Disks large homolog 1

Overview
NameDisks large homolog 1
Smed IDSMED30021882
Length (bp)1515
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Disks large homolog 1 (SMED30021882) t-SNE clustered cells

Violin plots show distribution of expression levels for Disks large homolog 1 (SMED30021882) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Disks large homolog 1 (SMED30021882) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Disks large homolog 1 (SMED30021882) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021882

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30021882SMESG000045568.1 Contig4881GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30021882SMESG000045568.1 Contig4881GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30021882SMESG000045568.1 dd_Smed_v4_8293_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30021882SMESG000045568.1 dd_Smed_v4_8293_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021882SMESG000045568.1 dd_Smed_v4_8293_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Disks large homolog 1 vs. Ensembl Human
Match: DLG3 (discs large MAGUK scaffold protein 3 [Source:HGNC Symbol;Acc:HGNC:2902])

HSP 1 Score: 186.037 bits (471), Expect = 1.540e-53
Identity = 106/304 (34.87%), Postives = 160/304 (52.63%), Query Frame = 1
Query:  340 KSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDEGIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRK----RQQATMQQNLTKTDQKMSINDF---------------YEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEK 1194
            +S YV+ L +Y+   D  LP +GLSF  G+ILH+ NA+D +WW AR + P   +      G+IPS  R+ KK + +  +V F  +T +IESN         S  T    S  L RK    + +  M Q  +  +Q ++ N                 YE V   +  + RPV+ +GP + ++ D LI  +P+ F S V HTTRP+R NE++G DYHF+ ++ Q   D +   FIE  ++N N YGTS+ +VR V E  +HCI+D +   IK L++  + PI+I I P +      +   QT E+
Sbjct:   19 RSLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGES---EQIGVIPSKKRVEKKERARLKTVKFHARTGMIESN--------RSIKTKRKKSFRLSRKFPFYKSKENMAQESSIQEQGVTSNTSDSESSSKGQEDAILSYEPVTRQEIHYARPVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQDNKFIEAGQFNDNLYGTSIQSVRAVAERGKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSIEALMEMNRRQTYEQ 311          
BLAST of Disks large homolog 1 vs. Ensembl Human
Match: DLG3 (discs large MAGUK scaffold protein 3 [Source:HGNC Symbol;Acc:HGNC:2902])

HSP 1 Score: 186.037 bits (471), Expect = 4.136e-52
Identity = 106/304 (34.87%), Postives = 160/304 (52.63%), Query Frame = 1
Query:  340 KSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDEGIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRK----RQQATMQQNLTKTDQKMSINDF---------------YEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEK 1194
            +S YV+ L +Y+   D  LP +GLSF  G+ILH+ NA+D +WW AR + P   +      G+IPS  R+ KK + +  +V F  +T +IESN         S  T    S  L RK    + +  M Q  +  +Q ++ N                 YE V   +  + RPV+ +GP + ++ D LI  +P+ F S V HTTRP+R NE++G DYHF+ ++ Q   D +   FIE  ++N N YGTS+ +VR V E  +HCI+D +   IK L++  + PI+I I P +      +   QT E+
Sbjct:  165 RSLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGES---EQIGVIPSKKRVEKKERARLKTVKFHARTGMIESN--------RSIKTKRKKSFRLSRKFPFYKSKENMAQESSIQEQGVTSNTSDSESSSKGQEDAILSYEPVTRQEIHYARPVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQDNKFIEAGQFNDNLYGTSIQSVRAVAERGKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSIEALMEMNRRQTYEQ 457          
BLAST of Disks large homolog 1 vs. Ensembl Human
Match: DLG1 (discs large MAGUK scaffold protein 1 [Source:HGNC Symbol;Acc:HGNC:2900])

HSP 1 Score: 184.496 bits (467), Expect = 3.207e-51
Identity = 112/332 (33.73%), Postives = 176/332 (53.01%), Query Frame = 1
Query:  340 KSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDE-GIIPSANRLYKKHQNKEMSVNFEEKTI----IIESNGSQTLDKINSGSTPGSSSLDLKRKRQQATMQQNLTKTDQKMSINDFYEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEKLVKNSMQYSSMLNSKE-RKSFDVKLKCQNMEELVKETFISVT 1317
            +S YV+ L +Y+   D  LP +GL+F+ G+ILH+ NA+D +WW AR++ P       SDE G+IPS  R+ KK + +  +V F  KT     I +  GS+ L  + S ++   SS    R +++  +                YE V   +  + RPV+ +GP + ++ D LI  +P+ F S V HTTRPKR  E++G DYHF+ ++ Q   D +   FIE  +YN + YGTS+ +VR V E  +HCI+D +   IK L+   + PISI I P                K ++N M+ +  L  ++ RK+F+  +K   +E+   E F ++ 
Sbjct:  229 RSLYVRALFDYDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGE----SDEVGVIPSKRRVEKKERARLKTVKFNSKTRDKGEIPDDMGSKGLKHVTSNASDSESSY---RGQEEYVLS---------------YEPVNQQEVNYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVREVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKP----------------KSMENIMEMNKRLTEEQARKTFERAMK---LEQEFTEHFTAIV 519          
BLAST of Disks large homolog 1 vs. Ensembl Human
Match: DLG2 (discs large MAGUK scaffold protein 2 [Source:HGNC Symbol;Acc:HGNC:2901])

HSP 1 Score: 177.178 bits (448), Expect = 2.179e-50
Identity = 98/282 (34.75%), Postives = 157/282 (55.67%), Query Frame = 1
Query:  298 MRDGINAIAIDDKIKSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDEGIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRKRQQATMQQNLTKTDQKMSINDFYEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICP 1143
            M  G  ++  + K +S YV+ + +Y+   D  LP +GLSF+ G+ILH+ NA+D +WW AR++     +    + G+IPS  R+ +K + +  +V F  K  +I+S G      I      G  +  LK     A+  ++  +  + + ++  YE V   +  + RPV+ +GP + ++ D LI  +P+ F S V HTTRPKR  E++G DYHF+ ++ Q   D +   FIE  +YN N YGTS+ +VR V E  +HCI+D +   IK L+   + PI+I I P
Sbjct:    6 MSSGSGSLRTNQK-RSLYVRAMFDYDKSKDSGLPSQGLSFKYGDILHVINASDDEWWQARRVMLEGDS---EEMGVIPSKRRVERKERARLKTVKFNAKPGVIDSKGD-----IPGLGDDGYGTKTLKHVSSNASDSESSYRGQEDLILS--YEPVTRQEINYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVISREQMEKDIQEHKFIEAGQYNDNLYGTSVQSVRFVAERGKHCILDVSGNAIKRLQVAQLYPIAIFIKP 276          
BLAST of Disks large homolog 1 vs. Ensembl Human
Match: DLG1 (discs large MAGUK scaffold protein 1 [Source:HGNC Symbol;Acc:HGNC:2900])

HSP 1 Score: 185.267 bits (469), Expect = 3.984e-50
Identity = 114/331 (34.44%), Postives = 179/331 (54.08%), Query Frame = 1
Query:  340 KSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDE-GIIPSANRLYKKHQNKEMSVNFEEKTI----IIESNGSQTLDKINSGSTPGSSSLDLKRKRQQATMQQNLTKTDQKMSINDFYEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEKLVKNSMQYSSMLNSKE-RKSFDVKLKCQNMEELVKETFISV 1314
            +S YV+ L +Y+   D  LP +GL+F+ G+ILH+ NA+D +WW AR++ P       SDE G+IPS  R+ KK + +  +V F  KT     I +  GS+ L  + S ++   SS  +       T +   +K  Q+  +   YE V   +  + RPV+ +GP + ++ D LI  +P+ F S V HTTRPKR  E++G DYHF+ ++ Q   D +   FIE  +YN + YGTS+ +VR V E  +HCI+D +   IK L+   + PISI I P                K ++N M+ +  L  ++ RK+F+  +K   +E+   E F ++
Sbjct:  466 RSLYVRALFDYDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGE----SDEVGVIPSKRRVEKKERARLKTVKFNSKTRDKGEIPDDMGSKGLKHVTSNASDSESSYLI-----LITDEYGCSKGGQEEYVLS-YEPVNQQEVNYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVREVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKP----------------KSMENIMEMNKRLTEEQARKTFERAMK---LEQEFTEHFTAI 767          
BLAST of Disks large homolog 1 vs. Ensembl Celegans
Match: dlg-1 (Disks large homolog 1 [Source:UniProtKB/Swiss-Prot;Acc:G5ECY0])

HSP 1 Score: 160.229 bits (404), Expect = 1.078e-41
Identity = 104/339 (30.68%), Postives = 174/339 (51.33%), Query Frame = 1
Query:  340 KSFYVKTLIEYNSESDYSL-PRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDEGIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKR-KRQQATMQQNLTKTDQKMSINDF--------------YEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKN-DIQPISILICPDTYNVAKSLMGEQTSEKLVKNSMQYSSMLNSKERKSFDVKLKCQNMEELVKETF 1305
            KS YV+ L +Y+   + S+ P + + F  G+ILHI N++D +WW ARK++    N   + EG+IPS  R+ K+ + +   VNF        ++GSQ+L     G    ++ L+ +R  R Q +  +          +ND               Y+ VE     + RPV+ +G  + ++ D+L+   P+ F+S V HT+RP R  E+ G DY+F+ NK+    D +  LFIE  ++  N YGTS+ +VR+V    RHCI+D +   I+ L+ N +IQPISI I P +   A+ ++  +   +L  N     +M   + +  +    +C  +E+   + F
Sbjct:  620 KSEYVRALFDYDPSRENSVAPHRSMGFNYGDILHIINSSDDEWWTARKVH---ENGEETAEGVIPSKKRVEKRERLRRKQVNF--------NSGSQSL-----GRNSSTTGLENRRGSRSQLSFSRKFPFVKSTDRLNDLNEESSNVAEEPVWSYQAVEQQAINYVRPVIILGALKDRINDELVNRDPSKFSSCVPHTSRPPREGEVNGRDYYFV-NKHNMEEDVKNNLFIEAGQFQNNLYGTSIQSVRDVANQGRHCILDVSGNAIRRLQSNANIQPISIFIKPSS---AQQIL--ELDSQLATNRQDDRAMSGEEAQAQYS---RCHRIEQTFGDLF 933          
BLAST of Disks large homolog 1 vs. Ensembl Celegans
Match: magu-2 (MAGUK family [Source:UniProtKB/TrEMBL;Acc:A0A3B1DQX2])

HSP 1 Score: 89.7373 bits (221), Expect = 1.067e-18
Identity = 74/275 (26.91%), Postives = 128/275 (46.55%), Query Frame = 1
Query:  349 YVKTLIEYNSESDYSLPRKGLS--FEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDEGIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRKRQQATMQQNLTKTDQKMSINDFYEIV-ESTKSLFPRPVL---AIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILI-CPDTY 1152
            +++ L +Y+ E D  +P K L+  F+ G+ILH+ N  D +WW A +      +I  S  G+IPS++              F ++ ++      +  ++              K + ++   ++NL           + E+V E  K+   RP++   A G G  KL D+L+ +     A PV +T+R  +  E  G  YHF+ +K +F+ D ++G F+E  EY   +YGT+   V NV+E  + C++      +  +   DIQP  I I  P  Y
Sbjct:  341 HLRALFDYDPEDDVYVPCKELAMKFQRGDILHVLNTKDDNWWQAYRDG---EDIQHSLAGLIPSSS--------------FRQQVVLYADEVEREQEQKRKECK---GKKKKKLEVKKGADEENLPAIGVYSDFLTYEEVVLELPKATHRRPIVLCGAEGVGCLKLRDRLLESDRITLACPVPYTSRTPKEGEFNGVHYHFV-SKQKFHEDAKSGKFVEFGEYQKFWYGTAKKDVVNVIERGKTCVMTLKAESLGAIRSPDIQPYIIFIAAPSLY 594          
BLAST of Disks large homolog 1 vs. Ensembl Celegans
Match: magu-2 (MAGUK family [Source:UniProtKB/TrEMBL;Acc:A0A3B1DQX2])

HSP 1 Score: 89.7373 bits (221), Expect = 1.067e-18
Identity = 74/275 (26.91%), Postives = 128/275 (46.55%), Query Frame = 1
Query:  349 YVKTLIEYNSESDYSLPRKGLS--FEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDEGIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRKRQQATMQQNLTKTDQKMSINDFYEIV-ESTKSLFPRPVL---AIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILI-CPDTY 1152
            +++ L +Y+ E D  +P K L+  F+ G+ILH+ N  D +WW A +      +I  S  G+IPS++              F ++ ++      +  ++              K + ++   ++NL           + E+V E  K+   RP++   A G G  KL D+L+ +     A PV +T+R  +  E  G  YHF+ +K +F+ D ++G F+E  EY   +YGT+   V NV+E  + C++      +  +   DIQP  I I  P  Y
Sbjct:  341 HLRALFDYDPEDDVYVPCKELAMKFQRGDILHVLNTKDDNWWQAYRDG---EDIQHSLAGLIPSSS--------------FRQQVVLYADEVEREQEQKRKECK---GKKKKKLEVKKGADEENLPAIGVYSDFLTYEEVVLELPKATHRRPIVLCGAEGVGCLKLRDRLLESDRITLACPVPYTSRTPKEGEFNGVHYHFV-SKQKFHEDAKSGKFVEFGEYQKFWYGTAKKDVVNVIERGKTCVMTLKAESLGAIRSPDIQPYIIFIAAPSLY 594          
BLAST of Disks large homolog 1 vs. Ensembl Celegans
Match: magu-2 (MAGUK family [Source:UniProtKB/TrEMBL;Acc:A0A3B1DQX2])

HSP 1 Score: 89.7373 bits (221), Expect = 1.278e-18
Identity = 74/275 (26.91%), Postives = 128/275 (46.55%), Query Frame = 1
Query:  349 YVKTLIEYNSESDYSLPRKGLS--FEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDEGIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRKRQQATMQQNLTKTDQKMSINDFYEIV-ESTKSLFPRPVL---AIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILI-CPDTY 1152
            +++ L +Y+ E D  +P K L+  F+ G+ILH+ N  D +WW A +      +I  S  G+IPS++              F ++ ++      +  ++              K + ++   ++NL           + E+V E  K+   RP++   A G G  KL D+L+ +     A PV +T+R  +  E  G  YHF+ +K +F+ D ++G F+E  EY   +YGT+   V NV+E  + C++      +  +   DIQP  I I  P  Y
Sbjct:  503 HLRALFDYDPEDDVYVPCKELAMKFQRGDILHVLNTKDDNWWQAYRDG---EDIQHSLAGLIPSSS--------------FRQQVVLYADEVEREQEQKRKECK---GKKKKKLEVKKGADEENLPAIGVYSDFLTYEEVVLELPKATHRRPIVLCGAEGVGCLKLRDRLLESDRITLACPVPYTSRTPKEGEFNGVHYHFV-SKQKFHEDAKSGKFVEFGEYQKFWYGTAKKDVVNVIERGKTCVMTLKAESLGAIRSPDIQPYIIFIAAPSLY 756          
BLAST of Disks large homolog 1 vs. Ensembl Celegans
Match: magu-2 (MAGUK family [Source:UniProtKB/TrEMBL;Acc:A0A3B1DQX2])

