSTHLYLEQVSDDKDGAVIDKMLLIKEKHGMGTFNC 436          
BLAST of Purple acid phosphatase vs. TrEMBL
Match: A0A504Y7X0 (Purple acid phosphatase OS=Fasciola gigantica OX=46835 GN=FGIG_09745 PE=3 SV=1)

HSP 1 Score: 495.352 bits (1274), Expect = 3.333e-169
Identity = 239/422 (56.64%), Postives = 301/422 (71.33%), Query Frame = 3
Query:  114 PEQIHLAIGNDTTTFVVTWVTLSWVNESMVIYGPNDALDHKQNGTVDKFVDGGSQKRNIFMHRVTLKNLLPSTKYNYLVGSRFGWSEIHSFTTFPLGSNWPTRYVVIGDMGNLNARSLAAIQRET-ERGLYDMVLHVGDFAYNMDSYNAQTGDQFMRQIQPVAAQIPYMTIPGNHEQAYNFSNYRRRFTMPGGDGEGQFYSFNVGYAHIIGFSSEFYYFTGYGFKQIENQYNWLKNDLKEANKPENRAVRPWIIAMGHRPMYCSNSDDGEHCLNPINAIRIGMPITVKRYGSMFVFGLEKLFYEYGVDLIFGAHEHSYERMWPVYNSKVCNGT-NQPYTNPPAPVHIVTGSAGNQEGEDPFYPNKPDWTAFHSSDYGYTRMNIFNSTHMHLEQVSDD--LNGKVIDEILYIRNQHGQ-VFNC 1364
            PEQ+HL+IG DT+T VVTWVT +   ES+V YG  D LD+KQ+G+ + F+DGGS++R+ ++HRV + NL     Y Y+ G    WS    F   P  +NW  R  + GD+G  N RSL  +QRET E   +D + HVGDFAYNMDS NA+ GDQFM QI+ VA+++PYMT  GNHE AYNFSNYR RFTMPGGDG+GQFYSFN+G AHII FS+EFYY+  YG+ Q+ NQ+ WL+ DL+EANKPENR +RPWIIAM HRPMYCSN++D  HC N  N +R G P + +   + ++ GLE LFY  GVD+I  AHEHSYER WPVYN  VCN + +QPY  PPAPVHIVTGSAG+ EG DPF P    W+AF + DYG+TRM+I NS+ + +EQVS D    G  ID    ++N HG+ ++NC
Sbjct:   28 PEQVHLSIGEDTSTIVVTWVTTNATRESIVKYGL-DRLDNKQSGSQEVFIDGGSEQRSFYIHRVRIANLTAGLIYYYVCGCESNWSPTFQFRALPNHANWSPRLAIFGDLGVENGRSLPELQRETIELESFDAIFHVGDFAYNMDSDNARYGDQFMSQIESVASRVPYMTAVGNHELAYNFSNYRARFTMPGGDGQGQFYSFNLGPAHIIAFSTEFYYYLYYGWVQLYNQFEWLRKDLQEANKPENRKIRPWIIAMAHRPMYCSNNNDAMHCCNIDNTVRTGFPFS-RNSSTGYILGLEDLFYNEGVDIIIAAHEHSYERFWPVYNLTVCNASFSQPYVEPPAPVHIVTGSAGSSEGLDPFLPGGHPWSAFRADDYGFTRMHIINSSLITVEQVSVDQGTRGTTIDSFSIVKNLHGRGLYNC 447          
BLAST of Purple acid phosphatase vs. TrEMBL
Match: A0A087U155 (Purple acid phosphatase (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_10061 PE=3 SV=1)

HSP 1 Score: 486.878 bits (1252), Expect = 1.773e-166
Identity = 243/438 (55.48%), Postives = 312/438 (71.23%), Query Frame = 3
Query:   54 IFVIVLEFYIYFSSGQL---YNQPEQIHLAIGNDTTTFVVTWVTLSWVNESMVIYGPNDALDHKQNGTVDKFVDGGSQKRNIFMHRVTLKNLLPSTKYNYLVGSRFGWSEIHSFTTFPLGSNWPTRYVVIGDMGNLNARSLAAIQRETERGLYDMVLHVGDFAYNMDSYNAQTGDQFMRQIQPVAAQIPYMTIPGNHEQAYNFSNYRRRFTMPGGDG--EGQFYSFNVGYAHIIGFSSEFYYFTGYGFKQIENQYNWLKNDLKEANKPENRAVRPWIIAMGHRPMYCSNSDDGEHCLNPINAIRIGMPITVKRYGSMFVFGLEKLFYEYGVDLIFGAHEHSYERMWPVYNSKVCNGT-NQPYTNPPAPVHIVTGSAGNQEGEDPFYPNKPDWTAFHSSDYGYTRMNIFNSTHMHLEQVSDDLNGKVIDEILYIRNQHG 1349
            IF  VL  + +F+S  L     QPEQ+HL+ G+  +  VVTWVTL   N S V YG N    HK  G++ KFVDGG   R I++HRV L +L P ++Y Y  GS  GWS I+ FT    G+NW  R+ V GDMGN+NA+SL  +Q + ++G+YD VLHVGDFAY++DS +A+ GD+FMRQI+ +AA +PYMT  GNHE AYNFSNY  RF+M   +G     +YSF++G AHIIGFS+EFYYF  YG+ Q+  QY WL+NDL++AN PENRA RPWII MGHRPMYCS +DDG+ C +  + IR G+PI       +  FGLE LFY+YGVDL   AHEH YER+WPVY+ KV NG+ + PYTNP APVHI+TGSAG QE  DPF PN   W+AF ++DYGYTRM I N TH++LEQVSDD  G++ID+++ ++++HG
Sbjct:    5 IFFSVLACFYFFTSCSLAILMTQPEQVHLSYGSVPSEMVVTWVTLDPTNISTVEYGFNKLNLHKI-GSMTKFVDGGPNSRVIYIHRVLLTDLKPGSEYIYHCGSIDGWSAIYWFTAMQSGTNWSPRFAVYGDMGNVNAQSLPRLQEDVQKGMYDAVLHVGDFAYDLDSDDAKVGDEFMRQIETIAAYVPYMTCVGNHESAYNFSNYDNRFSMLNKEGIMNNHYYSFDIGPAHIIGFSTEFYYFLQYGWTQMAYQYQWLENDLRKANLPENRAQRPWIITMGHRPMYCS-TDDGDDCTHKESIIRKGIPI-------LKAFGLEDLFYKYGVDLELWAHEHVYERLWPVYDRKVYNGSYDAPYTNPKAPVHIITGSAGCQENHDPFVPNPAGWSAFRNADYGYTRMYILNKTHLYLEQVSDDKGGQIIDKMMLVKDKHG 433          
BLAST of Purple acid phosphatase vs. Ensembl Cavefish
Match: acp7 (acid phosphatase 7, tartrate resistant (putative) [Source:NCBI gene;Acc:103026759])

HSP 1 Score: 439.499 bits (1129), Expect = 3.210e-151
Identity = 219/439 (49.89%), Postives = 294/439 (66.97%), Query Frame = 3
Query:   54 IFVIVLEFY----IYFSSGQLYNQPEQIHLAIGNDTTTFVVTWVTLSWVNESMVIYGP--NDALDHKQNGTVDKFVDGGSQKRNIFMHRVTLKNLLPSTKYNYLVGSRFGWSEIHSFTTFPLGSNWPTRYVVIGDMGNLNARSLAAIQRETERGLYDMVLHVGDFAYNMDSYNAQTGDQFMRQIQPVAAQIPYMTIPGNHEQAYNFSNYRRRFTMPGGDGEGQFYSFNVGYAHIIGFSSEFYYFTGYGFKQIENQYNWLKNDLKEANKPENRAVRPWIIAMGHRPMYCSNSDDGEHCLNPINAIRIGMPITVKRYGSMFVFGLEKLFYEYGVDLIFGAHEHSYERMWPVYNSKVCNG-TNQPYTNPPAPVHIVTGSAGNQEGEDPFYPNKPDWTAFHSSDYGYTRMNIFNSTHMHLEQVSDDLNGKVIDEILYIRNQHG 1349
            +F+  L F     +      ++ QPEQ+H++      + V+TW T     +SMV Y             G    FVDGG++KR +++HRVTL +L P + Y Y  GS  GWS++  FT     +++  R+ + GDMGN N +SLA +Q+ET+ G+YD +LH+GDFAY+M   N + GD+FM+QI+ +AA +PYMT PGNHE AYNFS+YR RF+MP G  E  +YS+N+G AHII FS+E Y++  YG   +  QY WL++DL+EANKPENRA+RPWII M HRPMYCS+ DD + C    + +R+G   T          GLE LFY++GVDL   AHEH+YER+WPVYN KV NG T++PY NP APVHI+TGSAG +E  D F P   DW+AF S+DYGYTRM++ N+TH++LEQVSDD +GKVID I  I++ HG
Sbjct:    4 LFLFFLSFCGLMPVALCVPPIWTQPEQVHISYPGVKGSMVITWTTFD-KTDSMVEYNLWGGKLFTQSAKGISTLFVDGGTEKRKLYIHRVTLSDLRPGSTYVYHCGSEEGWSDLFYFTALNESASFSPRFALFGDMGNENPQSLARLQKETQAGMYDAILHIGDFAYDMHEDNGRIGDEFMKQIESIAAYVPYMTCPGNHEWAYNFSHYRNRFSMP-GQTESLWYSWNIGSAHIISFSTEVYFYLEYGLDLLFEQYKWLQSDLEEANKPENRAIRPWIITMAHRPMYCSD-DDHDDCTKFESFVRLGRNDTKPP-----APGLEDLFYQHGVDLELWAHEHTYERLWPVYNYKVYNGSTDEPYVNPKAPVHIITGSAGCREKHDGFIPKPRDWSAFRSTDYGYTRMHLINTTHIYLEQVSDDQSGKVIDSITLIKDVHG 434          
BLAST of Purple acid phosphatase vs. Ensembl Sea Lamprey
Match: acp7 (acid phosphatase 7, tartrate resistant (putative) [Source:NCBI gene;Acc:571830])

HSP 1 Score: 433.335 bits (1113), Expect = 1.839e-149
Identity = 219/418 (52.39%), Postives = 288/418 (68.90%), Query Frame = 3
Query:  111 QPEQIHLAIGNDTTTFVVTWVTLSWVNESMVIYGP--NDALDHKQNGTVDKFVDGGSQKRNIFMHRVTLKNLLPSTKYNYLVGSRFGWSEIHSFTTFPLGSNWPTRYVVIGDMGNLNARSLAAIQRETERGLYDMVLHVGDFAYNMDSYNAQTGDQFMRQIQPVAAQIPYMTIPGNHEQAYNFSNYRRRFTMPGGDGEGQFYSFNVGYAHIIGFSSEFYYFTGYGFKQIENQYNWLKNDLKEANKPENRAVRPWIIAMGHRPMYCSNSDDGEHCLNPINAIRIGMPITVKRYGSMFVFGLEKLFYEY--GVDLIFGAHEHSYERMWPVYNSKVCNGTNQ-PYTNPPAPVHIVTGSAGNQEGEDPFYPNKPDWTAFHSSDYGYTRMNIFNSTHMHLEQVSDDLNGKVIDEILYIRNQHG 1349
            QPEQ+HL+   +  + +VTWVT +   +S++ Y    +     K  G+   F DGG +KR +++HRV +K L P  +Y Y  GS  GWS++  F+    GS+W  +  V GDMGN N +SLA +Q+ET+ G+YD +LHVGDFAY+MD  NA+ GD+FMRQI+ +AA +PYMT PGNHE AYNFSNYR RF+MP G+ EG +YS+N+G AHII  S+E YY+T YG   +  QY WLK DL+EAN PEN+   PWII +GHRPMYCSN +D + C +  + +R G         S  + GLEKLF+ Y  GVD+ F AHEHSYER+WP+Y+ KV NG+ + PY NP  PVHI+TGSAG +E  DPF P+  DW+AF SSDYGYTR+ I N +H++LEQVSDD +GKVID +  I+  HG
Sbjct:   31 QPEQMHLSFTGNPRSIMVTWVTTN-KTDSIIEYSRFGSKLFGLKAIGSSTIFTDGGVEKRFMYIHRVLIKELDPGAQYVYHCGSTDGWSDMFFFSAMREGSDWSPQLAVFGDMGNENPQSLARLQKETQMGMYDAILHVGDFAYDMDEDNARIGDEFMRQIESIAAYVPYMTCPGNHENAYNFSNYRNRFSMP-GNTEGLWYSWNIGPAHIISISTEVYYYTDYGLDLLLKQYEWLKKDLEEANLPENKKQTPWIITIGHRPMYCSN-NDTDDCKSFNSRVRTGF-----NSSSGVMPGLEKLFFIYDEGVDIEFWAHEHSYERLWPIYDYKVLNGSREFPYVNPKGPVHIITGSAGCRERVDPFVPHARDWSAFRSSDYGYTRLKIQNGSHVYLEQVSDDQSGKVIDSMWLIKENHG 440          
BLAST of Purple acid phosphatase vs. Ensembl Nematostella
Match: EDO41232 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4Y3])

HSP 1 Score: 445.277 bits (1144), Expect = 4.468e-152
Identity = 222/423 (52.48%), Postives = 285/423 (67.38%), Query Frame = 3