HSP 1 Score: 89.7373 bits (221), Expect = 1.278e-18
Identity = 74/275 (26.91%), Postives = 128/275 (46.55%), Query Frame = 1
Query:  349 YVKTLIEYNSESDYSLPRKGLS--FEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDEGIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRKRQQATMQQNLTKTDQKMSINDFYEIV-ESTKSLFPRPVL---AIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILI-CPDTY 1152
            +++ L +Y+ E D  +P K L+  F+ G+ILH+ N  D +WW A +      +I  S  G+IPS++              F ++ ++      +  ++              K + ++   ++NL           + E+V E  K+   RP++   A G G  KL D+L+ +     A PV +T+R  +  E  G  YHF+ +K +F+ D ++G F+E  EY   +YGT+   V NV+E  + C++      +  +   DIQP  I I  P  Y
Sbjct:  503 HLRALFDYDPEDDVYVPCKELAMKFQRGDILHVLNTKDDNWWQAYRDG---EDIQHSLAGLIPSSS--------------FRQQVVLYADEVEREQEQKRKECK---GKKKKKLEVKKGADEENLPAIGVYSDFLTYEEVVLELPKATHRRPIVLCGAEGVGCLKLRDRLLESDRITLACPVPYTSRTPKEGEFNGVHYHFV-SKQKFHEDAKSGKFVEFGEYQKFWYGTAKKDVVNVIERGKTCVMTLKAESLGAIRSPDIQPYIIFIAAPSLY 756          
BLAST of Disks large homolog 1 vs. Ensembl Fly
Match: dlg1 (gene:FBgn0001624 transcript:FBtr0333262)

HSP 1 Score: 184.496 bits (467), Expect = 5.646e-50
Identity = 113/347 (32.56%), Postives = 183/347 (52.74%), Query Frame = 1
Query:  340 KSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDE--GIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRKR---------QQATMQQNLTKTDQKMSINDF--YEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEKLVKNSMQYSSMLNSKERKSFDVKLKCQNMEEL---VKETFISVTNCQKW 1332
            +S YV+ L +Y+   D  LP +GL F+ G+ILH+ NA+D +WW AR++  L  N    DE  GI+PS  R  +K + ++ SV F+       +  +  LDK         S+LD K+K           ++  ++N   +DQ+ S  +   YE V+     + RPV+ +GP + ++ D LI  YP+ F S V HTTRPKR  E++G DYHF+ ++ Q   D +  LFIE  +YN N YGTS+ +VR V E  +HCI+D +   IK L+   + P+++ I P + +     M  + +E+  K + + +  +  +  + F   ++   +EE+   VK    S +    W
Sbjct:  609 RSLYVRALFDYDPNRDDGLPSRGLPFKHGDILHVTNASDDEWWQARRV--LGDN---EDEQIGIVPSKRRWERKMRARDRSVKFQG-----HAAANNNLDK--------QSTLDRKKKNFTFSRKFPFMKSRDEKNEDGSDQEPSEENVLSYEAVQRLSINYTRPVIILGPLKDRINDDLISEYPDKFGSCVPHTTRPKREYEVDGRDYHFVSSREQMERDIQNHLFIEAGQYNDNLYGTSVASVREVAEKGKHCILDVSGNAIKRLQVAQLYPVAVFIKPKSVDSVME-MNRRMTEEQAKKTYERAIKMEQEFGEYFTGVVQGDTIEEIYSKVKSMIWSQSGPTIW 936          
BLAST of Disks large homolog 1 vs. Ensembl Fly
Match: dlg1 (gene:FBgn0001624 transcript:FBtr0073490)

HSP 1 Score: 176.792 bits (447), Expect = 2.409e-47
Identity = 113/362 (31.22%), Postives = 184/362 (50.83%), Query Frame = 1
Query:  340 KSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDE--GIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRKR---------QQATMQQNLTKTDQK-----MSINDF------------YEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEKLVKNSMQYSSMLNSKERKSFDVKLKCQNMEEL---VKETFISVTNCQKW 1332
            +S YV+ L +Y+   D  LP +GL F+ G+ILH+ NA+D +WW AR++  L  N    DE  GI+PS  R  +K + ++ SV F+       +  +  LDK         S+LD K+K           ++  ++N   +DQ+      + +D             YE V+     + RPV+ +GP + ++ D LI  YP+ F S V HTTRPKR  E++G DYHF+ ++ Q   D +  LFIE  +YN N YGTS+ +VR V E  +HCI+D +   IK L+   + P+++ I P + +     M  + +E+  K + + +  +  +  + F   ++   +EE+   VK    S +    W
Sbjct:  562 RSLYVRALFDYDPNRDDGLPSRGLPFKHGDILHVTNASDDEWWQARRV--LGDN---EDEQIGIVPSKRRWERKMRARDRSVKFQG-----HAAANNNLDK--------QSTLDRKKKNFTFSRKFPFMKSRDEKNEDGSDQEPFMLCYTQDDANAEGASEENVLSYEAVQRLSINYTRPVIILGPLKDRINDDLISEYPDKFGSCVPHTTRPKREYEVDGRDYHFVSSREQMERDIQNHLFIEAGQYNDNLYGTSVASVREVAEKGKHCILDVSGNAIKRLQVAQLYPVAVFIKPKSVDSVME-MNRRMTEEQAKKTYERAIKMEQEFGEYFTGVVQGDTIEEIYSKVKSMIWSQSGPTIW 904          
BLAST of Disks large homolog 1 vs. Ensembl Fly
Match: dlg1 (gene:FBgn0001624 transcript:FBtr0112812)

HSP 1 Score: 176.407 bits (446), Expect = 3.329e-47
Identity = 113/362 (31.22%), Postives = 184/362 (50.83%), Query Frame = 1
Query:  340 KSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDE--GIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRKR---------QQATMQQNLTKTDQK-----MSINDF------------YEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEKLVKNSMQYSSMLNSKERKSFDVKLKCQNMEEL---VKETFISVTNCQKW 1332
            +S YV+ L +Y+   D  LP +GL F+ G+ILH+ NA+D +WW AR++  L  N    DE  GI+PS  R  +K + ++ SV F+       +  +  LDK         S+LD K+K           ++  ++N   +DQ+      + +D             YE V+     + RPV+ +GP + ++ D LI  YP+ F S V HTTRPKR  E++G DYHF+ ++ Q   D +  LFIE  +YN N YGTS+ +VR V E  +HCI+D +   IK L+   + P+++ I P + +     M  + +E+  K + + +  +  +  + F   ++   +EE+   VK    S +    W
Sbjct:  562 RSLYVRALFDYDPNRDDGLPSRGLPFKHGDILHVTNASDDEWWQARRV--LGDN---EDEQIGIVPSKRRWERKMRARDRSVKFQG-----HAAANNNLDK--------QSTLDRKKKNFTFSRKFPFMKSRDEKNEDGSDQEPFMLCYTQDDANAEGASEENVLSYEAVQRLSINYTRPVIILGPLKDRINDDLISEYPDKFGSCVPHTTRPKREYEVDGRDYHFVSSREQMERDIQNHLFIEAGQYNDNLYGTSVASVREVAEKGKHCILDVSGNAIKRLQVAQLYPVAVFIKPKSVDSVME-MNRRMTEEQAKKTYERAIKMEQEFGEYFTGVVQGDTIEEIYSKVKSMIWSQSGPTIW 904          
BLAST of Disks large homolog 1 vs. Ensembl Fly
Match: dlg1 (gene:FBgn0001624 transcript:FBtr0073488)

HSP 1 Score: 176.407 bits (446), Expect = 3.848e-47
Identity = 106/316 (33.54%), Postives = 165/316 (52.22%), Query Frame = 1
Query:  340 KSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDE--GIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRKR---------QQATMQQNLTKTDQK-----MSINDF------------YEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEKLVK 1203
            +S YV+ L +Y+   D  LP +GL F+ G+ILH+ NA+D +WW AR++  L  N    DE  GI+PS  R  +K + ++ SV F+       +  +  LDK         S+LD K+K           ++  ++N   +DQ+      + +D             YE V+     + RPV+ +GP + ++ D LI  YP+ F S V HTTRPKR  E++G DYHF+ ++ Q   D +  LFIE  +YN N YGTS+ +VR V E  +HCI+D +   IK L+   + P+++ I P + +    +    T E+  K
Sbjct:  621 RSLYVRALFDYDPNRDDGLPSRGLPFKHGDILHVTNASDDEWWQARRV--LGDN---EDEQIGIVPSKRRWERKMRARDRSVKFQG-----HAAANNNLDK--------QSTLDRKKKNFTFSRKFPFMKSRDEKNEDGSDQEPFMLCYTQDDANAEGASEENVLSYEAVQRLSINYTRPVIILGPLKDRINDDLISEYPDKFGSCVPHTTRPKREYEVDGRDYHFVSSREQMERDIQNHLFIEAGQYNDNLYGTSVASVREVAEKGKHCILDVSGNAIKRLQVAQLYPVAVFIKPKSVDSVMEMNRRMTEEQAKK 918          
BLAST of Disks large homolog 1 vs. Ensembl Fly
Match: dlg1 (gene:FBgn0001624 transcript:FBtr0073485)

HSP 1 Score: 172.94 bits (437), Expect = 5.406e-46
Identity = 113/372 (30.38%), Postives = 184/372 (49.46%), Query Frame = 1
Query:  340 KSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDE--GIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRKR---------QQATMQQNLTKTDQK-----MSINDF----------------------YEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEKLVKNSMQYSSMLNSKERKSFDVKLKCQNMEEL---VKETFISVTNCQKW 1332
            +S YV+ L +Y+   D  LP +GL F+ G+ILH+ NA+D +WW AR++  L  N    DE  GI+PS  R  +K + ++ SV F+       +  +  LDK         S+LD K+K           ++  ++N   +DQ+      S ++                       YE V+     + RPV+ +GP + ++ D LI  YP+ F S V HTTRPKR  E++G DYHF+ ++ Q   D +  LFIE  +YN N YGTS+ +VR V E  +HCI+D +   IK L+   + P+++ I P + +     M  + +E+  K + + +  +  +  + F   ++   +EE+   VK    S +    W
Sbjct:  601 RSLYVRALFDYDPNRDDGLPSRGLPFKHGDILHVTNASDDEWWQARRV--LGDN---EDEQIGIVPSKRRWERKMRARDRSVKFQG-----HAAANNNLDK--------QSTLDRKKKNFTFSRKFPFMKSRDEKNEDGSDQEPNGVVSSTSEIDINNVNNNQSNEPQPSEENVLSYEAVQRLSINYTRPVIILGPLKDRINDDLISEYPDKFGSCVPHTTRPKREYEVDGRDYHFVSSREQMERDIQNHLFIEAGQYNDNLYGTSVASVREVAEKGKHCILDVSGNAIKRLQVAQLYPVAVFIKPKSVDSVME-MNRRMTEEQAKKTYERAIKMEQEFGEYFTGVVQGDTIEEIYSKVKSMIWSQSGPTIW 953          
BLAST of Disks large homolog 1 vs. Ensembl Zebrafish
Match: dlg3 (discs, large homolog 3 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-050208-93])

HSP 1 Score: 189.889 bits (481), Expect = 3.446e-55
Identity = 107/304 (35.20%), Postives = 164/304 (53.95%), Query Frame = 1
Query:  340 KSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDEGIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRK----RQQATMQQNLTKTDQKMSINDF---------------YEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEK 1194
            +S YV+ L +Y+   D  LP +GLSF  G+ILH+ NA+D +WW AR + P   +      G+IPS  R+ KK + +  +V F  +T +IESN    + +          S +L RK    + +  + Q L +T+Q ++ N                 YE V   +  + RPV+ +GP + ++ D LI  +P+ F S V HTTRP+R NE++G DYHF+ ++ Q   D +   FIE  ++N N YGTS+L+VR V E  +HCI+D +   IK L++  + PI+I I P +      L   QT E+
Sbjct:   19 RSLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGES---EQIGVIPSKKRVEKKERARLKTVKFHARTGMIESNRPVKVKR--------KKSFNLSRKFPFYKSKENIVQELVETEQCLTSNTSDSESSSKGQEDTILSYEPVIRQEIHYTRPVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRENEMDGQDYHFVGSREQMEKDIQDNKFIEAGQFNENLYGTSILSVRAVAERGKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSVEALMELNKRQTYEQ 311          
BLAST of Disks large homolog 1 vs. Ensembl Zebrafish
Match: dlg3 (discs, large homolog 3 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-050208-93])

HSP 1 Score: 189.889 bits (481), Expect = 3.446e-55
Identity = 107/304 (35.20%), Postives = 164/304 (53.95%), Query Frame = 1
Query:  340 KSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDEGIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRK----RQQATMQQNLTKTDQKMSINDF---------------YEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEK 1194
            +S YV+ L +Y+   D  LP +GLSF  G+ILH+ NA+D +WW AR + P   +      G+IPS  R+ KK + +  +V F  +T +IESN    + +          S +L RK    + +  + Q L +T+Q ++ N                 YE V   +  + RPV+ +GP + ++ D LI  +P+ F S V HTTRP+R NE++G DYHF+ ++ Q   D +   FIE  ++N N YGTS+L+VR V E  +HCI+D +   IK L++  + PI+I I P +      L   QT E+
Sbjct:   19 RSLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGES---EQIGVIPSKKRVEKKERARLKTVKFHARTGMIESNRPVKVKR--------KKSFNLSRKFPFYKSKENIVQELVETEQCLTSNTSDSESSSKGQEDTILSYEPVIRQEIHYTRPVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRENEMDGQDYHFVGSREQMEKDIQDNKFIEAGQFNENLYGTSILSVRAVAERGKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSVEALMELNKRQTYEQ 311          
BLAST of Disks large homolog 1 vs. Ensembl Zebrafish
Match: dlg3 (discs, large homolog 3 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-050208-93])