Query:   39 MFKLCIFVIVLEFYIYFSSGQLYNQPEQIHLAIGNDTTTFVVTWVTLSWVNESMVIYGPND--ALDHKQNGTVDKFVDGGSQKRNIFMHRVTLKNLLPSTKYNYLVGSRFGWSEIHSFTTFPLGSNWPTRYVVIGDMGNLNARSLAAIQRETERGLYDMVLHVGDFAYNMDSYNAQTGDQFMRQIQPVAAQIPYMTIPGNHEQAYNFSNYRRRFTMPGGDGEGQFYSFNVGYAHIIGFSSEFYYFTGYGFKQIENQYNWLKNDLKEANKPENRAVRPWIIAMGHRPMYCSNSDDGEHCLNPINAIRIGMPITVKRYGSMFVFGLEKLFYEYGVDLIFGAHEHSYERMWPVYNSKVCNGTNQ-PYTNPPAPVHIVTGSAGNQEGEDPFYPNKPDWTAFHSSDYGYTRMNIFNSTHMHLEQVSDD 1298
            +   C+FV +L      S+GQ + QPEQ+H++  +D T  VVTWVT      S+V Y        + + NGTV KFVDGG+  R I++HRVTLK L P+  Y+Y  G   GWSE  +F     G +W  R  + GD+GN NA+SL  +Q E +RG YD ++HVGDFAYNMD+ NA  GD+FMRQ+QP+AA +PYMT PGNHE AYNFSNYR RF+MP G+ E  +YSFN+G  H I  S+EFY+FT YG + I++QY WL+NDLKEA  PENR +RPWI  MGHRPMYCSN+D  + C    + +R G+P   K        GLE + Y+YG D++  AHEHSYE+++PVYN ++CNG+ + PYTNP APVHI+TGSAG QE  DPF  +   WTA  S DYGYTRM I N TH++ +Q S D
Sbjct:    7 LLSCCVFVALL---FGSSNGQSFYQPEQVHISATDDVTEMVVTWVTFDLTPHSIVEYNKQGYPKFELQANGTVTKFVDGGNLHRTIYIHRVTLKGLKPTQAYDYHCGGPDGWSEEFNFKARRDGVDWSPRLAIFGDLGNKNAKSLPFLQEEVQRGDYDAIIHVGDFAYNMDTDNALYGDEFMRQVQPIAAYVPYMTCPGNHEGAYNFSNYRFRFSMP-GNTESLYYSFNIGPVHFISISTEFYFFTDYGLELIDHQYAWLENDLKEAAAPENRTLRPWIFLMGHRPMYCSNTDHDD-CTMHESRVRTGIPELNKP-------GLEDILYKYGADVLIWAHEHSYEKLFPVYNRQMCNGSKEAPYTNPCAPVHIITGSAGCQENHDPFKYHFGPWTASRSLDYGYTRMTIHNKTHIYFDQFSVD 417          
BLAST of Purple acid phosphatase vs. Ensembl Nematostella
Match: EDO41277 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4Y2])

HSP 1 Score: 411.764 bits (1057), Expect = 2.549e-141
Identity = 207/398 (52.01%), Postives = 263/398 (66.08%), Query Frame = 3
Query:  159 VVTWVTLSWVNESMVIYGPND--ALDHKQNGTVDKFVDGGSQKRNIFMHRVTLKNLLPSTKYNYLVGSRFGWSEIHSFTTFPLGSNWPTRYVVIGDMGNLNARSLAAIQRETERGLYDMVLHVGDFAYNMDSYNAQTGDQFMRQIQPVAAQIPYMTIPGNHEQAYNFSNYRRRFTMPGGDGEGQFYSFNVGYAHIIGFSSEFYYFTGYGFKQIENQYNWLKNDLKEANKPENRAVRPWIIAMGHRPMYCSNSDDGEHCLNPINAIRIGMPITVKRYGSMFVFGLEKLFYEYGVDLIFGAHEHSYERMWPVYNSKVCNGTNQPYTNPPAPVHIVTGSAGNQEGEDPFYPNKPDWTAFHSSDYGYTRMNIFNSTHMHLEQVSDDLNGKVIDEILYIRNQH 1346
            V+TWVTL     S+V Y        + +  GTV KFV+GGS  R  ++HRVTLK+L P+  Y Y  G   GWSE  +F     G +W  R  + GD+GN NARSL  +Q E ++G YD ++HVGDFAY++ + N   GD+FMRQIQP+AA +PYMT PGNHE AYNFS+Y+ RF+MP G+  G +YS+N+G  H I  S+E Y+ T YG+  I+ QY WL+ DLKEA   ENR +RPWI AMGHRPMYCSN D  + C N ++ +R G+P   K        GLE LFYEYGVD++  AHEHSYER+WP+YN ++CNGT   Y NP APVHI+TGSAG  E  D F  +   WTAF S DYGYTRM I N TH++ +Q S D   KVID    I+++H
Sbjct:    2 VITWVTLDLTPHSVVEYNKQGYPKFELRAIGTVTKFVNGGSLNRTEYIHRVTLKDLTPTQSYVYHCGGPDGWSEEFNFKARRDGVDWSPRLAIFGDLGNKNARSLPFLQEEVQKGDYDAIIHVGDFAYDLFTNNGTYGDEFMRQIQPIAALVPYMTCPGNHESAYNFSDYKNRFSMP-GNTNGMYYSWNIGPVHFISISTEVYFSTYYGYDLIDYQYAWLERDLKEATSKENRTLRPWIFAMGHRPMYCSNLDRDD-CTNHLSIVRTGIPEKNKP-------GLEDLFYEYGVDVLLWAHEHSYERLWPLYNKQMCNGTKGAYINPCAPVHIITGSAGCSEDHDKFKKDYGPWTAFRSEDYGYTRMTIHNKTHIYFDQFSVD-KEKVIDSAWVIKDRH 389          
BLAST of Purple acid phosphatase vs. Ensembl Nematostella
Match: EDO38114 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDQ0])

HSP 1 Score: 376.326 bits (965), Expect = 5.360e-128
Identity = 193/382 (50.52%), Postives = 248/382 (64.92%), Query Frame = 3
Query:  159 VVTWVTLSWVNESMVIYG-PNDALDHKQNGTVDKFVDGGSQKRNIFMHRVTLKNLLPSTKYNYLVGSRFGWSEIHSFTTFPLGSNWPTRYVVIGDMGNLNARSLAAIQRETERGLYDMVLHVGDFAYNMDSYNAQTGDQFMRQIQPVAAQIPYMTIPGNHEQAYNFSNYRRRFTMPGGDGEGQFYSFNVGYAHIIGFSSEFYYFTGYGFKQIENQYNWLKNDLKEANKPENRAVRPWIIAMGHRPMYCSNSDDGEHCLNPINAIRIGMPITVKRYGSMFVFGLEKLFYEYGVDLIFGAHEHSYERMWPVYNSKVCNGT-NQPYTNPPAPVHIVTGSAGNQEGEDPFYPNKPDWTAFHSSDYGYTRMNIFNSTHMHLEQVSDD 1298
            +VTW T++  N S V +G     L  K +  V KF   G +KR I++HR  L+ L+PS  Y+Y  G   GWS I++F     GS+W   + V GD+G  N  +LA +QRE + G YD +LH+GDFAY+M S  A+ GD FM QI+ +AA  PYM  PGNHE A NFS+YR+RF+MPGG  EG FYS+N+G AHII FS+E YYF  +G +Q+  QY WL+ DL+EAN P NRA RPWII MGHRPMYCS            N IR G+        S+ +F LE+LFY++GVDL    HEHSYER++PVY  K+  G+  +PYTNP APVH+ +GSAG +   D F  +   WTAF S DYG+TRM I N+TH++ EQVS D
Sbjct:    2 MVTWATMARTNNSFVEFGLRGQPLGSKVDAEVSKFRTCGVKKRTIWIHRAKLEGLVPSEGYDYRCGGDHGWSAIYTFNASNAGSDWSPSFAVYGDLGVGNPMALAKLQREVQSGHYDAILHIGDFAYDMASDMARVGDTFMNQIETMAAYTPYMVCPGNHEHACNFSDYRKRFSMPGGT-EGIFYSWNIGPAHIISFSTEVYYFLQFGIEQLVQQYKWLQKDLEEANLPHNRAQRPWIITMGHRPMYCS------------NIIRTGIT-------SLKLFPLEELFYKHGVDLQLYGHEHSYERLYPVYQHKIYKGSEEEPYTNPKAPVHLTSGSAGCKYCHDSFKRDYGPWTAFRSLDYGFTRMKIHNNTHLYFEQVSID 363          
BLAST of Purple acid phosphatase vs. Ensembl Nematostella
Match: EDO28974 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4Y9])

HSP 1 Score: 322.398 bits (825), Expect = 4.675e-107
Identity = 174/362 (48.07%), Postives = 226/362 (62.43%), Query Frame = 3
Query:  114 PEQIHLAIGNDTTTFVVTWVTLSWVNESMVIYG-PNDALDHKQNGTVDKFVDGGSQKRNIFMHRVTLKNLLPSTKYNYLVGSRFGWSEIHSFTTFPLGSNWPTRYVV--------IGDMGNLNARSLAAIQRETERGLYDMVLHVG--DFAYNMDSYNAQTGDQFMRQIQPVAAQIPYMTIPGNHEQAYNFSNYRRRFTMPGGDGEGQFYSFNVGYAHIIGFSSEFYYFTGYGFKQIENQYNWLKNDLKEANKPENRAVRPWIIAMGHRPMYCSNSDDGEHCLNPINAIRIGMPITVKRYGSMFVFGLEKLFYEYGVDLIFGAHEHSYERMWPVYNSKVCNGT-NQPYTNPPAPVHIVTGSA 1163
            PEQIHL++  D +  +VTW T++  N S V +G     L  K +  V KF   G +KR I++HR  L+ L+PS  Y+Y  G   GWS I++F     GS+W   + V        IG  GN   R++           + + L +G  DFAY+M S  A+ GD FM QI+ +AA  PYM  PGNHE A NFS+YR+RF+MPGG  EG FYS+N+G AHII FS+E YYF  +G +Q+  QY WL+ DL+EAN P NRA RPWII MGHRPMYCSN   G+ C N  NAIR G+        S+ +F LE+LFY++GVDL    HEHSYER++PVY  K+  G+  +PYTNP APVH+ +GSA
Sbjct:    2 PEQIHLSLTGDPSEMMVTWATMARTNNSFVEFGLRGQPLGSKVDAEVSKFRTCGVKKRTIWIHRAKLEGLVPSEGYDYRCGGDHGWSAIYTFNASNAGSDWSPSFAVALRTITLCIGGHGNAR-RTITLCIGGHGSARHTITLCIGGHDFAYDMASDMARVGDAFMNQIETMAAYTPYMVCPGNHEHACNFSDYRKRFSMPGGT-EGIFYSWNIGPAHIISFSTEVYYFLQFGIEQLVQQYKWLQKDLEEANLPHNRAQRPWIITMGHRPMYCSNI-VGDGCQNHENAIRTGIT-------SLKLFPLEELFYKHGVDLQLYGHEHSYERLYPVYQHKIYKGSEEEPYTNPKAPVHLTSGSA 353          
BLAST of Purple acid phosphatase vs. Ensembl Nematostella
Match: EDO40135 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S863])

HSP 1 Score: 199.904 bits (507), Expect = 1.291e-58
Identity = 159/447 (35.57%), Postives = 224/447 (50.11%), Query Frame = 3
Query:  111 QPEQIHLAIGNDTTTFVVTWVTLSWVNE---SMVIYGPN-DALDHKQNGTVDKFV-----------------DGGSQKRNIFMHRVTLKNLLPSTKYNYLVGS-RFGWSEIHSFTTFPLGSNWPTRYVVIGDMGNLNARSLAAIQRETERGLYDMVLHVGDFAYNMDSYNAQTGDQFMRQIQPVAAQIPYMTIPGNHEQAYNFSNYRRRFTM----PG---GDGEGQFYSFNVGYAHIIGFSSE-FYYFTGYGFKQIENQYNWLKNDLKEANKPENRAVRPWIIAMGHRPMYCSNSDDGEHCLNPINAIRIGMPITVKRYGSMFVFGLEKLFYEYGVDLIFGAHEHSYERMWPVYNSKVCNGTNQ-PYTNPPAPVHIVTGSAGNQEG-EDPFYPNKPDWTAFHSSDYGYTRMNIFNSTHMH--LEQVSDDLNGKVIDEILYIRNQHG 1349
            +PEQIHLA    ++  +V +VT S  +E   +MV YG + D L  K  G  D FV                    +  R   +H V L  L P+TKY Y VG      S+  SF+T          Y V GDMG  NA SL  + +E   G +  V+HVGD AY+    +A TGD FM  IQPVA  +PYM +PGNHE  +NFS+Y+ RF+     PG   G     +YSFNVG  H + F +E F YF+  G  QI+ Q NWL+ DL +AN   NR  RPWI+++ H+    S S++ + C    N + I +    +   + F   +  L ++YGVD+ F  H H+Y+R +P Y  +V     +  Y NP     IV GSAG++E       P +    A +  DYG+  + + N TH+    E    +L     DE+  +++ HG