HSP 1 Score: 190.66 bits (483), Expect = 3.737e-52
Identity = 106/297 (35.69%), Postives = 162/297 (54.55%), Query Frame = 1
Query:  340 KSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDEGIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRK----RQQATMQQNLTKTDQKMSIND--------FYEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEK 1194
            +S YV+ L +Y+   D  LP +GLSF  G+ILH+ NA+D +WW AR + P   +      G+IPS  R+ KK + +  +V F  +T +IESN    + +          S +L RK    + +  + Q L +T++K              YE V   +  + RPV+ +GP + ++ D LI  +P+ F S V HTTRP+R NE++G DYHF+ ++ Q   D +   FIE  ++N N YGTS+L+VR V E  +HCI+D +   IK L++  + PI+I I P +      L   QT E+
Sbjct:  520 RSLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGES---EQIGVIPSKKRVEKKERARLKTVKFHARTGMIESNRPVKVKR--------KKSFNLSRKFPFYKSKENIVQELVETERKYERGTRGQEDTILSYEPVIRQEIHYTRPVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRENEMDGQDYHFVGSREQMEKDIQDNKFIEAGQFNENLYGTSILSVRAVAERGKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSVEALMELNKRQTYEQ 805          
BLAST of Disks large homolog 1 vs. Ensembl Zebrafish
Match: dlg3 (discs, large homolog 3 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-050208-93])

HSP 1 Score: 189.504 bits (480), Expect = 1.016e-51
Identity = 107/304 (35.20%), Postives = 164/304 (53.95%), Query Frame = 1
Query:  340 KSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDEGIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRK----RQQATMQQNLTKTDQKMSINDF---------------YEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEK 1194
            +S YV+ L +Y+   D  LP +GLSF  G+ILH+ NA+D +WW AR + P   +      G+IPS  R+ KK + +  +V F  +T +IESN    + +          S +L RK    + +  + Q L +T+Q ++ N                 YE V   +  + RPV+ +GP + ++ D LI  +P+ F S V HTTRP+R NE++G DYHF+ ++ Q   D +   FIE  ++N N YGTS+L+VR V E  +HCI+D +   IK L++  + PI+I I P +      L   QT E+
Sbjct:  508 RSLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGES---EQIGVIPSKKRVEKKERARLKTVKFHARTGMIESNRPVKVKR--------KKSFNLSRKFPFYKSKENIVQELVETEQCLTSNTSDSESSSKGQEDTILSYEPVIRQEIHYTRPVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRENEMDGQDYHFVGSREQMEKDIQDNKFIEAGQFNENLYGTSILSVRAVAERGKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSVEALMELNKRQTYEQ 800          
BLAST of Disks large homolog 1 vs. Ensembl Zebrafish
Match: dlg3 (discs, large homolog 3 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-050208-93])

HSP 1 Score: 189.504 bits (480), Expect = 1.318e-51
Identity = 107/304 (35.20%), Postives = 164/304 (53.95%), Query Frame = 1
Query:  340 KSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDEGIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRK----RQQATMQQNLTKTDQKMSINDF---------------YEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEK 1194
            +S YV+ L +Y+   D  LP +GLSF  G+ILH+ NA+D +WW AR + P   +      G+IPS  R+ KK + +  +V F  +T +IESN    + +          S +L RK    + +  + Q L +T+Q ++ N                 YE V   +  + RPV+ +GP + ++ D LI  +P+ F S V HTTRP+R NE++G DYHF+ ++ Q   D +   FIE  ++N N YGTS+L+VR V E  +HCI+D +   IK L++  + PI+I I P +      L   QT E+
Sbjct:  526 RSLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGES---EQIGVIPSKKRVEKKERARLKTVKFHARTGMIESNRPVKVKR--------KKSFNLSRKFPFYKSKENIVQELVETEQCLTSNTSDSESSSKGQEDTILSYEPVIRQEIHYTRPVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRENEMDGQDYHFVGSREQMEKDIQDNKFIEAGQFNENLYGTSILSVRAVAERGKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSVEALMELNKRQTYEQ 818          
BLAST of Disks large homolog 1 vs. Ensembl Xenopus
Match: hmmr (hyaluronan-mediated motility receptor (RHAMM) [Source:Xenbase;Acc:XB-GENE-5851601])

HSP 1 Score: 184.111 bits (466), Expect = 4.770e-50
Identity = 104/290 (35.86%), Postives = 158/290 (54.48%), Query Frame = 1
Query:  340 KSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDEGIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRKRQ--QATMQQNLTKTDQKMSINDFYEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEKLVK 1203
            +S YV+ L +Y+   D  LP +GLSF  G+ILH+ NA+D +WW AR + P   +      G+IPS  R+ KK + +  +V F         +G   +D   S  +    S  L RK    ++ +Q N T   Q+ +I   YE V   +  + RPV+ +GP + ++ D LI  +P+ F S V HTTRP+R NE++G DYHF+ ++ Q   D +   FIE  ++N N YGTS+ +VR V E  +HCI+D +   IK L++  + PI+I I P +      +   QT E+  K
Sbjct:  423 RSLYVRALFDYDRSRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGES---EQIGVIPSKKRVEKKERARLKTVKF---------HGRSGIDSNRSIKSKRKKSFRLSRKFPFYKSLVQDNSTAQGQEDTILS-YEPVTRQEIHYARPVIILGPLKDRVNDDLISEFPHKFGSCVPHTTRPRRENEMDGQDYHFVGSREQMEKDIQENKFIEAGQFNDNLYGTSVQSVRAVAERGKHCILDVSGNAIKRLQQAQLFPIAIFIKPKSIEALMEMNRRQTFEQAQK 699          
BLAST of Disks large homolog 1 vs. Ensembl Xenopus
Match: hjv (hemojuvelin BMP co-receptor [Source:Xenbase;Acc:XB-GENE-922976])

HSP 1 Score: 178.333 bits (451), Expect = 1.018e-47
Identity = 113/343 (32.94%), Postives = 180/343 (52.48%), Query Frame = 1
Query:  298 MRDGINAIAIDDKIKSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDE-GIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRKRQQATMQQNLTKTDQKMSINDFYEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEKLVKNSMQYSSMLNSKE-RKSFDVKLKCQNMEELVKETFISVTN 1320
            M  G  ++  + K +S YV+ + +Y    D  LP +GLSF  G+ILH+ NA+D +WW AR++    T    S+E G+IPS  R+ +K + +  +V F  K  +I+S GS   +     S   S      + + Q   + +  +  Q+  I   YE V   +  + RPV+ +GP + ++ D LI  +P+ F S V HTTRPKR  E++G DYHF+ ++ Q   D +   FIE  +YN N YGTS+ +V+ V E  +HCI+D +   IK L+   + PI+I + P                K V++ M+ S  L  ++ +K+FD  LK   +E+   E F ++  
Sbjct:  468 MSSGSGSLRTNQK-RSLYVRAMFDYEKSKDSGLPSQGLSFRYGDILHVINASDDEWWQARRV----TQDGDSEEMGVIPSKRRVERKERARLKTVKFNAKPGVIDSRGS--FNDKRKKSFIFSRKFPFFKNKDQTEQETSDPERGQEDCILS-YEPVTRQEINYTRPVIILGPMKDRVNDDLISEFPDKFGSCVPHTTRPKRDYEMDGRDYHFVASREQMEKDIQEHKFIEAGQYNDNLYGTSVQSVKFVAERGKHCILDVSGNAIKRLQVAQLYPIAIFLKP----------------KSVESLMEISKRLTEEQAKKTFDRALK---LEQEFGEFFTAIVQ 783          
BLAST of Disks large homolog 1 vs. Ensembl Xenopus
Match: hjv (hemojuvelin BMP co-receptor [Source:Xenbase;Acc:XB-GENE-922976])

HSP 1 Score: 178.333 bits (451), Expect = 1.306e-47
Identity = 113/342 (33.04%), Postives = 180/342 (52.63%), Query Frame = 1
Query:  298 MRDGINAIAIDDKIKSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDE-GIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRKRQQATMQQNLTKTDQKMSINDFYEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEKLVKNSMQYSSMLNSKE-RKSFDVKLKCQNMEELVKETFISVT 1317
            M  G  ++  + K +S YV+ + +Y    D  LP +GLSF  G+ILH+ NA+D +WW AR++    T    S+E G+IPS  R+ +K + +  +V F  K  +I+S GS   +     S   S      + + Q   + +  +  Q+  I   YE V   +  + RPV+ +GP + ++ D LI  +P+ F S V HTTRPKR  E++G DYHF+ ++ Q   D +   FIE  +YN N YGTS+ +V+ V E  +HCI+D +   IK L+   + PI+I + P                K V++ M+ S  L  ++ +K+FD  LK   +E+   E F ++ 
Sbjct:  567 MSSGSGSLRTNQK-RSLYVRAMFDYEKSKDSGLPSQGLSFRYGDILHVINASDDEWWQARRV----TQDGDSEEMGVIPSKRRVERKERARLKTVKFNAKPGVIDSRGS--FNDKRKKSFIFSRKFPFFKNKDQTEQETSDPERGQEDCILS-YEPVTRQEINYTRPVIILGPMKDRVNDDLISEFPDKFGSCVPHTTRPKRDYEMDGRDYHFVASREQMEKDIQEHKFIEAGQYNDNLYGTSVQSVKFVAERGKHCILDVSGNAIKRLQVAQLYPIAIFLKP----------------KSVESLMEISKRLTEEQAKKTFDRALK---LEQEFGEFFTAIV 881          
BLAST of Disks large homolog 1 vs. Ensembl Xenopus
Match: hjv (hemojuvelin BMP co-receptor [Source:Xenbase;Acc:XB-GENE-922976])

HSP 1 Score: 177.948 bits (450), Expect = 1.337e-47
Identity = 113/343 (32.94%), Postives = 180/343 (52.48%), Query Frame = 1
Query:  298 MRDGINAIAIDDKIKSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDE-GIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRKRQQATMQQNLTKTDQKMSINDFYEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEKLVKNSMQYSSMLNSKE-RKSFDVKLKCQNMEELVKETFISVTN 1320
            M  G  ++  + K +S YV+ + +Y    D  LP +GLSF  G+ILH+ NA+D +WW AR++    T    S+E G+IPS  R+ +K + +  +V F  K  +I+S GS   +     S   S      + + Q   + +  +  Q+  I   YE V   +  + RPV+ +GP + ++ D LI  +P+ F S V HTTRPKR  E++G DYHF+ ++ Q   D +   FIE  +YN N YGTS+ +V+ V E  +HCI+D +   IK L+   + PI+I + P                K V++ M+ S  L  ++ +K+FD  LK   +E+   E F ++  
Sbjct:  507 MSSGSGSLRTNQK-RSLYVRAMFDYEKSKDSGLPSQGLSFRYGDILHVINASDDEWWQARRV----TQDGDSEEMGVIPSKRRVERKERARLKTVKFNAKPGVIDSRGS--FNDKRKKSFIFSRKFPFFKNKDQTEQETSDPERGQEDCILS-YEPVTRQEINYTRPVIILGPMKDRVNDDLISEFPDKFGSCVPHTTRPKRDYEMDGRDYHFVASREQMEKDIQEHKFIEAGQYNDNLYGTSVQSVKFVAERGKHCILDVSGNAIKRLQVAQLYPIAIFLKP----------------KSVESLMEISKRLTEEQAKKTFDRALK---LEQEFGEFFTAIVQ 822          
BLAST of Disks large homolog 1 vs. Ensembl Xenopus
Match: hjv (hemojuvelin BMP co-receptor [Source:Xenbase;Acc:XB-GENE-922976])

HSP 1 Score: 178.333 bits (451), Expect = 1.429e-47
Identity = 113/342 (33.04%), Postives = 180/342 (52.63%), Query Frame = 1
Query:  298 MRDGINAIAIDDKIKSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDE-GIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRKRQQATMQQNLTKTDQKMSINDFYEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEKLVKNSMQYSSMLNSKE-RKSFDVKLKCQNMEELVKETFISVT 1317
            M  G  ++  + K +S YV+ + +Y    D  LP +GLSF  G+ILH+ NA+D +WW AR++    T    S+E G+IPS  R+ +K + +  +V F  K  +I+S GS   +     S   S      + + Q   + +  +  Q+  I   YE V   +  + RPV+ +GP + ++ D LI  +P+ F S V HTTRPKR  E++G DYHF+ ++ Q   D +   FIE  +YN N YGTS+ +V+ V E  +HCI+D +   IK L+   + PI+I + P                K V++ M+ S  L  ++ +K+FD  LK   +E+   E F ++ 
Sbjct:  524 MSSGSGSLRTNQK-RSLYVRAMFDYEKSKDSGLPSQGLSFRYGDILHVINASDDEWWQARRV----TQDGDSEEMGVIPSKRRVERKERARLKTVKFNAKPGVIDSRGS--FNDKRKKSFIFSRKFPFFKNKDQTEQETSDPERGQEDCILS-YEPVTRQEINYTRPVIILGPMKDRVNDDLISEFPDKFGSCVPHTTRPKRDYEMDGRDYHFVASREQMEKDIQEHKFIEAGQYNDNLYGTSVQSVKFVAERGKHCILDVSGNAIKRLQVAQLYPIAIFLKP----------------KSVESLMEISKRLTEEQAKKTFDRALK---LEQEFGEFFTAIV 838          
BLAST of Disks large homolog 1 vs. Ensembl Mouse
Match: Dlg3 (discs large MAGUK scaffold protein 3 [Source:MGI Symbol;Acc:MGI:1888986])

HSP 1 Score: 185.652 bits (470), Expect = 4.600e-52
Identity = 106/304 (34.87%), Postives = 160/304 (52.63%), Query Frame = 1
Query:  340 KSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDEGIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRK----RQQATMQQNLTKTDQKMSINDF---------------YEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEK 1194
            +S YV+ L +Y+   D  LP +GLSF  G+ILH+ NA+D +WW AR + P   +      G+IPS  R+ KK + +  +V F  +T +IESN         S  T    S  L RK    + +  M Q  +  +Q ++ N                 YE V   +  + RPV+ +GP + ++ D LI  +P+ F S V HTTRP+R NE++G DYHF+ ++ Q   D +   FIE  ++N N YGTS+ +VR V E  +HCI+D +   IK L++  + PI+I I P +      +   QT E+
Sbjct:  165 RSLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGES---EQIGVIPSKKRVEKKERARLKTVKFHARTGMIESN--------RSIKTKRKKSFRLSRKFPFYKSKENMAQENSIQEQGVTSNTSDSESSSKGQEDAILSYEPVTRQEIHYARPVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQDNKFIEAGQFNDNLYGTSIQSVRAVAERGKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSIEALMEMNRRQTYEQ 457          
BLAST of Disks large homolog 1 vs. Ensembl Mouse
Match: Dlg1 (discs large MAGUK scaffold protein 1 [Source:MGI Symbol;Acc:MGI:107231])