Sbjct:   22 RPEQIHLAYTGTSSERIVNYVTQS-TDEGLGTMVAYGTDPDRLSLKAIG--DSFVYDIPLWHKDPEISAIYNVSKADPRQFSIHNVKLTGLQPNTKYYYKVGDVNQTMSDTFSFST----KENNIIYAVYGDMGYSNAVSLPQLVQEARDGHFQAVIHVGDLAYDFYQKDADTGDNFMNAIQPVATLVPYMALPGNHEHRFNFSHYKNRFSNMKLGPGATSGSDTSLWYSFNVGLIHFVAFDTEVFNYFSDVG--QIQRQLNWLEADLAKANT--NRDKRPWIVSLAHK----SKSEE-QKC----NYLMIWIDFMDE---TNFTH-ISPLLHKYGVDIHFCGHSHNYQRHYPYYQDEVDRPDKKNVYVNPKFMTVIVAGSAGSKEKISHGLGPKRH--LAKYIFDYGFGHLQVMNHTHLRWTWENTGVELASIEQDELWIVQDNHG 442          
BLAST of Purple acid phosphatase vs. Ensembl Medaka
Match: acp7 (acid phosphatase 7, tartrate resistant (putative) [Source:NCBI gene;Acc:101169400])

HSP 1 Score: 425.246 bits (1092), Expect = 1.284e-145
Identity = 214/424 (50.47%), Postives = 284/424 (66.98%), Query Frame = 3
Query:   36 KMFKLCIFVIVLEFYIYFSSGQLYNQPEQIHLAIGNDTTTFVVTWVTLSWVNESMVIYGPNDALDHK--QNGTVDKFVDGGSQKRNIFMHRVTLKNLLPSTKYNYLVGSRFGWSEIHSFTTFPLGSNWPTRYVVIGDMGNLNARSLAAIQRETERGLYDMVLHVGDFAYNMDSYNAQTGDQFMRQIQPVAAQIPYMTIPGNHEQAYNFSNYRRRFTMPGGDGEGQFYSFNVGYAHIIGFSSEFYYFTGYGFKQIENQYNWLKNDLKEANKPENRAVRPWIIAMGHRPMYCSNSDDGEHCLNPINAIRIGMPITVKRYGSMFVFGLEKLFYEYGVDLIFGAHEHSYERMWPVYNSKVCNGT-NQPYTNPPAPVHIVTGSAGNQEGEDPFYPNKPDWTAFHSSDYGYTRMNIFNSTHMHLEQVSDD 1298
            +M      ++    ++      ++ QPEQ+HL+      + VVTW T +   ES V YG       K    G+   FVD G +KR +F+HRVTL  L P+  + Y  GS  GWS++ SFT     S++  R+ + GD+GN N +SL+ +Q++T+ G+YD++LH+GDFAY+M   NA+ GD+FMRQIQ +AA +PYMT PGNHE AYNFSNYR RF+MP G  E  +YS+++G AHII FS+E Y++  +G + I  QY WLK DL+EAN+PENRAVRPWII MGHRPMYCS+ DD + C    + +R+G   T          GLE LFY YGVDL   AHEH+YER+WPVY  KV NG+ +QPY NP APVHI+TGSAG +E  D F PN   W+AF S+DYGY+RM+I N++H++LEQVSDD
Sbjct:   21 RMLSAACLLLGFAPFLVHGVPPIWTQPEQVHLSYAGVPGSMVVTWTTFN-KTESTVEYGLLGGRMFKLIAKGSSALFVDSGKEKRKMFIHRVTLIGLKPAATHVYHCGSDEGWSDVFSFTALNDSSSFSPRFALYGDLGNENPQSLSRLQKDTQMGMYDVILHIGDFAYDMHEDNARIGDEFMRQIQSIAAYVPYMTCPGNHESAYNFSNYRSRFSMP-GQTESLWYSWDLGSAHIISFSTEVYFYLEFGLELIFKQYEWLKKDLEEANRPENRAVRPWIITMGHRPMYCSD-DDQDDCTKFHSFVRLGRNDTKPP-----APGLEDLFYRYGVDLELWAHEHTYERLWPVYGDKVYNGSADQPYVNPKAPVHIITGSAGCRERTDRFQPNPKAWSAFRSTDYGYSRMHIINASHIYLEQVSDD 436          
BLAST of Purple acid phosphatase vs. Planmine SMEST
Match: SMESG000074506.1 (SMESG000074506.1)

HSP 1 Score: 931.013 bits (2405), Expect = 0.000e+0
Identity = 443/443 (100.00%), Postives = 443/443 (100.00%), Query Frame = 3
Query:   39 MFKLCIFVIVLEFYIYFSSGQLYNQPEQIHLAIGNDTTTFVVTWVTLSWVNESMVIYGPNDALDHKQNGTVDKFVDGGSQKRNIFMHRVTLKNLLPSTKYNYLVGSRFGWSEIHSFTTFPLGSNWPTRYVVIGDMGNLNARSLAAIQRETERGLYDMVLHVGDFAYNMDSYNAQTGDQFMRQIQPVAAQIPYMTIPGNHEQAYNFSNYRRRFTMPGGDGEGQFYSFNVGYAHIIGFSSEFYYFTGYGFKQIENQYNWLKNDLKEANKPENRAVRPWIIAMGHRPMYCSNSDDGEHCLNPINAIRIGMPITVKRYGSMFVFGLEKLFYEYGVDLIFGAHEHSYERMWPVYNSKVCNGTNQPYTNPPAPVHIVTGSAGNQEGEDPFYPNKPDWTAFHSSDYGYTRMNIFNSTHMHLEQVSDDLNGKVIDEILYIRNQHGQVFNCL 1367
            MFKLCIFVIVLEFYIYFSSGQLYNQPEQIHLAIGNDTTTFVVTWVTLSWVNESMVIYGPNDALDHKQNGTVDKFVDGGSQKRNIFMHRVTLKNLLPSTKYNYLVGSRFGWSEIHSFTTFPLGSNWPTRYVVIGDMGNLNARSLAAIQRETERGLYDMVLHVGDFAYNMDSYNAQTGDQFMRQIQPVAAQIPYMTIPGNHEQAYNFSNYRRRFTMPGGDGEGQFYSFNVGYAHIIGFSSEFYYFTGYGFKQIENQYNWLKNDLKEANKPENRAVRPWIIAMGHRPMYCSNSDDGEHCLNPINAIRIGMPITVKRYGSMFVFGLEKLFYEYGVDLIFGAHEHSYERMWPVYNSKVCNGTNQPYTNPPAPVHIVTGSAGNQEGEDPFYPNKPDWTAFHSSDYGYTRMNIFNSTHMHLEQVSDDLNGKVIDEILYIRNQHGQVFNCL