HSP 1 Score: 184.111 bits (466), Expect = 7.405e-50
Identity = 114/332 (34.34%), Postives = 178/332 (53.61%), Query Frame = 1
Query:  340 KSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDE-GIIPSANRLYKKHQNKEMSVNFEEKTI-----IIESNGSQTLDKINSGSTPGSSSLDLKRKRQQATMQQNLTKTDQKMSINDFYEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEKLVKNSMQYSSMLNSKE-RKSFDVKLKCQNMEELVKETFISV 1314
            +S YV+ L +Y+   D  LP +GL+F  G+ILH+ NA+D +WW AR++ P       SDE G+IPS  R+ KK + +  +V F  KT      I +  GS+ L  + S ++   SS  +       T +   +K  Q+  +   YE V   +  + RPV+ +GP + ++ D LI  +P+ F S V HTTRPKR  E++G DYHF+ ++ Q   D +   FIE  +YN + YGTS+ +VR V E  +HCI+D +   IK L+   + PISI I P                K ++N M+ +  L  ++ RK+F+  +K   +E+   E F ++
Sbjct:  499 RSLYVRALFDYDKTKDSGLPSQGLNFRFGDILHVINASDDEWWQARQVTPDGE----SDEVGVIPSKRRVEKKERARLKTVKFNSKTRGDKGEIPDDMGSKGLKHVTSNASDSESSYLI-----LITDEYGCSKGGQEEYVLS-YEPVNQQEVNYTRPVIILGPMKDRVNDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVRAVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKP----------------KSMENIMEMNKRLTEEQARKTFERAMK---LEQEFTEHFTAI 801          
BLAST of Disks large homolog 1 vs. Ensembl Mouse
Match: Dlg1 (discs large MAGUK scaffold protein 1 [Source:MGI Symbol;Acc:MGI:107231])

HSP 1 Score: 183.726 bits (465), Expect = 1.290e-49
Identity = 112/333 (33.63%), Postives = 175/333 (52.55%), Query Frame = 1
Query:  340 KSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDE-GIIPSANRLYKKHQNKEMSVNFEEKTI-----IIESNGSQTLDKINSGSTPGSSSLDLKRKRQQATMQQNLTKTDQKMSINDFYEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEKLVKNSMQYSSMLNSKE-RKSFDVKLKCQNMEELVKETFISVT 1317
            +S YV+ L +Y+   D  LP +GL+F  G+ILH+ NA+D +WW AR++ P       SDE G+IPS  R+ KK + +  +V F  KT      I +  GS+ L  + S ++   SS    R +++  +                YE V   +  + RPV+ +GP + ++ D LI  +P+ F S V HTTRPKR  E++G DYHF+ ++ Q   D +   FIE  +YN + YGTS+ +VR V E  +HCI+D +   IK L+   + PISI I P                K ++N M+ +  L  ++ RK+F+  +K   +E+   E F ++ 
Sbjct:  549 RSLYVRALFDYDKTKDSGLPSQGLNFRFGDILHVINASDDEWWQARQVTPDGE----SDEVGVIPSKRRVEKKERARLKTVKFNSKTRGDKGEIPDDMGSKGLKHVTSNASDSESSY---RGQEEYVLS---------------YEPVNQQEVNYTRPVIILGPMKDRVNDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVRAVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKP----------------KSMENIMEMNKRLTEEQARKTFERAMK---LEQEFTEHFTAIV 840          
BLAST of Disks large homolog 1 vs. Ensembl Mouse
Match: Dlg1 (discs large MAGUK scaffold protein 1 [Source:MGI Symbol;Acc:MGI:107231])

HSP 1 Score: 183.341 bits (464), Expect = 1.837e-49
Identity = 113/332 (34.04%), Postives = 176/332 (53.01%), Query Frame = 1
Query:  340 KSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDE-GIIPSANRLYKKHQNKEMSVNFEEKTI-----IIESNGSQTLDKINSGSTPGSSSLDLKRKRQQATMQQNLTKTDQKMSINDFYEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEKLVKNSMQYSSMLNSKE-RKSFDVKLKCQNMEELVKETFISV 1314
            +S YV+ L +Y+   D  LP +GL+F  G+ILH+ NA+D +WW AR++ P       SDE G+IPS  R+ KK + +  +V F  KT      I +  GS+ L  + S ++   SS            +   +K  Q+  +   YE V   +  + RPV+ +GP + ++ D LI  +P+ F S V HTTRPKR  E++G DYHF+ ++ Q   D +   FIE  +YN + YGTS+ +VR V E  +HCI+D +   IK L+   + PISI I P                K ++N M+ +  L  ++ RK+F+  +K   +E+   E F ++
Sbjct:  582 RSLYVRALFDYDKTKDSGLPSQGLNFRFGDILHVINASDDEWWQARQVTPDGE----SDEVGVIPSKRRVEKKERARLKTVKFNSKTRGDKGEIPDDMGSKGLKHVTSNASDSESSY----------HEYGCSKGGQEEYVLS-YEPVNQQEVNYTRPVIILGPMKDRVNDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVRAVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKP----------------KSMENIMEMNKRLTEEQARKTFERAMK---LEQEFTEHFTAI 879          
BLAST of Disks large homolog 1 vs. Ensembl Mouse
Match: Dlg1 (discs large MAGUK scaffold protein 1 [Source:MGI Symbol;Acc:MGI:107231])

HSP 1 Score: 183.341 bits (464), Expect = 2.273e-49
Identity = 112/332 (33.73%), Postives = 175/332 (52.71%), Query Frame = 1
Query:  340 KSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDE-GIIPSANRLYKKHQNKEMSVNFEEKTI-----IIESNGSQTLDKINSGSTPGSSSLDLKRKRQQATMQQNLTKTDQKMSINDFYEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEKLVKNSMQYSSMLNSKE-RKSFDVKLKCQNMEELVKETFISV 1314
            +S YV+ L +Y+   D  LP +GL+F  G+ILH+ NA+D +WW AR++ P       SDE G+IPS  R+ KK + +  +V F  KT      I +  GS+ L  + S ++   SS    R +++  +                YE V   +  + RPV+ +GP + ++ D LI  +P+ F S V HTTRPKR  E++G DYHF+ ++ Q   D +   FIE  +YN + YGTS+ +VR V E  +HCI+D +   IK L+   + PISI I P                K ++N M+ +  L  ++ RK+F+  +K   +E+   E F ++
Sbjct:  582 RSLYVRALFDYDKTKDSGLPSQGLNFRFGDILHVINASDDEWWQARQVTPDGE----SDEVGVIPSKRRVEKKERARLKTVKFNSKTRGDKGEIPDDMGSKGLKHVTSNASDSESSY---RGQEEYVLS---------------YEPVNQQEVNYTRPVIILGPMKDRVNDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVRAVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKP----------------KSMENIMEMNKRLTEEQARKTFERAMK---LEQEFTEHFTAI 872          
BLAST of Disks large homolog 1 vs. UniProt/SwissProt
Match: sp|Q12959|DLG1_HUMAN (Disks large homolog 1 OS=Homo sapiens OX=9606 GN=DLG1 PE=1 SV=2)

HSP 1 Score: 183.726 bits (465), Expect = 9.082e-49
Identity = 112/332 (33.73%), Postives = 176/332 (53.01%), Query Frame = 1
Query:  340 KSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDE-GIIPSANRLYKKHQNKEMSVNFEEKTI----IIESNGSQTLDKINSGSTPGSSSLDLKRKRQQATMQQNLTKTDQKMSINDFYEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEKLVKNSMQYSSMLNSKE-RKSFDVKLKCQNMEELVKETFISVT 1317
            +S YV+ L +Y+   D  LP +GL+F+ G+ILH+ NA+D +WW AR++ P       SDE G+IPS  R+ KK + +  +V F  KT     I +  GS+ L  + S ++   SS    R +++  +                YE V   +  + RPV+ +GP + ++ D LI  +P+ F S V HTTRPKR  E++G DYHF+ ++ Q   D +   FIE  +YN + YGTS+ +VR V E  +HCI+D +   IK L+   + PISI I P                K ++N M+ +  L  ++ RK+F+  +K   +E+   E F ++ 
Sbjct:  582 RSLYVRALFDYDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGE----SDEVGVIPSKRRVEKKERARLKTVKFNSKTRDKGEIPDDMGSKGLKHVTSNASDSESSY---RGQEEYVLS---------------YEPVNQQEVNYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVREVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKP----------------KSMENIMEMNKRLTEEQARKTFERAMK---LEQEFTEHFTAIV 872          
BLAST of Disks large homolog 1 vs. UniProt/SwissProt
Match: sp|Q811D0|DLG1_MOUSE (Disks large homolog 1 OS=Mus musculus OX=10090 GN=Dlg1 PE=1 SV=1)

HSP 1 Score: 183.341 bits (464), Expect = 1.590e-48
Identity = 112/332 (33.73%), Postives = 175/332 (52.71%), Query Frame = 1
Query:  340 KSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDE-GIIPSANRLYKKHQNKEMSVNFEEKTI-----IIESNGSQTLDKINSGSTPGSSSLDLKRKRQQATMQQNLTKTDQKMSINDFYEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEKLVKNSMQYSSMLNSKE-RKSFDVKLKCQNMEELVKETFISV 1314
            +S YV+ L +Y+   D  LP +GL+F  G+ILH+ NA+D +WW AR++ P       SDE G+IPS  R+ KK + +  +V F  KT      I +  GS+ L  + S ++   SS    R +++  +                YE V   +  + RPV+ +GP + ++ D LI  +P+ F S V HTTRPKR  E++G DYHF+ ++ Q   D +   FIE  +YN + YGTS+ +VR V E  +HCI+D +   IK L+   + PISI I P                K ++N M+ +  L  ++ RK+F+  +K   +E+   E F ++
Sbjct:  582 RSLYVRALFDYDKTKDSGLPSQGLNFRFGDILHVINASDDEWWQARQVTPDGE----SDEVGVIPSKRRVEKKERARLKTVKFNSKTRGDKGEIPDDMGSKGLKHVTSNASDSESSY---RGQEEYVLS---------------YEPVNQQEVNYTRPVIILGPMKDRVNDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVRAVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKP----------------KSMENIMEMNKRLTEEQARKTFERAMK---LEQEFTEHFTAI 872          
BLAST of Disks large homolog 1 vs. UniProt/SwissProt
Match: sp|Q62696|DLG1_RAT (Disks large homolog 1 OS=Rattus norvegicus OX=10116 GN=Dlg1 PE=1 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 2.385e-48
Identity = 112/333 (33.63%), Postives = 177/333 (53.15%), Query Frame = 1
Query:  340 KSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDE-GIIPSANRLYKKHQNKEMSVNFEEKTI-----IIESNGSQTLDKINSGSTPGSSSLDLKRKRQQATMQQNLTKTDQKMSINDFYEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEKLVKNSMQYSSMLNSKE-RKSFDVKLKCQNMEELVKETFISVT 1317
            +S YV+ L +Y+   D  LP +GL+F+ G+ILH+ NA+D +WW AR++ P       SDE G+IPS  R+ KK + +  +V F  KT      I +  GS+ L  + S ++   SS            +   +K  Q+  +   YE V   +  + RPV+ +GP + ++ D LI  +P+ F S V HTTRPKR  E++G DYHF+ ++ Q   D +   FIE  +YN + YGTS+ +VR V E  +HCI+D +   IK L+   + PISI I P                K ++N M+ +  L  ++ RK+F+  ++   +E+   E F ++ 
Sbjct:  581 RSLYVRALFDYDKTKDSGLPSQGLNFKFGDILHVINASDDEWWQARQVTPDGE----SDEVGVIPSKRRVEKKERARLKTVKFNSKTRGDKGEIPDDMGSKGLKHVTSNASDSESSY----------HEYGCSKGGQEEYVLS-YEPVNQQEVNYTRPVIILGPMKDRVNDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVTSREQMEKDIQEHKFIEAGQYNNHLYGTSVQSVRAVAEKGKHCILDVSGNAIKRLQIAQLYPISIFIKP----------------KSMENIMEMNKRLTDEQARKTFERAVR---LEQEFTEHFTAIV 879          
BLAST of Disks large homolog 1 vs. UniProt/SwissProt
Match: sp|P70175|DLG3_MOUSE (Disks large homolog 3 OS=Mus musculus OX=10090 GN=Dlg3 PE=1 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 3.281e-48
Identity = 102/291 (35.05%), Postives = 151/291 (51.89%), Query Frame = 1
Query:  340 KSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDEGIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRKRQQATMQQNLTKTDQKMSINDF---YEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEKLVK 1203
            +S YV+ L +Y+   D  LP +GLSF  G+ILH+ NA+D +WW AR + P   +      G+IPS  R+ KK + +  +V F  +T +IESN             PG S      K  +                 D    YE V   +  + RPV+ +GP + ++ D LI  +P+ F S V HTTRP+R NE++G DYHF+ ++ Q   D +   FIE  ++N N YGTS+ +VR V E  +HCI+D +   IK L++  + PI+I I P +      +   QT E+  K
Sbjct:  520 RSLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGES---EQIGVIPSKKRVEKKERARLKTVKFHARTGMIESNRD----------FPGLSDDYYGAKNLKGVTSNTSDSESSSKGQEDAILSYEPVTRQEIHYARPVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQDNKFIEAGQFNDNLYGTSIQSVRAVAERGKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSIEALMEMNRRQTYEQANK 797          
BLAST of Disks large homolog 1 vs. UniProt/SwissProt
Match: sp|Q62936|DLG3_RAT (Disks large homolog 3 OS=Rattus norvegicus OX=10116 GN=Dlg3 PE=1 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 3.579e-48
Identity = 102/291 (35.05%), Postives = 151/291 (51.89%), Query Frame = 1
Query:  340 KSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDEGIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRKRQQATMQQNLTKTDQKMSINDF---YEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEKLVK 1203
            +S YV+ L +Y+   D  LP +GLSF  G+ILH+ NA+D +WW AR + P   +      G+IPS  R+ KK + +  +V F  +T +IESN             PG S      K  +                 D    YE V   +  + RPV+ +GP + ++ D LI  +P+ F S V HTTRP+R NE++G DYHF+ ++ Q   D +   FIE  ++N N YGTS+ +VR V E  +HCI+D +   IK L++  + PI+I I P +      +   QT E+  K
Sbjct:  520 RSLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGES---EQIGVIPSKKRVEKKERARLKTVKFHARTGMIESNRD----------FPGLSDDYYGAKNLKGVTSNTSDSESSSKGQEDAILSYEPVTRQEIHYARPVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQDNKFIEAGQFNDNLYGTSIQSVRAVAERGKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSIEALMEMNRRQTYEQANK 797          
BLAST of Disks large homolog 1 vs. TrEMBL
Match: A0A1A8RLL8 (Discs, large homolog 3 (Fragment) OS=Nothobranchius rachovii OX=451742 GN=DLG3 PE=4 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 1.280e-52
Identity = 117/351 (33.33%), Postives = 184/351 (52.42%), Query Frame = 1
Query:  298 MRDGINAIAIDDKIKSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDEGIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRK----RQQATMQQNLTKTDQKMSINDF---------------YEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKR-HCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEKLVKNSMQYSSMLNSKERKSFDVKLKCQNMEEL 1290
            M  G  ++   +K +S YV+ L EY+   D  LP +GLSF  G ILH+ NA+D +WW AR + P   +      G+IPS  R+ KK + +  +V F  +T +IESN +  + +          S +L RK    + +  + Q L +++Q ++ N                 YE V   +  + RPV+ +GP + ++ D LI  +P+ F S V HTTRP+R NEI+G DYHF+ ++ Q   D +   FIE  ++N N YGTS+L+VR V E +R HCI+D +   IK L++  + PI+I I P +      +   QT E+  K     +  L     + F   ++C ++EE+
Sbjct:    2 MSSGSGSLRTSEK-RSLYVRALFEYDRTRDSCLPSQGLSFTYGNILHVINASDDEWWQARLVTPHGES---EQIGVIPSKKRVEKKERARLKTVKFHGRTGMIESNRTVRVKR--------KKSFNLSRKFPFYKSKENIVQELVESEQCLTSNTSDSESSSKGQEDTILSYEPVIRQEIHYTRPVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRENEIDGQDYHFVGSREQMEKDIQDNKFIEAGQFNENLYGTSILSVRTVAERQRKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSIEALMEMNKRQTYEQATK-VFDKAVKLEQDFGEYFTAIVQCDSLEEI 339          
BLAST of Disks large homolog 1 vs. TrEMBL
Match: A0A212C0V1 (DLG3 OS=Cervus elaphus hippelaphus OX=46360 GN=Celaphus_00009871 PE=4 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 1.436e-52
Identity = 105/290 (36.21%), Postives = 160/290 (55.17%), Query Frame = 1
Query:  340 KSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDEGIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRKRQQATMQQNLTK--TDQKMSINDF---YEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEK 1194
            +S YV+ L +Y+   D  LP +GLSF  G+ILH+ NA+D +WW AR + P   +      G+IPS  R+ KK + +  +V F  +T +IESN         S  T    S  L RK      ++N+ +  + Q+    D    YE V   +  + RPV+ +GP + ++ D LI  +P+ F S V HTTRP+R NE++G DYHF+ ++ Q   D +   FIE  ++N N YGTS+ +VR V E  +HCI+D +   IK L+++ + PI+I I P +      +   QT E+
Sbjct:   18 RSLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGES---EQIGVIPSKKRVEKKERARLKTVKFHARTGMIESN--------RSIKTKRKKSFRLSRKFPFYKSKENMAQESSGQEQGQEDAILSYEPVTRQEIHYARPVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQDNKFIEAGQFNDNLYGTSIQSVRAVAERGKHCILDVSGNAIKRLQQSQLYPIAIFIKPKSIEALMEMNRRQTYEQ 296          
BLAST of Disks large homolog 1 vs. TrEMBL
Match: A0A3Q2ZLD4 (Discs, large homolog 3 (Drosophila) OS=Kryptolebias marmoratus OX=37003 PE=4 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 1.688e-52
Identity = 107/304 (35.20%), Postives = 165/304 (54.28%), Query Frame = 1
Query:  340 KSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDEGIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRK----RQQATMQQNLTKTDQKMSINDF---------------YEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEK 1194
            +S YV+ L EY+   D  LP +GLSF  G+ILH+ NA+D +WW AR + P   +      G+IPS  R+ KK + +  +V F  +T +IESN +  + +          S +L RK    + +  + Q+L + +Q ++ N                 YE V   +  + RPV+ +GP + ++ D LI  +P+ F S V HTTRP+R NEI+G DYHF+ ++ Q   D +   FIE  ++N N YGTS+L+VR V E  +HCI+D +   IK L++  + PI+I I P +      +   QT E+
Sbjct:   19 RSLYVRALFEYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGES---EQIGVIPSKKRVEKKERARLKTVKFHARTGMIESNRTVKVKR--------KKSFNLSRKFPFYKSKENIAQDLVEPEQCLTSNTSDSESSSKGQEDTILSYEPVIRQEIHYTRPVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRENEIDGQDYHFVGSREQMEKDIQDNKFIEAGQFNENLYGTSILSVRTVAERGKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSIEALMEMNKRQTYEQ 311          
BLAST of Disks large homolog 1 vs. TrEMBL
Match: A5PKT0 (Discs, large homolog 3 (Drosophila) OS=Danio rerio OX=7955 GN=dlg3 PE=1 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 7.710e-52
Identity = 107/304 (35.20%), Postives = 164/304 (53.95%), Query Frame = 1
Query:  340 KSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDEGIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRK----RQQATMQQNLTKTDQKMSINDF---------------YEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEK 1194
            +S YV+ L +Y+   D  LP +GLSF  G+ILH+ NA+D +WW AR + P   +      G+IPS  R+ KK + +  +V F  +T +IESN    + +          S +L RK    + +  + Q L +T+Q ++ N                 YE V   +  + RPV+ +GP + ++ D LI  +P+ F S V HTTRP+R NE++G DYHF+ ++ Q   D +   FIE  ++N N YGTS+L+VR V E  +HCI+D +   IK L++  + PI+I I P +      L   QT E+
Sbjct:   19 RSLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGES---EQIGVIPSKKRVEKKERARLKTVKFHARTGMIESNRPVKVKR--------KKSFNLSRKFPFYKSKENIVQELVETEQCLTSNTSDSESSSKGQEDTILSYEPVIRQEIHYTRPVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRENEMDGQDYHFVGSREQMEKDIQDNKFIEAGQFNENLYGTSILSVRAVAERGKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSVEALMELNKRQTYEQ 311          
BLAST of Disks large homolog 1 vs. TrEMBL
Match: A0A3B4CMR9 (Discs, large homolog 3 (Drosophila) OS=Pygocentrus nattereri OX=42514 PE=4 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 7.874e-52
Identity = 106/304 (34.87%), Postives = 164/304 (53.95%), Query Frame = 1
Query:  340 KSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDEGIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRK----RQQATMQQNLTKTDQKMSINDF---------------YEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEK 1194
            +S YV+ L +Y+   D  LP +GLSF  G+ILH+ NA+D +WW AR + P   +      G+IPS  R+ KK + +  +V F  +T +IESN    + +          S +L RK    + +  + Q L +++Q ++ N                 YE V   +  + RPV+ +GP + ++ D LI  +P+ F S V HTTRP+R NE++G DYHF+ ++ Q   D +   FIE  ++N N YGTS+L+VR V E  +HCI+D +   IK L++  + PISI I P +      +   QT E+
Sbjct:   19 RSLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGES---EQIGVIPSKKRVEKKERARLKTVKFHARTGMIESNRPVKVKR--------KKSFNLSRKFPFYKSKENIVQELVESEQCLTSNTSDSESSSKGQEDTILSYEPVTRQEIHYTRPVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRENEMDGQDYHFVSSREQMEKDIQDNKFIEAGQFNENLYGTSILSVRAVAERGKHCILDVSGNAIKRLQQAQLYPISIFIKPKSIEALMEMNKRQTYEQ 311          
BLAST of Disks large homolog 1 vs. Ensembl Cavefish
Match: dlg3 (discs, large homolog 3 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-050208-93])