Sbjct:    1 MFKLCIFVIVLEFYIYFSSGQLYNQPEQIHLAIGNDTTTFVVTWVTLSWVNESMVIYGPNDALDHKQNGTVDKFVDGGSQKRNIFMHRVTLKNLLPSTKYNYLVGSRFGWSEIHSFTTFPLGSNWPTRYVVIGDMGNLNARSLAAIQRETERGLYDMVLHVGDFAYNMDSYNAQTGDQFMRQIQPVAAQIPYMTIPGNHEQAYNFSNYRRRFTMPGGDGEGQFYSFNVGYAHIIGFSSEFYYFTGYGFKQIENQYNWLKNDLKEANKPENRAVRPWIIAMGHRPMYCSNSDDGEHCLNPINAIRIGMPITVKRYGSMFVFGLEKLFYEYGVDLIFGAHEHSYERMWPVYNSKVCNGTNQPYTNPPAPVHIVTGSAGNQEGEDPFYPNKPDWTAFHSSDYGYTRMNIFNSTHMHLEQVSDDLNGKVIDEILYIRNQHGQVFNCL 443          
BLAST of Purple acid phosphatase vs. Planmine SMEST
Match: SMESG000028714.1 (SMESG000028714.1)

HSP 1 Score: 413.305 bits (1061), Expect = 6.520e-141
Identity = 216/446 (48.43%), Postives = 285/446 (63.90%), Query Frame = 3
Query:   39 MFKLCIFVIVLEFYIYFSSGQL-----YNQPEQIHLAIGNDTTTFVVTWVTLSWVNESMVIYGPNDALDHKQNGTVDKFVDGGSQKRNIFMHRVTLKNLLPSTKYNYLVGS--RFGWSEIHSFTTFPLGSNWPTRYVVIGDMGNLNARSLAAIQRETERGLYDMVLHVGDFAYNMDSYNAQTGDQFMRQIQPVAAQIPYMTIPGNHEQAYNFSNYRRRFTMPGGDGEGQFYSFNVGYAHIIGFSSEFYYFTGYGFKQIENQYNWLKNDLKEANKPENRAVRPWIIAMGHRPMYCSNSDDGEHCLNPINAIRIGMPITVKRYGSMFVFGLEKLFYEYGVDLIFGAHEHSYERMWPVYNSKVCNGTN--QPYTNPPAPVHIVTGSAGNQEGEDPFYPNKPDWTAFHSSDYGYTRMNIFNSTHMHLEQVSDDLNGKVIDEILYIRNQHG 1349
            +F   IFV  L+  +  S+  +       +P+QIHL++GN+ T  VVTW T S   +++V YG  + +     GT   F +G +   N F+H   +  LLP+T Y Y VGS      S I++FTT PLG NW  R+ V GD+G +N +S + I  +    LYD++LHVGDFAY++D+     GDQFMR I+P+A+++PYM  PGNHE + NFSNY+ RF MP  D +  FYS+NVG  H I  S+EFY++  YG  QI NQY WL N+LK AN PENR  +PWII +GHRP+YC+NS DG  C    + +R G+P        + + GLE L YEYGV+L   AHEH+YERMWPVY  KV N +   QPY NP A VHIV+GSAG QE  D F   + D++AFHS DYGY+RM ++NSTH++ EQVSDD  GK+ID I  I+  HG
Sbjct:   11 IFHFFIFVSTLKTLLKRSTFAINADNNSTKPQQIHLSLGNNPTQMVVTWSTFSQT-DTLVRYGIGNLIT-THTGTSTNFSNGINH--NQFIHSAIMDQLLPNTTYIYQVGSGNPDEMSNIYNFTTLPLGMNWSPRFCVYGDLGLVNPQSYSRILADVNSRLYDVILHVGDFAYDLDANFGDIGDQFMRLIEPIASRVPYMASPGNHENSGNFSNYKNRFRMPNNDNQNMFYSYNVGPVHFISISTEFYFYVNYGLMQIFNQYKWLINELKTANLPENRKNQPWIILLGHRPLYCTNS-DGNDCTLGADWLRYGVPF-------IHLLGLEDLLYEYGVELAIWAHEHTYERMWPVYQEKVVNSSTPGQPYYNPKATVHIVSGSAGCQENHDEFPQIEKDYSAFHSKDYGYSRMTVYNSTHLYFEQVSDDQKGKIIDSIWLIKTHHG 444          
The following BLAST results are available for this feature:
BLAST of Purple acid phosphatase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ACP78.091e-13847.71acid phosphatase 7, tartrate resistant (putative) ... [more]
ACP73.580e-8055.81acid phosphatase 7, tartrate resistant (putative) ... [more]
ACP78.136e-2333.89acid phosphatase 7, tartrate resistant (putative) ... [more]
ACP78.368e-2333.89acid phosphatase 7, tartrate resistant (putative) ... [more]
back to top
BLAST of Purple acid phosphatase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F21A3.112.180e-13550.00Purple acid phosphatase [Source:UniProtKB/TrEMBL;... [more]
C08B6.146.803e-8839.72Purple acid phosphatase [Source:UniProtKB/TrEMBL;... [more]
papl-11.354e-7435.39Purple acid phosphatase [Source:UniProtKB/TrEMBL;... [more]
papl-11.354e-7435.39Purple acid phosphatase [Source:UniProtKB/TrEMBL;... [more]
papl-12.070e-7036.14Purple acid phosphatase [Source:UniProtKB/TrEMBL;... [more]
back to top
BLAST of Purple acid phosphatase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG16371.286e-15451.97gene:FBgn0030245 transcript:FBtr0073406[more]
CG16372.011e-15451.85gene:FBgn0030245 transcript:FBtr0339836[more]
CG16372.031e-15252.15gene:FBgn0030245 transcript:FBtr0073407[more]
CG16374.711e-15252.16gene:FBgn0030245 transcript:FBtr0346382[more]
CG16374.711e-15252.16gene:FBgn0030245 transcript:FBtr0073408[more]
back to top
BLAST of Purple acid phosphatase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
acp72.115e-13649.75acid phosphatase 7, tartrate resistant (putative) ... [more]
back to top
BLAST of Purple acid phosphatase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
abca22.629e-15354.22ATP binding cassette subfamily A member 2 [Source:... [more]
back to top
BLAST of Purple acid phosphatase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Acp71.105e-14650.34acid phosphatase 7, tartrate resistant [Source:MGI... [more]
Acp72.851e-14650.34acid phosphatase 7, tartrate resistant [Source:MGI... [more]
Acp75.143e-1837.40acid phosphatase 7, tartrate resistant [Source:MGI... [more]
back to top
BLAST of Purple acid phosphatase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8BX37|ACP7_MOUSE7.729e-14650.34Acid phosphatase type 7 OS=Mus musculus OX=10090 G... [more]
sp|A5D6U8|ACP7_DANRE5.147e-14149.41Acid phosphatase type 7 OS=Danio rerio OX=7955 GN=... [more]
sp|Q6ZNF0|ACP7_HUMAN3.886e-13747.71Acid phosphatase type 7 OS=Homo sapiens OX=9606 GN... [more]
sp|Q9C510|PPA6_ARATH3.413e-3429.58Purple acid phosphatase 6 OS=Arabidopsis thaliana ... [more]
sp|Q93WP4|PEPP_ALLCE3.347e-3327.79Phosphoenolpyruvate phosphatase OS=Allium cepa OX=... [more]
back to top
BLAST of Purple acid phosphatase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8GHM80.000e+060.18Purple acid phosphatase OS=Macrostomum lignano OX=... [more]
A0A1I8GHZ90.000e+059.95Purple acid phosphatase OS=Macrostomum lignano OX=... [more]
A0A1S3IPU21.514e-18058.73Purple acid phosphatase OS=Lingula unguis OX=7574 ... [more]
A0A504Y7X03.333e-16956.64Purple acid phosphatase OS=Fasciola gigantica OX=4... [more]
A0A087U1551.773e-16655.48Purple acid phosphatase (Fragment) OS=Stegodyphus ... [more]
back to top
BLAST of Purple acid phosphatase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
acp73.210e-15149.89acid phosphatase 7, tartrate resistant (putative) ... [more]
back to top
BLAST of Purple acid phosphatase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
acp71.839e-14952.39acid phosphatase 7, tartrate resistant (putative) ... [more]
back to top
BLAST of Purple acid phosphatase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Purple acid phosphatase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO412324.468e-15252.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412772.549e-14152.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO381145.360e-12850.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO289744.675e-10748.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO401351.291e-5835.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Purple acid phosphatase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
acp71.284e-14550.47acid phosphatase 7, tartrate resistant (putative) ... [more]
back to top
BLAST of Purple acid phosphatase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000074506.10.000e+0100.00SMESG000074506.1[more]
SMESG000028714.16.520e-14148.43SMESG000028714.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021884 ID=SMED30021884|Name=Purple acid phosphatase|organism=Schmidtea mediterranea sexual|type=transcript|length=1489bp
CAAATATCAAAAGTCCATTAACATTTTATTTTTGAAAAATGTTTAAATTA
TGCATTTTCGTCATCGTGTTAGAATTTTATATTTATTTCAGTTCCGGTCA
ACTGTATAATCAACCTGAACAAATACATCTTGCTATAGGAAATGATACGA
CGACATTTGTTGTGACATGGGTCACATTATCCTGGGTGAATGAGAGCATG
GTCATTTACGGGCCTAATGATGCACTGGACCACAAACAAAATGGAACCGT