HSP 1 Score: 189.119 bits (479), Expect = 1.028e-51
Identity = 106/304 (34.87%), Postives = 164/304 (53.95%), Query Frame = 1
Query:  340 KSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDEGIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRK----RQQATMQQNLTKTDQKMSINDF---------------YEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEK 1194
            +S YV+ L +Y+   D  LP +GLSF  G+ILH+ NA+D +WW AR + P   +      G+IPS  R+ KK + +  +V F  +T +IESN    + +          S +L RK    + +  + Q L +++Q ++ N                 YE V   +  + RPV+ +GP + ++ D LI  +P+ F S V HTTRP+R NE++G DYHF+ ++ Q   D +   FIE  ++N N YGTS+L+VR V E  +HCI+D +   IK L++  + PISI I P +      +   QT E+
Sbjct:  496 RSLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGES---EQIGVIPSKKRVEKKERARLKTVKFHARTGMIESNRPVKVKR--------KKSFNLSRKFPFYKSKENIVQELVESEQCLTSNTSDSESSSKGQEDTILSYEPVIRQEIHYTRPVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRENEMDGQDYHFVASREQMEKDIQDNKFIEAGQFNENLYGTSILSVRAVAERGKHCILDVSGNAIKRLQQAQLYPISIFIKPKSIEALMEMNKRQTYEQ 788          
BLAST of Disks large homolog 1 vs. Ensembl Cavefish
Match: dlg3 (discs, large homolog 3 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-050208-93])

HSP 1 Score: 189.119 bits (479), Expect = 1.084e-51
Identity = 106/304 (34.87%), Postives = 164/304 (53.95%), Query Frame = 1
Query:  340 KSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDEGIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRK----RQQATMQQNLTKTDQKMSINDF---------------YEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEK 1194
            +S YV+ L +Y+   D  LP +GLSF  G+ILH+ NA+D +WW AR + P   +      G+IPS  R+ KK + +  +V F  +T +IESN    + +          S +L RK    + +  + Q L +++Q ++ N                 YE V   +  + RPV+ +GP + ++ D LI  +P+ F S V HTTRP+R NE++G DYHF+ ++ Q   D +   FIE  ++N N YGTS+L+VR V E  +HCI+D +   IK L++  + PISI I P +      +   QT E+
Sbjct:  471 RSLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGES---EQIGVIPSKKRVEKKERARLKTVKFHARTGMIESNRPVKVKR--------KKSFNLSRKFPFYKSKENIVQELVESEQCLTSNTSDSESSSKGQEDTILSYEPVIRQEIHYTRPVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRENEMDGQDYHFVASREQMEKDIQDNKFIEAGQFNENLYGTSILSVRAVAERGKHCILDVSGNAIKRLQQAQLYPISIFIKPKSIEALMEMNKRQTYEQ 763          
BLAST of Disks large homolog 1 vs. Ensembl Cavefish
Match: dlg3 (discs, large homolog 3 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-050208-93])

HSP 1 Score: 189.119 bits (479), Expect = 1.377e-51
Identity = 106/304 (34.87%), Postives = 164/304 (53.95%), Query Frame = 1
Query:  340 KSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDEGIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRK----RQQATMQQNLTKTDQKMSINDF---------------YEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEK 1194
            +S YV+ L +Y+   D  LP +GLSF  G+ILH+ NA+D +WW AR + P   +      G+IPS  R+ KK + +  +V F  +T +IESN    + +          S +L RK    + +  + Q L +++Q ++ N                 YE V   +  + RPV+ +GP + ++ D LI  +P+ F S V HTTRP+R NE++G DYHF+ ++ Q   D +   FIE  ++N N YGTS+L+VR V E  +HCI+D +   IK L++  + PISI I P +      +   QT E+
Sbjct:  515 RSLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGES---EQIGVIPSKKRVEKKERARLKTVKFHARTGMIESNRPVKVKR--------KKSFNLSRKFPFYKSKENIVQELVESEQCLTSNTSDSESSSKGQEDTILSYEPVIRQEIHYTRPVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRENEMDGQDYHFVASREQMEKDIQDNKFIEAGQFNENLYGTSILSVRAVAERGKHCILDVSGNAIKRLQQAQLYPISIFIKPKSIEALMEMNKRQTYEQ 807          
BLAST of Disks large homolog 1 vs. Ensembl Cavefish
Match: dlg3 (discs, large homolog 3 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-050208-93])

HSP 1 Score: 186.422 bits (472), Expect = 7.328e-51
Identity = 101/285 (35.44%), Postives = 156/285 (54.74%), Query Frame = 1
Query:  340 KSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDEGIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRKRQQATMQQNLTKTDQKMSINDFYEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEK 1194
            +S YV+ L +Y+   D  LP +GLSF  G+ILH+ NA+D +WW AR + P   +      G+IPS  R+ KK + +  +V F  +T +IESN                         + + ++++L    Q+ +I   YE V   +  + RPV+ +GP + ++ D LI  +P+ F S V HTTRP+R NE++G DYHF+ ++ Q   D +   FIE  ++N N YGTS+L+VR V E  +HCI+D +   IK L++  + PISI I P +      +   QT E+
Sbjct:  502 RSLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGES---EQIGVIPSKKRVEKKERARLKTVKFHARTGMIESN-------------------------RVSVVEKHLPPQGQEDTILS-YEPVIRQEIHYTRPVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRENEMDGQDYHFVASREQMEKDIQDNKFIEAGQFNENLYGTSILSVRAVAERGKHCILDVSGNAIKRLQQAQLYPISIFIKPKSIEALMEMNKRQTYEQ 757          
BLAST of Disks large homolog 1 vs. Ensembl Cavefish
Match: dlg3 (discs, large homolog 3 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-050208-93])

HSP 1 Score: 186.808 bits (473), Expect = 7.574e-51
Identity = 105/285 (36.84%), Postives = 158/285 (55.44%), Query Frame = 1
Query:  340 KSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDEGIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRKRQQATMQQNLTKTDQKMSINDFYEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEK 1194
            +S YV+ L +Y+   D  LP +GLSF  G+ILH+ NA+D +WW AR + P   +      G+IPS  R+ KK + +  +V F  +T +IESN  +    + S    GS SL         +   +  + D  +S    YE V   +  + RPV+ +GP + ++ D LI  +P+ F S V HTTRP+R NE++G DYHF+ ++ Q   D +   FIE  ++N N YGTS+L+VR V E  +HCI+D +   IK L++  + PISI I P +      +   QT E+
Sbjct:  526 RSLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGES---EQIGVIPSKKRVEKKERARLKTVKFHARTGMIESN--RDFPGL-SDDFYGSKSLKCLTSNTSDSESSSKGQEDTILS----YEPVIRQEIHYTRPVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRENEMDGQDYHFVASREQMEKDIQDNKFIEAGQFNENLYGTSILSVRAVAERGKHCILDVSGNAIKRLQQAQLYPISIFIKPKSIEALMEMNKRQTYEQ 800          
BLAST of Disks large homolog 1 vs. Ensembl Sea Lamprey
Match: mpp7a (membrane protein, palmitoylated 7a (MAGUK p55 subfamily member 7) [Source:NCBI gene;Acc:30166])

HSP 1 Score: 102.064 bits (253), Expect = 2.242e-23
Identity = 71/291 (24.40%), Postives = 141/291 (48.45%), Query Frame = 1
Query:  346 FYVKTLIEYNSESDYSLPRK--GLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDEGIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRKRQQATMQQNLTKTDQKMS-INDFYEIVESTKSLFP----RPVLAIGP---GRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTS 1188
             Y++T  +YN   D ++P K  GL F  GE+L + + +D  WW A++    N        G+IPS     K +  + ++        I++ +    L  +       S  L  + ++    M ++    +   S ++ + E+++      P    R ++ +GP   G ++L  +LI + P++++  V  TTR K+S+E +  +Y+F+ +++ F  D     F+E  E+ GN YGTS+ A+R+V+ + + C++D +   IK++   + +P  I + P +    +   G   S
Sbjct:  231 IYLRTFFDYNPRGDVAIPCKEAGLPFLRGEVLQVVSQDDSMWWQAKRTEQSNMRA-----GLIPS-----KHYMERRLAARQPASPPIVQKSSKSRLSGLRR-----SFRLSRQSRKTSKLMYESKRSAEYDASEVSTYEEVLQYQHQ--PGDKYRVIVLVGPPGVGINELKRRLIASDPSLYSGTVPTTTRQKKSHEKDSKEYYFV-SRHLFEADLHNNRFVEYGEFKGNLYGTSVDAIRSVVNAGKVCLLDVSPPAIKSIRTPEFKPFVIFVKPPSLERLRQTRGAAKS 503          
BLAST of Disks large homolog 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006611.1 (pep scaffold:Pmarinus_7.0:GL481772:5454:8357:-1 gene:ENSPMAG00000005965.1 transcript:ENSPMAT00000006611.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.9005 bits (237), Expect = 3.569e-23
Identity = 62/199 (31.16%), Postives = 98/199 (49.25%), Query Frame = 1
Query:  787 PRPVLAIGP---GRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSE---------KLVKNSMQYSSMLNSKERKSFD-------VKLKCQNMEELVKETFISVTNCQ 1326
            PRPV+  GP   G+S L  +L+  +  +F   V+HTTR  R  E+ G DYHF+  +        A  FIE  EY+GN YGTS  AVR V++  + CI+D     + +++K D+ P+ I I P +  + +  +  + +E         K  K  +++     SKE  +FD       ++     ++ELVK+    V N  
Sbjct:    4 PRPVVLSGPSGCGKSTLIKKLMSEFEGVFGLSVSHTTRNPRPGEVTGKDYHFVTREEMLRLIA-AREFIEHAEYSGNLYGTSKSAVRAVLDKNQICILDIDMQGVHSMKKTDLNPLYISIQPPSITILEERLRLRKTENDDSLKRRLKAAKKEIEF-----SKEPGAFDAIVVNDELQEAYAQLKELVKKEIAKVQNAH 196          
BLAST of Disks large homolog 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004699.1 (pep scaffold:Pmarinus_7.0:GL501143:686031:770336:1 gene:ENSPMAG00000004247.1 transcript:ENSPMAT00000004699.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 96.2857 bits (238), Expect = 1.078e-21
Identity = 85/331 (25.68%), Postives = 141/331 (42.60%), Query Frame = 1
Query:  349 YVKTLIEYNSESDYSLPRK--GLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDEGIIPSAN-----RLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRKRQQATMQQNLTKTDQKMSINDFYEIVESTKSLFPRPVLAIGP---GRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAK-----SLMGEQTSEKL----VKNSMQYSSMLNSKERKSFDVKLKCQNME 1284
            +VK   +YN E D  +P K  GL F  G+IL I +  D DWW A K+    +       G+IPS       + Y +H+     V                     SG       L  K+K++   M     + D+   +   YE V        + ++ IG    GR  L ++L++  P+ +   V  T+RP R +E EG  Y+F+ ++     D  AG ++E+ EY GN YGT + ++  V+ + + CI+D     +K L   +  P  + +   T    +     +L    TS+ L    +K ++  S  +       FD+K+   NM+
Sbjct:  137 FVKCYFDYNPEDDQLIPCKEAGLRFNRGDILQIVSQEDPDWWQALKVKDGGS------AGLIPSQTLEEKRKAYVRHEWDYTGV---------------------SGERGFCGVLGGKKKKKMMYMSTKNAEFDRHEIL--IYEEVAKMPPFQRKTLMLIGAQGVGRRSLKNRLLVANPSRYGMIVPFTSRPPRDDEKEGQGYYFV-SRADMEADIRAGRYLESGEYEGNLYGTKIESIHGVVRTGKMCILDVNPQALKVLRTAEFMPFVVFVAAPTLETLRAMHRAALDAGATSKHLTDTDLKKTVDESVRIQRAYSHFFDLKIVNNNMD 437          
BLAST of Disks large homolog 1 vs. Ensembl Sea Lamprey
Match: MPP5 (membrane palmitoylated protein 5 [Source:HGNC Symbol;Acc:HGNC:18669])

HSP 1 Score: 91.6633 bits (226), Expect = 2.152e-21
Identity = 46/135 (34.07%), Postives = 81/135 (60.00%), Query Frame = 1
Query:  790 RPVLAIGP---GRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQT 1185
            RP++ IGP   GR++L  +L+ +  + FA+   HTTR  R NE++G DYHF+ ++  F  D     FIE  E+  N YGTS+ +VR V+ S + C+++     +K L+ +D++P  I + P +    +++M +++
Sbjct:   42 RPIVLIGPPNCGRNELRTRLMESDADRFAAATPHTTRGMRDNEVDGRDYHFV-SRQAFEADIGVHKFIEHGEFEKNLYGTSIDSVRQVINSGKICVLNLHTQSLKLLKNSDLKPYIIFVAPPSQERLRAMMAKES 175          
BLAST of Disks large homolog 1 vs. Ensembl Sea Lamprey
Match: guk1b (guanylate kinase 1b [Source:ZFIN;Acc:ZDB-GENE-020916-1])

HSP 1 Score: 88.1965 bits (217), Expect = 2.264e-20
Identity = 54/176 (30.68%), Postives = 97/176 (55.11%), Query Frame = 1
Query:  781 LFPRPVLAIGP---GRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYN-VAKSLMGEQT-SEKLVKNSMQY--SSMLNSKERKSFDVKLKCQNMEE 1287
            + PRPV+  GP   G+S L  +L+  Y ++F   V+HTTR  R+ E++G DYHF+  + +      A  FIE  E++GN YGTS  AV  + +  + CI+D     ++++++  + P+ + I P +   + + L G +T SE+ ++  +    + +  SKE   FD  +   +++E
Sbjct:   17 MGPRPVVLSGPSGAGKSTLVKRLMQEYADVFGFSVSHTTRNPRAGEVDGKDYHFV-CREEMEKGILADEFIEHAEFSGNLYGTSKKAVEVIRDHNQICILDLDIQGVRSMKRTTLNPLYLSIHPPSIEALEERLRGRKTESEESIQKRLAAARADLEISKEPGIFDAVIINDDLDE 191          
BLAST of Disks large homolog 1 vs. Ensembl Yeast
Match: GUK1 (Guanylate kinase; converts GMP to GDP; required for growth and mannose outer chain elongation of cell wall N-linked glycoproteins [Source:SGD;Acc:S000002862])

HSP 1 Score: 76.2554 bits (186), Expect = 1.323e-16
Identity = 48/177 (27.12%), Postives = 93/177 (52.54%), Query Frame = 1
Query:  790 RPVLAIGP---GRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEK-NDIQPISILICPDTYNVAKSLM---GEQTSEKLVKNSMQYSSMLNSKERKSFDVKLKCQNMEELVKE 1299
            RP++  GP   G+S L  +L   YP+ F   V+ TTR  R+ E+ G DY+F+ + ++F +  +   FIE  +++GN+YG+++ +V+ V +S + CI+D     +K+++   ++    + I P +    K  +   G +T E + K      + L   E  + D  +   ++++  KE
Sbjct:    3 RPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRAGEVNGKDYNFV-SVDEFKSMIKNNEFIEWAQFSGNYYGSTVASVKQVSKSGKTCILDIDMQGVKSVKAIPELNARFLFIAPPSVEDLKKRLEGRGTETEESINKRLSAAQAELAYAETGAHDKVIVNDDLDKAYKE 178          
BLAST of Disks large homolog 1 vs. Ensembl Nematostella
Match: EDO46060 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR66])

HSP 1 Score: 170.629 bits (431), Expect = 1.985e-48
Identity = 98/311 (31.51%), Postives = 155/311 (49.84%), Query Frame = 1
Query:  340 KSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDEGIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSL------------------DLKRKRQQATMQQNLTKTDQKMSIND-----FYEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEKLVK 1203
            +  YV+ L +Y+   D  LP +GLSF+ G+ILH+ NA+D +WW ARKLN +         G+IPS  R+ ++ + +  SV F   +           DK+      G+ S+                  DL+      +   N + ++   S         YE V+  +  + RPV+ +GP + ++ D LI  +P+ F S V HTTRP+R  E +G DYHF+E++ +     +  +FIE  +YN N YGTS+ +V+ V E  +HCI+D +   IK L+   + PI+I I P +    + L    T E+  K
Sbjct:   15 RQLYVRALFDYDKTKDSGLPSQGLSFKYGDILHVTNASDDEWWQARKLNAVGEE---EGRGVIPSKRRVERREKARMKSVKFTRTSD----------DKLRGSFNDGTGSVRKRSFKFSKKLPFFKKESDLETSDVDPSYTSNASDSESSTSARAEEPILSYEAVQQHELKYTRPVIVLGPLKDRINDDLISEFPDKFGSCVPHTTRPRRDYEKDGLDYHFVESREEMERAIQNHMFIEAGQYNDNLYGTSVESVKIVAEKSKHCILDVSGYAIKRLQVAGLYPIAIFIKPKSMESIRELNKRLTEEQAQK 312          
BLAST of Disks large homolog 1 vs. Ensembl Nematostella
Match: EDO33577 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRU3])

HSP 1 Score: 114.775 bits (286), Expect = 3.656e-27
Identity = 82/286 (28.67%), Postives = 147/286 (51.40%), Query Frame = 1
Query:  340 KSFYVKTLIEYNSESDYSLPRK--GLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDEGIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRKRQQATM---QQN-LTKTDQKMSINDFYEIVESTKSLFPRPVLAIGP---GRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSL 1170
            ++ +V+   +Y+   D  +P +  GL+F  G+ILH+ +  D++WW A +       +     G+IPS     K  Q +  S+        + ++  +T +K           L +KRKR++  +   QQN + + DQ ++ ++  +++    S   RP++ IGP   GR +L  +LI   P+ FA  + HT+RP +  EI  +DYHF+  ++ F TD  A  F+E  E   +FYGTS  A++ V+ + + CI++     +K L  ++I+P  I I   +Y   ++L
Sbjct:  286 RAVHVRANFDYDPYDDEFIPCRELGLAFRRGDILHVVDQEDQNWWQAWRAGEEGKKL----AGLIPS-----KHFQQQRESMKH-----TVPADNEKTTEK-------SKKCLCIKRKRRKKVLYNAQQNEVFEVDQVLTYDEV-DLLHPNPSR-KRPIVLIGPPKIGRKELRQRLIQYDPDRFAGAIPHTSRPIKPGEINDHDYHFVP-RHTFVTDIVAHKFVEHGELQDHFYGTSFDAIKMVINAGKTCILNLHCEALKTLRASNIKPYVIFISSPSYERVRAL 547          
BLAST of Disks large homolog 1 vs. Ensembl Nematostella
Match: EDO37538 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFE0])

HSP 1 Score: 104.76 bits (260), Expect = 4.571e-24
Identity = 84/328 (25.61%), Postives = 143/328 (43.60%), Query Frame = 1
Query:  349 YVKTLIEYNSESDYSLPRK--GLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDEGIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRKRQQATMQQNLTKTDQKMSINDFYEIVESTKSLFPRPVL----AIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEKLV---------KNSMQYSSMLNSKERKSFDVKLKCQNMEE 1287
            +V+   +Y+   D  +P +  GL+F+ GE+L I +  D +WW A+K++           GIIPS                      I E      + K      PGS  L   +K+Q+   + +     +K  +  + E+ +     F R  L    A G GR  L ++LI++    F + + HT+R  R  E  G  Y F+ ++ +   D  AG ++E  EY GN YGT +  +R VM S + C++D   T +K L+  +  P  + I   ++   K    +  SE +V         + +++ S  L +     FD+ +   N+EE
Sbjct:  193 FVRAHFDYDPSKDDQIPCQDAGLAFKQGEVLQIVDQEDANWWQAKKVDDSRA------AGIIPSQ---------------------ICEERRRAGVKK----DKPGSKFLCGSKKKQKVMYKSSKNFDFEKHELPIYEEVAKMPP--FQRKTLVMIGAQGVGRRTLKNKLIMSDRKRFGTTIPHTSRQMREGEQSGRGYFFV-SREEMERDIRAGKYLEFGEYGGNMYGTKIDTIREVMRSGKMCVVDVNPTALKVLKTPEFMPYIVCIASPSFEELKEFQSKALSEGIVNKKRSDDELRKTVEDSERLYNSYAHYFDLTIANDNVEE 486          
BLAST of Disks large homolog 1 vs. Ensembl Nematostella
Match: EDO42233 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S267])

HSP 1 Score: 83.9593 bits (206), Expect = 7.090e-19
Identity = 46/121 (38.02%), Postives = 69/121 (57.02%), Query Frame = 1
Query:  790 RPVLAIGP---GRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICP 1143
            +P++  GP   G+S L  +L+  YP+ F   V+HTTR  R  EI G DY+F E +       E G F+E  EYN N YGTS  AV++V+   + CI+D     +KN++K +++ + I   P
Sbjct:    4 KPIVIHGPSGSGKSTLVKRLMKEYPDTFGFSVSHTTRQPRPGEINGKDYNFTE-RGIMEKAIENGEFLEFAEYNQNLYGTSKKAVQDVIHVGKVCILDIDVQGVKNVKKAEMKCLYIFAKP 123          
BLAST of Disks large homolog 1 vs. Ensembl Nematostella
Match: EDO37539 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFE1])

HSP 1 Score: 82.4185 bits (202), Expect = 3.529e-18
Identity = 49/171 (28.65%), Postives = 83/171 (48.54%), Query Frame = 1
Query:  802 AIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEKLV---------KNSMQYSSMLNSKERKSFDVKLKCQNMEE 1287
            A G GR  L ++LI++    F + + HT+R  R  E  G  Y F+ ++ +   D  AG ++E  EY GN YGT +  +R VM S + C++D   T +K L+  +  P  + I   ++   K    +  SE +V         + +++ S  L +     FD+ +   N+EE
Sbjct:    2 AQGVGRRTLKNKLIMSDRKRFGTTIPHTSRQMREGEQSGRGYFFV-SREEMERDIRAGKYLEFGEYGGNMYGTKIDTIREVMRSGKMCVVDVNPTALKVLKTPEFMPYIVCIASPSFEELKEFQSKALSEGIVNKKRSDDELRKTVEDSERLYNSYAHYFDLTIANDNVEE 171          
BLAST of Disks large homolog 1 vs. Ensembl Medaka
Match: dlg3 (discs large MAGUK scaffold protein 3 [Source:NCBI gene;Acc:101169708])