TGACAAATTTGTTGATGGTGGATCCCAGAAACGAAATATTTTTATGCATC
GCGTTACATTAAAAAATTTGTTGCCTTCCACAAAATACAATTATCTCGTT
GGATCACGATTTGGATGGTCTGAGATCCATTCATTTACGACCTTTCCACT
TGGATCGAATTGGCCAACAAGATATGTGGTAATTGGAGATATGGGTAATC
TAAATGCCAGATCTTTGGCAGCGATTCAAAGAGAAACGGAAAGAGGTTTA
TATGACATGGTCCTTCATGTTGGTGACTTTGCATATAACATGGATTCGTA
CAACGCACAAACTGGTGACCAATTTATGAGACAAATCCAACCTGTAGCGG
CTCAAATACCTTACATGACAATTCCTGGAAACCATGAACAAGCATATAAC
TTTAGCAATTATAGACGACGATTTACTATGCCCGGAGGAGATGGGGAGGG
ACAATTTTACAGTTTTAATGTGGGATATGCACATATTATTGGATTTTCAT
CAGAATTTTACTATTTTACTGGTTATGGATTTAAACAAATTGAAAATCAA
TACAATTGGCTTAAAAATGATTTAAAGGAAGCAAACAAGCCAGAAAACCG
AGCCGTTCGACCTTGGATCATTGCAATGGGCCATCGGCCAATGTATTGCA
GTAATAGTGATGATGGGGAGCATTGTTTAAACCCAATAAACGCAATCAGA
ATTGGAATGCCGATCACCGTTAAACGGTACGGATCAATGTTCGTTTTTGG
GCTTGAAAAACTGTTTTACGAGTATGGGGTTGATCTGATCTTCGGAGCCC
ATGAACATTCATATGAAAGAATGTGGCCTGTTTATAATTCTAAGGTGTGC
AATGGTACTAACCAACCATATACCAACCCACCAGCACCAGTTCATATTGT
TACAGGATCAGCCGGGAATCAAGAAGGAGAAGATCCTTTCTATCCTAATA
AACCAGATTGGACGGCGTTTCATTCTTCTGATTATGGTTATACCAGAATG
AACATATTCAATTCAACTCACATGCATCTGGAACAAGTGTCAGACGACTT
GAATGGCAAAGTCATAGATGAAATACTTTATATTAGAAACCAACATGGCC
AGGTATTCAATTGCCTGTAATGTGGACTCATACAGATATGTATGAAATTA
ACAAAATTTTCATTTCAATGAACTTTATTATTTTAAATGAATACATAAAT
GTTTTAATTTTATTGTCTCACAGTAACAGATTATGCAAG
back to top

protein sequence of SMED30021884-orf-1

>SMED30021884-orf-1 ID=SMED30021884-orf-1|Name=SMED30021884-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=444bp
MFKLCIFVIVLEFYIYFSSGQLYNQPEQIHLAIGNDTTTFVVTWVTLSWV
NESMVIYGPNDALDHKQNGTVDKFVDGGSQKRNIFMHRVTLKNLLPSTKY
NYLVGSRFGWSEIHSFTTFPLGSNWPTRYVVIGDMGNLNARSLAAIQRET
ERGLYDMVLHVGDFAYNMDSYNAQTGDQFMRQIQPVAAQIPYMTIPGNHE
QAYNFSNYRRRFTMPGGDGEGQFYSFNVGYAHIIGFSSEFYYFTGYGFKQ
IENQYNWLKNDLKEANKPENRAVRPWIIAMGHRPMYCSNSDDGEHCLNPI
NAIRIGMPITVKRYGSMFVFGLEKLFYEYGVDLIFGAHEHSYERMWPVYN
SKVCNGTNQPYTNPPAPVHIVTGSAGNQEGEDPFYPNKPDWTAFHSSDYG
YTRMNIFNSTHMHLEQVSDDLNGKVIDEILYIRNQHGQVFNCL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR041792MPP_PAP
IPR015914Purple_acid_Pase_N
IPR004843Calcineurin-like_PHP_ApaH
IPR025733Purple_acid_PPase_C_dom
IPR029052Metallo-depent_PP-like
IPR008963Purple_acid_Pase-like_N
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0016787hydrolase activity
GO:0003993acid phosphatase activity
Vocabulary: biological process
TermDefinition
GO:0016311dephosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004843Calcineurin-like phosphoesterase domain, ApaH typePFAMPF00149Metallophoscoord: 128..342
e-value: 4.6E-23
score: 82.8
IPR029052Metallo-dependent phosphatase-likeGENE3DG3DSA:3.60.21.10coord: 122..438
e-value: 5.5E-97
score: 327.0
IPR015914Purple acid phosphatase, N-terminalPFAMPF16656Pur_ac_phosph_Ncoord: 26..118
e-value: 3.8E-18
score: 65.9
IPR008963Purple acid phosphatase-like, N-terminalGENE3DG3DSA:2.60.40.380coord: 25..121
e-value: 1.3E-16
score: 62.8
IPR008963Purple acid phosphatase-like, N-terminalSUPERFAMILYSSF49363Purple acid phosphatase, N-terminal domaincoord: 6..120
IPR025733Iron/zinc purple acid phosphatase-like C-terminal domainPFAMPF14008Metallophos_Ccoord: 366..428
e-value: 9.1E-24
score: 84.1
NoneNo IPR availablePANTHERPTHR45867FAMILY NOT NAMEDcoord: 4..439
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.775
NoneNo IPR availableSUPERFAMILYSSF56300Metallo-dependent phosphatasescoord: 128..419
IPR041792Purple acid phosphatase, metallophosphatase domainCDDcd00839MPP_PAPscoord: 123..429
e-value: 9.62477E-116
score: 338.889