HSP 1 Score: 183.726 bits (465), Expect = 6.734e-53
Identity = 106/308 (34.42%), Postives = 162/308 (52.60%), Query Frame = 1
Query:  340 KSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDEGIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRK-----------RQQATMQQNLT------------KTDQKMSINDFYEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEK 1194
            +S YV+ L +Y+   D  LP +GLSF  G+ILH+ NA+D +WW AR + P   +      G+IPS  R+ KK + +  +V F  +T +IESN    + +          S +L RK            +Q   +Q LT            + D  +S    YE V   +  + RPV+ +GP + ++ D LI  +P+ F S V HTTRP+R NE++G DYHF+ ++ Q   D +   FIE  ++N N YGTS+L+VR V E  +HCI+D +   IK L++  + PI+I I P +      +   QT ++
Sbjct:   19 RSLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGES---EQIGVIPSKKRVEKKERARLKTVKFHARTGMIESNRPVKVKR--------KKSFNLSRKFPFYKSKENIAYEQVDPEQCLTSNTSDSESSSKGQEDTILS----YEPVIRQEIHYTRPVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRENEMDGQDYHFVASREQMEKDIQDNKFIEAGQFNENLYGTSILSVRTVAERGKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSIEALMEMNKRQTYDQ 311          
BLAST of Disks large homolog 1 vs. Ensembl Medaka
Match: dlg3 (discs large MAGUK scaffold protein 3 [Source:NCBI gene;Acc:101169708])

HSP 1 Score: 184.111 bits (466), Expect = 7.881e-50
Identity = 106/308 (34.42%), Postives = 162/308 (52.60%), Query Frame = 1
Query:  340 KSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDEGIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRK-----------RQQATMQQNLT------------KTDQKMSINDFYEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEK 1194
            +S YV+ L +Y+   D  LP +GLSF  G+ILH+ NA+D +WW AR + P   +      G+IPS  R+ KK + +  +V F  +T +IESN    + +          S +L RK            +Q   +Q LT            + D  +S    YE V   +  + RPV+ +GP + ++ D LI  +P+ F S V HTTRP+R NE++G DYHF+ ++ Q   D +   FIE  ++N N YGTS+L+VR V E  +HCI+D +   IK L++  + PI+I I P +      +   QT ++
Sbjct:  511 RSLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGES---EQIGVIPSKKRVEKKERARLKTVKFHARTGMIESNRPVKVKR--------KKSFNLSRKFPFYKSKENIAYEQVDPEQCLTSNTSDSESSSKGQEDTILS----YEPVIRQEIHYTRPVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRENEMDGQDYHFVASREQMEKDIQDNKFIEAGQFNENLYGTSILSVRTVAERGKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSIEALMEMNKRQTYDQ 803          
BLAST of Disks large homolog 1 vs. Ensembl Medaka
Match: dlg3 (discs large MAGUK scaffold protein 3 [Source:NCBI gene;Acc:101169708])

HSP 1 Score: 183.726 bits (465), Expect = 8.732e-50
Identity = 106/308 (34.42%), Postives = 162/308 (52.60%), Query Frame = 1
Query:  340 KSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDEGIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRK-----------RQQATMQQNLT------------KTDQKMSINDFYEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEK 1194
            +S YV+ L +Y+   D  LP +GLSF  G+ILH+ NA+D +WW AR + P   +      G+IPS  R+ KK + +  +V F  +T +IESN    + +          S +L RK            +Q   +Q LT            + D  +S    YE V   +  + RPV+ +GP + ++ D LI  +P+ F S V HTTRP+R NE++G DYHF+ ++ Q   D +   FIE  ++N N YGTS+L+VR V E  +HCI+D +   IK L++  + PI+I I P +      +   QT ++
Sbjct:  514 RSLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGES---EQIGVIPSKKRVEKKERARLKTVKFHARTGMIESNRPVKVKR--------KKSFNLSRKFPFYKSKENIAYEQVDPEQCLTSNTSDSESSSKGQEDTILS----YEPVIRQEIHYTRPVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRENEMDGQDYHFVASREQMEKDIQDNKFIEAGQFNENLYGTSILSVRTVAERGKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSIEALMEMNKRQTYDQ 806          
BLAST of Disks large homolog 1 vs. Ensembl Medaka
Match: dlg3 (discs large MAGUK scaffold protein 3 [Source:NCBI gene;Acc:101169708])

HSP 1 Score: 182.956 bits (463), Expect = 1.163e-49
Identity = 104/285 (36.49%), Postives = 157/285 (55.09%), Query Frame = 1
Query:  340 KSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDEGIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRKRQQATMQQNLTKTDQKMSINDFYEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEK 1194
            +S YV+ L +Y+   D  LP +GLSF  G+ILH+ NA+D +WW AR + P   +      G+IPS  R+ KK + +  +V F  +T +IESN  +    + S    GS SL    K Q+ T+                YE V   +  + RPV+ +GP + ++ D LI  +P+ F S V HTTRP+R NE++G DYHF+ ++ Q   D +   FIE  ++N N YGTS+L+VR V E  +HCI+D +   IK L++  + PI+I I P +      +   QT ++
Sbjct:  499 RSLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGES---EQIGVIPSKKRVEKKERARLKTVKFHARTGMIESN--RDFPGL-SDDFYGSKSL----KGQEDTILS--------------YEPVIRQEIHYTRPVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRENEMDGQDYHFVASREQMEKDIQDNKFIEAGQFNENLYGTSILSVRTVAERGKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSIEALMEMNKRQTYDQ 759          
BLAST of Disks large homolog 1 vs. Ensembl Medaka
Match: dlg3 (discs large MAGUK scaffold protein 3 [Source:NCBI gene;Acc:101169708])

HSP 1 Score: 183.341 bits (464), Expect = 1.430e-49
Identity = 104/304 (34.21%), Postives = 159/304 (52.30%), Query Frame = 1
Query:  340 KSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDEGIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRK-----------RQQATMQQNLTKTDQKMSIND--------FYEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEK 1194
            +S YV+ L +Y+   D  LP +GLSF  G+ILH+ NA+D +WW AR + P   +      G+IPS  R+ KK + +  +V F  +T +IESN    + +          S +L RK            +Q   +Q LT        +          YE V   +  + RPV+ +GP + ++ D LI  +P+ F S V HTTRP+R NE++G DYHF+ ++ Q   D +   FIE  ++N N YGTS+L+VR V E  +HCI+D +   IK L++  + PI+I I P +      +   QT ++
Sbjct:  518 RSLYVRALFDYDRTRDSCLPSQGLSFSYGDILHVINASDDEWWQARLVTPHGES---EQIGVIPSKKRVEKKERARLKTVKFHARTGMIESNRPVKVKR--------KKSFNLSRKFPFYKSKENIAYEQVDPEQCLTSNTSDSESSSKGQEDTILSYEPVIRQEIHYTRPVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRENEMDGQDYHFVASREQMEKDIQDNKFIEAGQFNENLYGTSILSVRTVAERGKHCILDVSGNAIKRLQQAQLYPIAIFIKPKSIEALMEMNKRQTYDQ 810          
BLAST of Disks large homolog 1 vs. Planmine SMEST
Match: SMESG000045568.1 (SMESG000045568.1)

HSP 1 Score: 749.199 bits (1933), Expect = 0.000e+0
Identity = 363/363 (100.00%), Postives = 363/363 (100.00%), Query Frame = 1
Query:  298 MRDGINAIAIDDKIKSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDEGIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRKRQQATMQQNLTKTDQKMSINDFYEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEKLVKNSMQYSSMLNSKERKSFDVKLKCQNMEELVKETFISVTNCQKWGVWKRAEDQSLIEIFSTK 1386
            MRDGINAIAIDDKIKSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDEGIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRKRQQATMQQNLTKTDQKMSINDFYEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEKLVKNSMQYSSMLNSKERKSFDVKLKCQNMEELVKETFISVTNCQKWGVWKRAEDQSLIEIFSTK
Sbjct:    1 MRDGINAIAIDDKIKSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDEGIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRKRQQATMQQNLTKTDQKMSINDFYEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEKLVKNSMQYSSMLNSKERKSFDVKLKCQNMEELVKETFISVTNCQKWGVWKRAEDQSLIEIFSTK 363          
BLAST of Disks large homolog 1 vs. Planmine SMEST
Match: SMESG000017603.1 (SMESG000017603.1)

HSP 1 Score: 215.312 bits (547), Expect = 7.867e-65
Identity = 122/369 (33.06%), Postives = 205/369 (55.56%), Query Frame = 1
Query:  319 IAIDDKIKSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKL--------NPLNTNIFPSDEGIIPSANRLYKKHQNKEMSVNFEEKTIIIESNGSQTLDKINSGSTPGSSSLDLKRKRQ----QATMQQNLTKTDQKMSINDFYEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEKL-VKNSMQYSSMLNSKERKSFDVKLKCQNMEELVKETFISVTNCQKWGVWKRAEDQSLIEIFSTK 1386
            I +D+K+++FY++TL  Y    D  LP KGL F+ G++L + NAND  WW A  +        N L+ +    + G+IPS  R+  K + ++  V F+ + ++I   G    + INS   PG SS DLKR R+    +  M++++  TD + +  + YEI+E       RP++ IGPG+ +LY+ L++ Y +I+ +P+ HTTRP R  E +G DYHFI NK++  ++  +  +I+  ++ GNFY  S+ +V+  +   ++ ++D +   I+ L    I PI ILI   + + AK+L G+     L V+++  Y+  L  +    FDV +   +  EL ++    V   Q+   W  AEDQSL+ I S++
Sbjct:   10 ITVDNKVQTFYIRTLCSYEPSLDKGLPGKGLKFKPGDLLLVINANDSQWWQAVHIRRNLFLSSNNLHNSSLSRERGLIPSLERVKNKSRFQKRHVEFDSRAMVIGPTGKLVSEIINS---PGCSSFDLKRIRKFNNSRKPMEKSICGTDLENNFTNPYEIIEQQIIKTTRPIVVIGPGKDQLYEYLLIEYSDIYNTPIPHTTRPPRPGERDGVDYHFISNKDELESETNSSKYIDVGKFKGNFYANSIESVKQALAKSKYPLLDISHNGIEKLRSAAIYPICILISTSSLSQAKTLQGDGRQINLDVQSTRDYTIKLEKEFSVLFDVIISPTSAAELKEQVVQLVHAYQRSPTWVAAEDQSLLNISSSE 375          
BLAST of Disks large homolog 1 vs. Planmine SMEST
Match: SMESG000034854.1 (SMESG000034854.1)

HSP 1 Score: 157.147 bits (396), Expect = 1.130e-40
Identity = 96/273 (35.16%), Postives = 149/273 (54.58%), Query Frame = 1
Query:  346 FYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDEGIIPSANRLYKKHQNKEMSVNFEEKTIIIES-------NGSQTLDKINSGSTPGSSSLDLKRKRQQATMQQNLTKTDQKMSINDFYEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICP 1143
            FYV+ L E++ + + +LP + L+F   +I+ I N+ D DWW AR +   N N      GIIPS NRLY+K +  +  VNF+ + +   S       NG  +  K     +   S+ ++   +  A    N   T+  + +  +YE +      + RPV+ IGP R K+ D LI  +PN+FAS V HTTR K+  E+ G DY+F++++++     +   FIE  +Y  N YGTS+ AVR+V + K HC++D     IK L   ++ PI+ILI P
Sbjct:  750 FYVRALFEFDPDVEKNLPSRPLAFLTNDIILIVNSADPDWWQARVVEDNNEN---GPLGIIPSPNRLYRKEKRNKKKVNFDSQLVSKNSKKNSLPRNGKPSFIKRMQLGSMSKSAQNITEDKSYADEYMNEKFTEANLML-LYYEPLVKISLDYVRPVVIIGPLRDKINDTLIDEHPNLFASCVPHTTRSKKPFEVHGKDYYFVKDRSEMEEQIKHQEFIEAGQYKDNLYGTSIAAVRDVAKLK-HCVLDVNALAIKRLVAANLLPITILIKP 1017          
BLAST of Disks large homolog 1 vs. Planmine SMEST
Match: SMESG000034854.1 (SMESG000034854.1)

HSP 1 Score: 156.762 bits (395), Expect = 1.435e-40
Identity = 96/273 (35.16%), Postives = 149/273 (54.58%), Query Frame = 1
Query:  346 FYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDEGIIPSANRLYKKHQNKEMSVNFEEKTIIIES-------NGSQTLDKINSGSTPGSSSLDLKRKRQQATMQQNLTKTDQKMSINDFYEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICP 1143
            FYV+ L E++ + + +LP + L+F   +I+ I N+ D DWW AR +   N N      GIIPS NRLY+K +  +  VNF+ + +   S       NG  +  K     +   S+ ++   +  A    N   T+  + +  +YE +      + RPV+ IGP R K+ D LI  +PN+FAS V HTTR K+  E+ G DY+F++++++     +   FIE  +Y  N YGTS+ AVR+V + K HC++D     IK L   ++ PI+ILI P
Sbjct:  762 FYVRALFEFDPDVEKNLPSRPLAFLTNDIILIVNSADPDWWQARVVEDNNEN---GPLGIIPSPNRLYRKEKRNKKKVNFDSQLVSKNSKKNSLPRNGKPSFIKRMQLGSMSKSAQNITEDKSYADEYMNEKFTEANLMLL-YYEPLVKISLDYVRPVVIIGPLRDKINDTLIDEHPNLFASCVPHTTRSKKPFEVHGKDYYFVKDRSEMEEQIKHQEFIEAGQYKDNLYGTSIAAVRDVAKLK-HCVLDVNALAIKRLVAANLLPITILIKP 1029          
BLAST of Disks large homolog 1 vs. Planmine SMEST
Match: SMESG000060935.1 (SMESG000060935.1)

HSP 1 Score: 142.895 bits (359), Expect = 1.114e-36
Identity = 109/373 (29.22%), Postives = 184/373 (49.33%), Query Frame = 1
Query:  340 KSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKNANDKDWWFARKLNPLNTNIFPSDEGIIPSANRLYKKHQNKEMSVNF--EEKTIIIESNGSQTLD----------KINSGSTPGSSS---LDLKRKRQQATMQQNLTKTDQKM---------------------SINDFYEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPKRSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNF-YGTSLLAVRNVMESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEKLVKNSMQYSSMLNSKERKSFDVKLKCQNMEELVKETF--ISVTNCQKWGVW 1341
            K+ YV+ L  Y    D  LP KGLSF+ G+ILH+ NA+D +WW ARK+N L T    +D GIIPS NR+ ++++ K+  V    ++   I++ N   T+           K+ + S P   +   +D K++       +   K+  K                      SI  +  +++   SL  RPV+ +G  + ++   L+  Y   F   V HTTRP  +++I+G D++F+ + ++ N       FIET   +GNF YGTS+ ++ +V E+ +HCI+D +   IK L   +I PI+ILI   + +  +SL+ +  SE+    ++   S L  +        +   N E + ++    I++ N +K  VW
Sbjct:  174 KTLYVRALFNYQVNKDCGLPNKGLSFKFGDILHVTNASDSEWWQARKVN-LTTGEDETDLGIIPSKNRVERQNKTKQKKVRICVDDTIPIVDENDEYTISTSLSQSVGDIKLTANSLPRPQNGKIIDCKKQTNGGLFSRFKGKSKNKCQSNSINQESENDVTLARNSTESIQSYQPVIQEENSLI-RPVIILGVAKEEINKSLLKEYNEEFGVCVPHTTRPIETDDIDGKDFYFV-SVSEMNELMSNHQFIETGR-SGNFLYGTSVQSIIDVAEAGKHCILDISSMAIKRLYIREIWPITILIQVQSIDDYRSLISKPVSEEQSLKALSKLSRLEQEFLPFITAIISGSNFESVYQQVIQTIAINNGRK--VW 540          
The following BLAST results are available for this feature:
BLAST of Disks large homolog 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DLG31.540e-5334.87discs large MAGUK scaffold protein 3 [Source:HGNC ... [more]
DLG34.136e-5234.87discs large MAGUK scaffold protein 3 [Source:HGNC ... [more]
DLG13.207e-5133.73discs large MAGUK scaffold protein 1 [Source:HGNC ... [more]
DLG22.179e-5034.75discs large MAGUK scaffold protein 2 [Source:HGNC ... [more]
DLG13.984e-5034.44discs large MAGUK scaffold protein 1 [Source:HGNC ... [more]
back to top
BLAST of Disks large homolog 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dlg-11.078e-4130.68Disks large homolog 1 [Source:UniProtKB/Swiss-Pro... [more]
magu-21.067e-1826.91MAGUK family [Source:UniProtKB/TrEMBL;Acc:A0A3B1D... [more]
magu-21.067e-1826.91MAGUK family [Source:UniProtKB/TrEMBL;Acc:A0A3B1D... [more]
magu-21.278e-1826.91MAGUK family [Source:UniProtKB/TrEMBL;Acc:A0A3B1D... [more]
magu-21.278e-1826.91MAGUK family [Source:UniProtKB/TrEMBL;Acc:A0A3B1D... [more]
back to top
BLAST of Disks large homolog 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dlg15.646e-5032.56gene:FBgn0001624 transcript:FBtr0333262[more]
dlg12.409e-4731.22gene:FBgn0001624 transcript:FBtr0073490[more]
dlg13.329e-4731.22gene:FBgn0001624 transcript:FBtr0112812[more]
dlg13.848e-4733.54gene:FBgn0001624 transcript:FBtr0073488[more]
dlg15.406e-4630.38gene:FBgn0001624 transcript:FBtr0073485[more]
back to top
BLAST of Disks large homolog 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dlg33.446e-5535.20discs, large homolog 3 (Drosophila) [Source:ZFIN;A... [more]
dlg33.446e-5535.20discs, large homolog 3 (Drosophila) [Source:ZFIN;A... [more]
dlg33.737e-5235.69discs, large homolog 3 (Drosophila) [Source:ZFIN;A... [more]
dlg31.016e-5135.20discs, large homolog 3 (Drosophila) [Source:ZFIN;A... [more]
dlg31.318e-5135.20discs, large homolog 3 (Drosophila) [Source:ZFIN;A... [more]
back to top
BLAST of Disks large homolog 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hmmr4.770e-5035.86hyaluronan-mediated motility receptor (RHAMM) [Sou... [more]
hjv1.018e-4732.94hemojuvelin BMP co-receptor [Source:Xenbase;Acc:XB... [more]
hjv1.306e-4733.04hemojuvelin BMP co-receptor [Source:Xenbase;Acc:XB... [more]
hjv1.337e-4732.94hemojuvelin BMP co-receptor [Source:Xenbase;Acc:XB... [more]
hjv1.429e-4733.04hemojuvelin BMP co-receptor [Source:Xenbase;Acc:XB... [more]
back to top
BLAST of Disks large homolog 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dlg34.600e-5234.87discs large MAGUK scaffold protein 3 [Source:MGI S... [more]
Dlg17.405e-5034.34discs large MAGUK scaffold protein 1 [Source:MGI S... [more]
Dlg11.290e-4933.63discs large MAGUK scaffold protein 1 [Source:MGI S... [more]
Dlg11.837e-4934.04discs large MAGUK scaffold protein 1 [Source:MGI S... [more]
Dlg12.273e-4933.73discs large MAGUK scaffold protein 1 [Source:MGI S... [more]
back to top
BLAST of Disks large homolog 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q12959|DLG1_HUMAN9.082e-4933.73Disks large homolog 1 OS=Homo sapiens OX=9606 GN=D... [more]
sp|Q811D0|DLG1_MOUSE1.590e-4833.73Disks large homolog 1 OS=Mus musculus OX=10090 GN=... [more]
sp|Q62696|DLG1_RAT2.385e-4833.63Disks large homolog 1 OS=Rattus norvegicus OX=1011... [more]
sp|P70175|DLG3_MOUSE3.281e-4835.05Disks large homolog 3 OS=Mus musculus OX=10090 GN=... [more]
sp|Q62936|DLG3_RAT3.579e-4835.05Disks large homolog 3 OS=Rattus norvegicus OX=1011... [more]
back to top
BLAST of Disks large homolog 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1A8RLL81.280e-5233.33Discs, large homolog 3 (Fragment) OS=Nothobranchiu... [more]
A0A212C0V11.436e-5236.21DLG3 OS=Cervus elaphus hippelaphus OX=46360 GN=Cel... [more]
A0A3Q2ZLD41.688e-5235.20Discs, large homolog 3 (Drosophila) OS=Kryptolebia... [more]
A5PKT07.710e-5235.20Discs, large homolog 3 (Drosophila) OS=Danio rerio... [more]
A0A3B4CMR97.874e-5234.87Discs, large homolog 3 (Drosophila) OS=Pygocentrus... [more]
back to top
BLAST of Disks large homolog 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dlg31.028e-5134.87discs, large homolog 3 (Drosophila) [Source:ZFIN;A... [more]
dlg31.084e-5134.87discs, large homolog 3 (Drosophila) [Source:ZFIN;A... [more]
dlg31.377e-5134.87discs, large homolog 3 (Drosophila) [Source:ZFIN;A... [more]
dlg37.328e-5135.44discs, large homolog 3 (Drosophila) [Source:ZFIN;A... [more]
dlg37.574e-5136.84discs, large homolog 3 (Drosophila) [Source:ZFIN;A... [more]
back to top
BLAST of Disks large homolog 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mpp7a2.242e-2324.40membrane protein, palmitoylated 7a (MAGUK p55 subf... [more]
ENSPMAT00000006611.13.569e-2331.16pep scaffold:Pmarinus_7.0:GL481772:5454:8357:-1 ge... [more]
ENSPMAT00000004699.11.078e-2125.68pep scaffold:Pmarinus_7.0:GL501143:686031:770336:1... [more]
MPP52.152e-2134.07membrane palmitoylated protein 5 [Source:HGNC Symb... [more]
guk1b2.264e-2030.68guanylate kinase 1b [Source:ZFIN;Acc:ZDB-GENE-0209... [more]
back to top
BLAST of Disks large homolog 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
GUK11.323e-1627.12Guanylate kinase; converts GMP to GDP; required fo... [more]
back to top
BLAST of Disks large homolog 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO460601.985e-4831.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO335773.656e-2728.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375384.571e-2425.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO422337.090e-1938.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375393.529e-1828.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Disks large homolog 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dlg36.734e-5334.42discs large MAGUK scaffold protein 3 [Source:NCBI ... [more]
dlg37.881e-5034.42discs large MAGUK scaffold protein 3 [Source:NCBI ... [more]
dlg38.732e-5034.42discs large MAGUK scaffold protein 3 [Source:NCBI ... [more]
dlg31.163e-4936.49discs large MAGUK scaffold protein 3 [Source:NCBI ... [more]
dlg31.430e-4934.21discs large MAGUK scaffold protein 3 [Source:NCBI ... [more]
back to top
BLAST of Disks large homolog 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000045568.10.000e+0100.00SMESG000045568.1[more]
SMESG000017603.17.867e-6533.06SMESG000017603.1[more]
SMESG000034854.11.130e-4035.16SMESG000034854.1[more]
SMESG000034854.11.435e-4035.16SMESG000034854.1[more]
SMESG000060935.11.114e-3629.22SMESG000060935.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021882 ID=SMED30021882|Name=Disks large homolog 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1515bp
CCAAATATTGTGTGTGTGTGTTGATCAATCGTGTTAGCAGCACCAATCAG
AAACACTACAATGCACATCGTCATTTACACGCCAAAATTCATAATGATTC
ATATAAGTCTATTTTCGTCTACCAATCAACATCTGATCAACTCAATGAAT
ATAATTCAATTGTATTGTTAATTAATATTTTGATTTTTTAAATTATCATC
CACATAAACTCAAAACCAATTTCTATTCAATATTATTGTAAAAGTTCAAT
TTATTCTTTACTTGGAATTACTTTTATTCGGAAATCCAATCATAATAATG
AGAGATGGAATTAATGCAATTGCGATTGATGACAAAATCAAGTCATTTTA
TGTCAAAACATTGATAGAATACAATTCCGAATCAGATTACAGTCTTCCCA
GAAAGGGGCTCAGTTTTGAAATAGGAGAAATTCTACACATAAAAAATGCC
AATGATAAAGATTGGTGGTTTGCTCGAAAATTGAATCCATTGAATACGAA
TATCTTCCCATCAGATGAAGGAATAATACCAAGTGCAAACAGATTATACA
AAAAGCATCAGAATAAGGAGATGTCTGTCAATTTTGAAGAGAAAACGATA
ATAATTGAATCCAATGGCTCACAAACTTTGGATAAAATCAATTCTGGCAG
TACTCCAGGTTCTAGCTCGTTAGATTTAAAACGAAAACGACAACAAGCAA
CAATGCAACAAAATCTCACAAAAACTGATCAGAAAATGTCAATAAATGAC
TTCTATGAAATTGTTGAATCTACGAAGTCATTATTCCCAAGACCGGTGCT
GGCTATTGGTCCTGGTCGCAGTAAATTGTATGATCAACTGATTTTAAATT
ATCCCAATATATTTGCTTCACCAGTCAACCATACCACTAGGCCGAAGCGA
AGCAACGAAATAGAAGGAAATGATTATCACTTTATTGAAAATAAGAACCA
ATTTAACACAGATAAAGAGGCGGGATTATTCATTGAAACCGTCGAGTACA
ATGGAAACTTTTACGGAACGAGTTTACTGGCGGTTAGAAACGTCATGGAA
TCGAAACGGCATTGCATTATAGATGCAACGTTTACGGTGATCAAAAATTT
AGAGAAAAACGATATTCAGCCAATTTCAATACTGATTTGTCCCGATACGT
ATAATGTGGCGAAAAGCTTGATGGGAGAACAAACCTCAGAGAAATTGGTG
AAGAATTCAATGCAATATTCATCGATGCTCAATTCAAAGGAAAGAAAATC
ATTTGATGTGAAACTTAAATGTCAGAATATGGAAGAGCTGGTAAAAGAGA
CGTTCATTTCTGTCACAAATTGTCAGAAATGGGGTGTATGGAAACGAGCC
GAGGATCAATCTTTAATAGAAATTTTTTCTACTAAATAATGAAACATATC
ATATTTTTGAACAAAATTGCTTTTCAATGCTCAAACCGAATTTTTAGTTT
TTTTTTGATATCGACAGTCCGAGGACTAAAAATGATCAAAATGATTTATT
AATATCTTCTCTTAG
back to top

protein sequence of SMED30021882-orf-1

>SMED30021882-orf-1 ID=SMED30021882-orf-1|Name=SMED30021882-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=364bp
MRDGINAIAIDDKIKSFYVKTLIEYNSESDYSLPRKGLSFEIGEILHIKN
ANDKDWWFARKLNPLNTNIFPSDEGIIPSANRLYKKHQNKEMSVNFEEKT
IIIESNGSQTLDKINSGSTPGSSSLDLKRKRQQATMQQNLTKTDQKMSIN
DFYEIVESTKSLFPRPVLAIGPGRSKLYDQLILNYPNIFASPVNHTTRPK
RSNEIEGNDYHFIENKNQFNTDKEAGLFIETVEYNGNFYGTSLLAVRNVM
ESKRHCIIDATFTVIKNLEKNDIQPISILICPDTYNVAKSLMGEQTSEKL
VKNSMQYSSMLNSKERKSFDVKLKCQNMEELVKETFISVTNCQKWGVWKR
AEDQSLIEIFSTK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0016020membrane
GO:0016324apical plasma membrane
GO:0030054cell junction
GO:0005615extracellular space
GO:0005737cytoplasm
GO:0005886plasma membrane
GO:0005911cell-cell junction
GO:0005923bicellular tight junction
GO:0014069postsynaptic density
GO:0016323basolateral plasma membrane
GO:0030426growth cone
GO:0032281AMPA glutamate receptor complex
GO:0043025neuronal cell body
GO:0043198dendritic shaft
GO:0045202synapse
GO:0045211postsynaptic membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR036028SH3-like_dom_sf
IPR008145GK/Ca_channel_bsu
IPR027417P-loop_NTPase
IPR020590Guanylate_kinase_CS
IPR008144Guanylate_kin-like_dom
IPR001452SH3_domain
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0004385guanylate kinase activity
GO:0008022protein C-terminus binding
GO:0019900kinase binding
GO:0019902phosphatase binding
GO:0019903protein phosphatase binding
GO:0019904protein domain specific binding
GO:0030165PDZ domain binding
GO:0031625ubiquitin protein ligase binding
GO:0035255ionotropic glutamate receptor binding
Vocabulary: biological process
TermDefinition
GO:0001736establishment of planar polarity
GO:0007268chemical synaptic transmission
GO:0007399nervous system development
GO:0010923negative regulation of phosphatase activity
GO:0043113receptor clustering
GO:0045197establishment or maintenance of epithelial cell apical/basal polarity
GO:0046037GMP metabolic process
GO:0046710GDP metabolic process
GO:0097120receptor localization to synapse
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008145Guanylate kinase/L-type calcium channel beta subunitSMARTSM00072gk_7coord: 163..344
e-value: 1.9E-31
score: 120.5
IPR008145Guanylate kinase/L-type calcium channel beta subunitPFAMPF00625Guanylate_kincoord: 167..334
e-value: 3.3E-36
score: 124.7
NoneNo IPR availableGENE3DG3DSA:2.30.30.40coord: 7..157
e-value: 5.4E-20
score: 73.8
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 159..339
e-value: 2.6E-44
score: 152.9
NoneNo IPR availablePANTHERPTHR23122:SF70coord: 15..311
NoneNo IPR availablePANTHERPTHR23122MEMBRANE-ASSOCIATED GUANYLATE KINASE MAGUKcoord: 15..311
IPR020590Guanylate kinase, conserved sitePROSITEPS00856GUANYLATE_KINASE_1coord: 196..213
IPR008144Guanylate kinase-like domainPROSITEPS50052GUANYLATE_KINASE_2coord: 164..340
score: 30.738
IPR001452SH3 domainPROSITEPS50002SH3coord: 14..87
score: 13.983
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 166..345
IPR036028SH3-like domain superfamilySUPERFAMILYSSF50044SH3-domaincoord: 16..108